./0040755000000000000000000000000013365330320007713 5ustar rootrootusr/0040755000000000000000000000000013365330317010375 5ustar rootrootusr/include/0040755000000000000000000000000013365330314012015 5ustar rootrootusr/include/clamav.h0100644000000000000000000007610213365330314013434 0ustar rootroot/* * Copyright (C) 2015 Cisco Systems, Inc. and/or its affiliates. All rights reserved. * Copyright (C) 2007-2013 Sourcefire, Inc. * * Authors: Tomasz Kojm * * This program is free software; you can redistribute it and/or modify * it under the terms of the GNU General Public License version 2 as * published by the Free Software Foundation. * * This program is distributed in the hope that it will be useful, * but WITHOUT ANY WARRANTY; without even the implied warranty of * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the * GNU General Public License for more details. * * You should have received a copy of the GNU General Public License * along with this program; if not, write to the Free Software * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, * MA 02110-1301, USA. */ #ifndef __CLAMAV_H #define __CLAMAV_H #ifdef _WIN32 #ifndef OWN_WINSOCK #include #endif #endif #include #include /* Certain OSs already use 64bit variables in their stat struct */ #if ( !defined(__FreeBSD__) && !defined(__APPLE__) ) #define STAT64_BLACKLIST 1 #else #define STAT64_BLACKLIST 0 #endif #if defined(HAVE_STAT64) && STAT64_BLACKLIST #include #define STATBUF struct stat64 #define CLAMSTAT stat64 #define LSTAT lstat64 #define FSTAT fstat64 #define safe_open(a, b) open(a, b|O_LARGEFILE) #else #define STATBUF struct stat #define CLAMSTAT stat #define LSTAT lstat #define FSTAT fstat /* Nothing is safe in windows, not even open, safe_open defined under /win32 */ #ifndef _WIN32 #define safe_open open #endif #endif #define UNUSEDPARAM(x) (void)(x) #include #include #ifdef __cplusplus extern "C" { #endif #define CL_COUNT_PRECISION 4096 /* return codes */ typedef enum { /* libclamav specific */ CL_CLEAN = 0, CL_SUCCESS = 0, CL_VIRUS, CL_ENULLARG, CL_EARG, CL_EMALFDB, CL_ECVD, CL_EVERIFY, CL_EUNPACK, /* I/O and memory errors */ CL_EOPEN, CL_ECREAT, CL_EUNLINK, CL_ESTAT, CL_EREAD, CL_ESEEK, CL_EWRITE, CL_EDUP, CL_EACCES, CL_ETMPFILE, CL_ETMPDIR, CL_EMAP, CL_EMEM, CL_ETIMEOUT, /* internal (not reported outside libclamav) */ CL_BREAK, CL_EMAXREC, CL_EMAXSIZE, CL_EMAXFILES, CL_EFORMAT, CL_EPARSE, CL_EBYTECODE,/* may be reported in testmode */ CL_EBYTECODE_TESTFAIL, /* may be reported in testmode */ /* c4w error codes */ CL_ELOCK, CL_EBUSY, CL_ESTATE, /* no error codes below this line please */ CL_ELAST_ERROR } cl_error_t; /* db options */ #define CL_DB_PHISHING 0x2 #define CL_DB_PHISHING_URLS 0x8 #define CL_DB_PUA 0x10 #define CL_DB_CVDNOTMP 0x20 /* obsolete */ #define CL_DB_OFFICIAL 0x40 /* internal */ #define CL_DB_PUA_MODE 0x80 #define CL_DB_PUA_INCLUDE 0x100 #define CL_DB_PUA_EXCLUDE 0x200 #define CL_DB_COMPILED 0x400 /* internal */ #define CL_DB_DIRECTORY 0x800 /* internal */ #define CL_DB_OFFICIAL_ONLY 0x1000 #define CL_DB_BYTECODE 0x2000 #define CL_DB_SIGNED 0x4000 /* internal */ #define CL_DB_BYTECODE_UNSIGNED 0x8000 #define CL_DB_UNSIGNED 0x10000 /* internal */ #define CL_DB_BYTECODE_STATS 0x20000 #define CL_DB_ENHANCED 0x40000 #define CL_DB_PCRE_STATS 0x80000 #define CL_DB_YARA_EXCLUDE 0x100000 #define CL_DB_YARA_ONLY 0x200000 /* recommended db settings */ #define CL_DB_STDOPT (CL_DB_PHISHING | CL_DB_PHISHING_URLS | CL_DB_BYTECODE) /* scan options */ #define CL_SCAN_RAW 0x0 #define CL_SCAN_ARCHIVE 0x1 #define CL_SCAN_MAIL 0x2 #define CL_SCAN_OLE2 0x4 #define CL_SCAN_BLOCKENCRYPTED 0x8 #define CL_SCAN_HTML 0x10 #define CL_SCAN_PE 0x20 #define CL_SCAN_BLOCKBROKEN 0x40 #define CL_SCAN_MAILURL 0x80 /* ignored */ #define CL_SCAN_BLOCKMAX 0x100 #define CL_SCAN_ALGORITHMIC 0x200 #define CL_SCAN_PHISHING_BLOCKSSL 0x800 /* ssl mismatches, not ssl by itself*/ #define CL_SCAN_PHISHING_BLOCKCLOAK 0x1000 #define CL_SCAN_ELF 0x2000 #define CL_SCAN_PDF 0x4000 #define CL_SCAN_STRUCTURED 0x8000 #define CL_SCAN_STRUCTURED_SSN_NORMAL 0x10000 #define CL_SCAN_STRUCTURED_SSN_STRIPPED 0x20000 #define CL_SCAN_PARTIAL_MESSAGE 0x40000 #define CL_SCAN_HEURISTIC_PRECEDENCE 0x80000 #define CL_SCAN_BLOCKMACROS 0x100000 #define CL_SCAN_ALLMATCHES 0x200000 #define CL_SCAN_SWF 0x400000 #define CL_SCAN_PARTITION_INTXN 0x800000 #define CL_SCAN_XMLDOCS 0x1000000 #define CL_SCAN_HWP3 0x2000000 #define CL_SCAN_FILE_PROPERTIES 0x10000000 //#define UNUSED 0x20000000 #define CL_SCAN_PERFORMANCE_INFO 0x40000000 /* collect performance timings */ #define CL_SCAN_INTERNAL_COLLECT_SHA 0x80000000 /* Enables hash output in sha-collect builds - for internal use only */ /* recommended scan settings */ #define CL_SCAN_STDOPT (CL_SCAN_ARCHIVE | CL_SCAN_MAIL | CL_SCAN_OLE2 | CL_SCAN_PDF | CL_SCAN_HTML | CL_SCAN_PE | CL_SCAN_ALGORITHMIC | CL_SCAN_ELF | CL_SCAN_SWF | CL_SCAN_XMLDOCS | CL_SCAN_HWP3) /* cl_countsigs options */ #define CL_COUNTSIGS_OFFICIAL 0x1 #define CL_COUNTSIGS_UNOFFICIAL 0x2 #define CL_COUNTSIGS_ALL (CL_COUNTSIGS_OFFICIAL | CL_COUNTSIGS_UNOFFICIAL) /* For the new engine_options bit field in the engine */ #define ENGINE_OPTIONS_NONE 0x0 #define ENGINE_OPTIONS_DISABLE_CACHE 0x1 #define ENGINE_OPTIONS_FORCE_TO_DISK 0x2 #define ENGINE_OPTIONS_DISABLE_PE_STATS 0x4 #define ENGINE_OPTIONS_DISABLE_PE_CERTS 0x8 #define ENGINE_OPTIONS_PE_DUMPCERTS 0x10 struct cl_engine; struct cl_settings; /** * Initialize the crypto system. * @return Always returns 0 */ int cl_initialize_crypto(void); /** * Cleanup the crypto system prior to program exit */ void cl_cleanup_crypto(void); #define CL_INIT_DEFAULT 0x0 extern int cl_init(unsigned int initoptions); extern struct cl_engine *cl_engine_new(void); extern void cl_always_gen_section_hash(void); enum cl_engine_field { CL_ENGINE_MAX_SCANSIZE, /* uint64_t */ CL_ENGINE_MAX_FILESIZE, /* uint64_t */ CL_ENGINE_MAX_RECURSION, /* uint32_t */ CL_ENGINE_MAX_FILES, /* uint32_t */ CL_ENGINE_MIN_CC_COUNT, /* uint32_t */ CL_ENGINE_MIN_SSN_COUNT, /* uint32_t */ CL_ENGINE_PUA_CATEGORIES, /* (char *) */ CL_ENGINE_DB_OPTIONS, /* uint32_t */ CL_ENGINE_DB_VERSION, /* uint32_t */ CL_ENGINE_DB_TIME, /* time_t */ CL_ENGINE_AC_ONLY, /* uint32_t */ CL_ENGINE_AC_MINDEPTH, /* uint32_t */ CL_ENGINE_AC_MAXDEPTH, /* uint32_t */ CL_ENGINE_TMPDIR, /* (char *) */ CL_ENGINE_KEEPTMP, /* uint32_t */ CL_ENGINE_BYTECODE_SECURITY, /* uint32_t */ CL_ENGINE_BYTECODE_TIMEOUT, /* uint32_t */ CL_ENGINE_BYTECODE_MODE, /* uint32_t */ CL_ENGINE_MAX_EMBEDDEDPE, /* uint64_t */ CL_ENGINE_MAX_HTMLNORMALIZE, /* uint64_t */ CL_ENGINE_MAX_HTMLNOTAGS, /* uint64_t */ CL_ENGINE_MAX_SCRIPTNORMALIZE, /* uint64_t */ CL_ENGINE_MAX_ZIPTYPERCG, /* uint64_t */ CL_ENGINE_FORCETODISK, /* uint32_t */ CL_ENGINE_DISABLE_CACHE, /* uint32_t */ CL_ENGINE_DISABLE_PE_STATS, /* uint32_t */ CL_ENGINE_STATS_TIMEOUT, /* uint32_t */ CL_ENGINE_MAX_PARTITIONS, /* uint32_t */ CL_ENGINE_MAX_ICONSPE, /* uint32_t */ CL_ENGINE_MAX_RECHWP3, /* uint32_t */ CL_ENGINE_TIME_LIMIT, /* uint32_t */ CL_ENGINE_PCRE_MATCH_LIMIT, /* uint64_t */ CL_ENGINE_PCRE_RECMATCH_LIMIT, /* uint64_t */ CL_ENGINE_PCRE_MAX_FILESIZE, /* uint64_t */ CL_ENGINE_DISABLE_PE_CERTS, /* uint32_t */ CL_ENGINE_PE_DUMPCERTS /* uint32_t */ }; enum bytecode_security { CL_BYTECODE_TRUST_ALL=0, /* obsolete */ CL_BYTECODE_TRUST_SIGNED, /* default */ CL_BYTECODE_TRUST_NOTHING /* paranoid setting */ }; enum bytecode_mode { CL_BYTECODE_MODE_AUTO=0, /* JIT if possible, fallback to interpreter */ CL_BYTECODE_MODE_JIT, /* force JIT */ CL_BYTECODE_MODE_INTERPRETER, /* force interpreter */ CL_BYTECODE_MODE_TEST, /* both JIT and interpreter, compare results, all failures are fatal */ CL_BYTECODE_MODE_OFF /* for query only, not settable */ }; struct cli_section_hash { unsigned char md5[16]; size_t len; }; typedef struct cli_stats_sections { size_t nsections; struct cli_section_hash *sections; } stats_section_t; extern int cl_engine_set_num(struct cl_engine *engine, enum cl_engine_field field, long long num); extern long long cl_engine_get_num(const struct cl_engine *engine, enum cl_engine_field field, int *err); extern int cl_engine_set_str(struct cl_engine *engine, enum cl_engine_field field, const char *str); extern const char *cl_engine_get_str(const struct cl_engine *engine, enum cl_engine_field field, int *err); extern struct cl_settings *cl_engine_settings_copy(const struct cl_engine *engine); extern int cl_engine_settings_apply(struct cl_engine *engine, const struct cl_settings *settings); extern int cl_engine_settings_free(struct cl_settings *settings); extern int cl_engine_compile(struct cl_engine *engine); extern int cl_engine_addref(struct cl_engine *engine); extern int cl_engine_free(struct cl_engine *engine); extern void cli_cache_disable(void); extern int cli_cache_enable(struct cl_engine *engine); /* CALLBACKS */ /* I certainly wish I could declare the callback protos stable and move on to better things. But real life crossed my way enough times already and what looked perfect had to evolve somehow. So all I can say is I'll try my best not to break these things in the long run. But I just can't guarantee that won't happen (again). */ typedef cl_error_t (*clcb_pre_cache)(int fd, const char *type, void *context); /* PRE-CACHE Called for each processed file (both the entry level - AKA 'outer' - file and inner files - those generated when processing archive and container files), before the actual scanning takes place. Input: fd = File descriptor which is about to be scanned type = File type detected via magic - i.e. NOT on the fly - (e.g. "CL_TYPE_MSEXE") context = Opaque application provided data Output: CL_CLEAN = File is scanned CL_BREAK = Whitelisted by callback - file is skipped and marked as clean CL_VIRUS = Blacklisted by callback - file is skipped and marked as infected */ extern void cl_engine_set_clcb_pre_cache(struct cl_engine *engine, clcb_pre_cache callback); typedef cl_error_t (*clcb_pre_scan)(int fd, const char *type, void *context); /* PRE-SCAN Called for each NEW file (inner and outer) before the scanning takes place. This is roughly the the same as clcb_before_cache, but it is affected by clean file caching. This means that it won't be called if a clean cached file (inner or outer) is scanned a second time. Input: fd = File descriptor which is about to be scanned type = File type detected via magic - i.e. NOT on the fly - (e.g. "CL_TYPE_MSEXE") context = Opaque application provided data Output: CL_CLEAN = File is scanned CL_BREAK = Whitelisted by callback - file is skipped and marked as clean CL_VIRUS = Blacklisted by callback - file is skipped and marked as infected */ extern void cl_engine_set_clcb_pre_scan(struct cl_engine *engine, clcb_pre_scan callback); typedef cl_error_t (*clcb_post_scan)(int fd, int result, const char *virname, void *context); /* POST-SCAN Called for each processed file (inner and outer), after the scanning is complete. Input: fd = File descriptor which is was scanned result = The scan result for the file virname = Virus name if infected context = Opaque application provided data Output: CL_CLEAN = Scan result is not overridden CL_BREAK = Whitelisted by callback - scan result is set to CL_CLEAN CL_VIRUS = Blacklisted by callback - scan result is set to CL_VIRUS */ extern void cl_engine_set_clcb_post_scan(struct cl_engine *engine, clcb_post_scan callback); typedef void (*clcb_virus_found)(int fd, const char *virname, void *context); /* VIRUS FOUND Called for each virus found. Input: fd = File descriptor which is was scanned virname = Virus name context = Opaque application provided data Output: none */ extern void cl_engine_set_clcb_virus_found(struct cl_engine *engine, clcb_virus_found callback); typedef int (*clcb_sigload)(const char *type, const char *name, unsigned int custom, void *context); /* SIGNATURE LOAD Input: type = The signature type (e.g. "db", "ndb", "mdb", etc.) name = The virus name custom = The signature is official (custom == 0) or custom (custom != 0) context = Opaque application provided data Output: 0 = Load the current signature Non 0 = Skip the current signature WARNING: Some signatures (notably ldb, cbc) can be dependent upon other signatures. Failure to preserve dependency chains will result in database loading failure. It is the implementor's responsibility to guarantee consistency. */ extern void cl_engine_set_clcb_sigload(struct cl_engine *engine, clcb_sigload callback, void *context); /* LibClamAV messages callback * The specified callback will be called instead of logging to stderr. * Messages of lower severity than specified are logged as usual. * * Just like with cl_debug() this must be called before going multithreaded. * Callable before cl_init, if you want to log messages from cl_init() itself. * * You can use context of cl_scandesc_callback to convey more information to the callback (such as the filename!) * Note: setting a 2nd callbacks overwrites previous, multiple callbacks are not * supported */ enum cl_msg { /* leave room for more message levels in the future */ CL_MSG_INFO_VERBOSE = 32, /* verbose */ CL_MSG_WARN = 64, /* LibClamAV WARNING: */ CL_MSG_ERROR = 128/* LibClamAV ERROR: */ }; typedef void (*clcb_msg)(enum cl_msg severity, const char *fullmsg, const char *msg, void *context); extern void cl_set_clcb_msg(clcb_msg callback); /* LibClamAV hash stats callback */ typedef void (*clcb_hash)(int fd, unsigned long long size, const unsigned char *md5, const char *virname, void *context); extern void cl_engine_set_clcb_hash(struct cl_engine *engine, clcb_hash callback); /* Archive member metadata callback. Return CL_VIRUS to blacklist, CL_CLEAN to * continue scanning */ typedef cl_error_t (*clcb_meta)(const char* container_type, unsigned long fsize_container, const char *filename, unsigned long fsize_real, int is_encrypted, unsigned int filepos_container, void *context); extern void cl_engine_set_clcb_meta(struct cl_engine *engine, clcb_meta callback); /* File properties callback */ typedef int (*clcb_file_props)(const char *j_propstr, int rc, void *cbdata); extern void cl_engine_set_clcb_file_props(struct cl_engine *engine, clcb_file_props callback); /* Statistics/intelligence gathering callbacks */ extern void cl_engine_set_stats_set_cbdata(struct cl_engine *engine, void *cbdata); typedef void (*clcb_stats_add_sample)(const char *virname, const unsigned char *md5, size_t size, stats_section_t *sections, void *cbdata); extern void cl_engine_set_clcb_stats_add_sample(struct cl_engine *engine, clcb_stats_add_sample callback); typedef void (*clcb_stats_remove_sample)(const char *virname, const unsigned char *md5, size_t size, void *cbdata); extern void cl_engine_set_clcb_stats_remove_sample(struct cl_engine *engine, clcb_stats_remove_sample callback); typedef void (*clcb_stats_decrement_count)(const char *virname, const unsigned char *md5, size_t size, void *cbdata); extern void cl_engine_set_clcb_stats_decrement_count(struct cl_engine *engine, clcb_stats_decrement_count callback); typedef void (*clcb_stats_submit)(struct cl_engine *engine, void *cbdata); extern void cl_engine_set_clcb_stats_submit(struct cl_engine *engine, clcb_stats_submit callback); typedef void (*clcb_stats_flush)(struct cl_engine *engine, void *cbdata); extern void cl_engine_set_clcb_stats_flush(struct cl_engine *engine, clcb_stats_flush callback); typedef size_t (*clcb_stats_get_num)(void *cbdata); extern void cl_engine_set_clcb_stats_get_num(struct cl_engine *engine, clcb_stats_get_num callback); typedef size_t (*clcb_stats_get_size)(void *cbdata); extern void cl_engine_set_clcb_stats_get_size(struct cl_engine *engine, clcb_stats_get_size callback); typedef char * (*clcb_stats_get_hostid)(void *cbdata); extern void cl_engine_set_clcb_stats_get_hostid(struct cl_engine *engine, clcb_stats_get_hostid callback); extern void cl_engine_stats_enable(struct cl_engine *engine); struct cl_stat { char *dir; STATBUF *stattab; char **statdname; unsigned int entries; }; struct cl_cvd { /* field no. */ char *time; /* 2 */ unsigned int version; /* 3 */ unsigned int sigs; /* 4 */ unsigned int fl; /* 5 */ /* padding */ char *md5; /* 6 */ char *dsig; /* 7 */ char *builder; /* 8 */ unsigned int stime; /* 9 */ }; /* file scanning */ extern int cl_scandesc(int desc, const char **virname, unsigned long int *scanned, const struct cl_engine *engine, unsigned int scanoptions); extern int cl_scandesc_callback(int desc, const char **virname, unsigned long int *scanned, const struct cl_engine *engine, unsigned int scanoptions, void *context); extern int cl_scanfile(const char *filename, const char **virname, unsigned long int *scanned, const struct cl_engine *engine, unsigned int scanoptions); extern int cl_scanfile_callback(const char *filename, const char **virname, unsigned long int *scanned, const struct cl_engine *engine, unsigned int scanoptions, void *context); /* database handling */ extern int cl_load(const char *path, struct cl_engine *engine, unsigned int *signo, unsigned int dboptions); extern const char *cl_retdbdir(void); /* engine handling */ /* CVD */ extern struct cl_cvd *cl_cvdhead(const char *file); extern struct cl_cvd *cl_cvdparse(const char *head); extern int cl_cvdverify(const char *file); extern void cl_cvdfree(struct cl_cvd *cvd); /* db dir stat functions */ extern int cl_statinidir(const char *dirname, struct cl_stat *dbstat); extern int cl_statchkdir(const struct cl_stat *dbstat); extern int cl_statfree(struct cl_stat *dbstat); /* count signatures */ extern int cl_countsigs(const char *path, unsigned int countoptions, unsigned int *sigs); /* enable debug messages */ extern void cl_debug(void); /* software versions */ extern unsigned int cl_retflevel(void); extern const char *cl_retver(void); /* others */ extern const char *cl_strerror(int clerror); /* custom data scanning */ struct cl_fmap; typedef struct cl_fmap cl_fmap_t; /* handle - the handle passed to cl_fmap_open_handle, its meaning is up to the * callback's implementation * buf, count, offset - read 'count' bytes starting at 'offset' into the buffer 'buf' * Thread safety: it is guaranteed that only one callback is executing for a specific handle at * any time, but there might be multiple callbacks executing for different * handle at the same time. */ typedef off_t (*clcb_pread)(void* handle, void *buf, size_t count, off_t offset); /* Open a map for scanning custom data accessed by a handle and pread (lseek + * read)-like interface. For example a WIN32 HANDLE. * By default fmap will use aging to discard old data, unless you tell it not * to. * The handle will be passed to the callback each time. */ extern cl_fmap_t *cl_fmap_open_handle(void* handle, size_t offset, size_t len, clcb_pread, int use_aging); /* Open a map for scanning custom data, where the data is already in memory, * either in the form of a buffer, a memory mapped file, etc. * Note that the memory [start, start+len) must be the _entire_ file, * you can't give it parts of a file and expect detection to work. */ extern cl_fmap_t *cl_fmap_open_memory(const void *start, size_t len); /* Releases resources associated with the map, you should release any resources * you hold only after (handles, maps) calling this function */ extern void cl_fmap_close(cl_fmap_t*); /* Scan custom data */ extern int cl_scanmap_callback(cl_fmap_t *map, const char **virname, unsigned long int *scanned, const struct cl_engine *engine, unsigned int scanoptions, void *context); /* Crypto/hashing functions */ #define SHA1_HASH_SIZE 20 #define SHA256_HASH_SIZE 32 /** Generate a hash of data. @param[in] alg The hashing algorithm to use @param[in] buf The data to be hashed @param[in] len The length of the to-be-hashed data @param[out] obuf An optional buffer to store the generated hash. Use NULL to dynamically allocate buffer. @param[out] olen An optional pointer that stores how long the generated hash is. @return A pointer to the generated hash or obuf if obuf is not NULL. */ unsigned char *cl_hash_data(char *alg, const void *buf, size_t len, unsigned char *obuf, unsigned int *olen); /** Generate a hash of a file. @param[in] ctx A pointer to the OpenSSL EVP_MD_CTX object @param[in] fd The file descriptor @param[out] olen An optional pointer that stores how long the generated hash is @return A pointer to a dynamically-created buffer that holds the generated hash */ unsigned char *cl_hash_file_fd_ctx(EVP_MD_CTX *ctx, int fd, unsigned int *olen); /** Generate a hash of a file. @param[in] fd The file descriptor @param[in] alg The hashing algorithm to use @param[out] olen An optional pointer that stores how long the generated hash is @return A pointer to a dynamically-created buffer that holds the generated hash */ unsigned char *cl_hash_file_fd(int fd, char *alg, unsigned int *olen); /** Generate a hash of a file. @param[in] fp A pointer to a FILE object @param[in] alg The hashing algorithm to use @param[out] olen An optional pointer that stores how long the generated hash is @return A pointer to a dynamically-created buffer that holds the generated hash */ unsigned char *cl_hash_file_fp(FILE *fp, char *alg, unsigned int *olen); /** Generate a sha256 hash of data @param[in] buf The data to hash @param[in] len The length of the to-be-hashed data @param[out] obuf An optional pointer to store the generated hash. Use NULL to dynamically allocate buffer. @param[out] olen An optional pointer that stores how long the generated hash is. @return A pointer to the buffer that holds the generated hash */ unsigned char *cl_sha256(const void *buf, size_t len, unsigned char *obuf, unsigned int *olen); /** Generate a sha1 hash of data @param[in] buf The data to hash @param[in] len The length of the to-be-hashed data @param[out] obuf An optional pointer to store the generated hash. Use NULL to dynamically allocate buffer. @param[out] olen An optional pointer that stores how long the generated hash is. @return A pointer to the buffer that holds the generated hash or obuf if obuf is not NULL */ unsigned char *cl_sha1(const void *buf, size_t len, unsigned char *obuf, unsigned int *olen); /** Verify validity of signed data @param[in] pkey The public key of the keypair that signed the data @param[in] alg The algorithm used to hash the data @param[in] sig The signature block @param[in] siglen The length of the signature @param[in] data The data that was signed @param[in] datalen The length of the data @param[in] decode Whether or not to base64-decode the signature prior to verification. 1 for yes, 0 for no. @return 0 for success, -1 for error or invalid signature */ int cl_verify_signature(EVP_PKEY *pkey, char *alg, unsigned char *sig, unsigned int siglen, unsigned char *data, size_t datalen, int decode); /** Verify validity of signed data @param[in] pkey The public key of the keypair that signed the data @param[in] alg The algorithm used to hash the data @param[in] sig The signature block @param[in] siglen The length of the signature @param[in] digest The hash of the signed data @return 0 for success, -1 for error or invalid signature */ int cl_verify_signature_hash(EVP_PKEY *pkey, char *alg, unsigned char *sig, unsigned int siglen, unsigned char *digest); /** Verify validity of signed data @param[in] pkey The public key of the keypair that signed the data @param[in] alg The algorithm used to hash the data @param[in] sig The signature block @param[in] siglen The length of the signature @param[in] fd The file descriptor @return 0 for success, -1 for error or invalid signature */ int cl_verify_signature_fd(EVP_PKEY *pkey, char *alg, unsigned char *sig, unsigned int siglen, int fd); /** Verify validity of signed data @param[in] x509path The path to the public key of the keypair that signed the data @param[in] alg The algorithm used to hash the data @param[in] sig The signature block @param[in] siglen The length of the signature @param[in] digest The hash of the signed data @return 0 for success, -1 for error or invalid signature */ int cl_verify_signature_hash_x509_keyfile(char *x509path, char *alg, unsigned char *sig, unsigned int siglen, unsigned char *digest); /** Verify validity of signed data @param[in] x509path The path to the public key of the keypair that signed the data @param[in] alg The algorithm used to hash the data @param[in] sig The signature block @param[in] siglen The length of the signature @param[in] fd The file descriptor @return 0 for success, -1 for error or invalid signature */ int cl_verify_signature_fd_x509_keyfile(char *x509path, char *alg, unsigned char *sig, unsigned int siglen, int fd); /** Verify validity of signed data @param[in] x509path The path to the public key of the keypair that signed the data @param[in] alg The algorithm used to hash the data @param[in] sig The signature block @param[in] siglen The length of the signature @param[in] data The data that was signed @param[in] datalen The length of the data @param[in] decode Whether or not to base64-decode the signature prior to verification. 1 for yes, 0 for no. @return 0 for success, -1 for error or invalid signature */ int cl_verify_signature_x509_keyfile(char *x509path, char *alg, unsigned char *sig, unsigned int siglen, unsigned char *data, size_t datalen, int decode); /** Verify validity of signed data @param[in] x509 The X509 object of the public key of the keypair that signed the data @param[in] alg The algorithm used to hash the data @param[in] sig The signature block @param[in] siglen The length of the signature @param[in] digest The hash of the signed data @return 0 for success, -1 for error or invalid signature */ int cl_verify_signature_hash_x509(X509 *x509, char *alg, unsigned char *sig, unsigned int siglen, unsigned char *digest); /** Verify validity of signed data @param[in] x509 The X509 object of the public key of the keypair that signed the data @param[in] alg The algorithm used to hash the data @param[in] sig The signature block @param[in] siglen The length of the signature @param[in] fd The file descriptor @return 0 for success, -1 for error or invalid signature */ int cl_verify_signature_fd_x509(X509 *x509, char *alg, unsigned char *sig, unsigned int siglen, int fd); /** Verify validity of signed data @param[in] x509 The X509 object of the public key of the keypair that signed the data @param[in] alg The algorithm used to hash the data @param[in] sig The signature block @param[in] siglen The length of the signature @param[in] data The data that was signed @param[in] datalen The length of the data @param[in] decode Whether or not to base64-decode the signature prior to verification. 1 for yes, 0 for no. @return 0 for success, -1 for error or invalid signature */ int cl_verify_signature_x509(X509 *x509, char *alg, unsigned char *sig, unsigned int siglen, unsigned char *data, size_t datalen, int decode); /** Get an X509 object from memory * @param[in] data A pointer to a spot in memory that contains the PEM X509 cert * @param[in] len The length of the data * @return a pointer to the X509 object on success, NULL on error */ X509 *cl_get_x509_from_mem(void *data, unsigned int len); /** Validate an X509 certificate chain, with the chain being located in a directory @param[in] tsdir The path to the trust store directory @param[in] certpath The path to the X509 certificate to be validated. @return 0 for success, -1 for error or invalid certificate. */ int cl_validate_certificate_chain_ts_dir(char *tsdir, char *certpath); /** Validate an X509 certificate chain with support for a CRL @param[in] authorities A NULL-terminated array of strings that hold the path of the CA's X509 certificate @param[in] crlpath An optional path to the CRL file. NULL if no CRL. @param[in] certpath The path to the X509 certificate to be validated. @return 0 for success, -1 for error or invalid certificate. */ int cl_validate_certificate_chain(char **authorities, char *crlpath, char *certpath); /** Load an X509 certificate from a file @param[in] certpath The path to the X509 certificate */ X509 *cl_load_cert(const char *certpath); /** Parse an ASN1_TIME object @param[in] timeobj The ASN1_TIME object @return A pointer to a (struct tm). Adjusted for time zone and daylight savings time. */ struct tm *cl_ASN1_GetTimeT(ASN1_TIME *timeobj); /** Load a CRL file into an X509_CRL object @param[in] file The path to the CRL @return A pointer to an X509_CRL object or NULL on error. */ X509_CRL *cl_load_crl(const char *timeobj); /** Sign data with a key stored on disk @param[in] keypath The path to the RSA private key @param[in] alg The hash/signature algorithm to use @param[in] hash The hash to sign @param[out] olen A pointer that stores the size of the signature @param[in] Whether or not to base64-encode the signature. 1 for yes, 0 for no. @return The generated signature */ unsigned char *cl_sign_data_keyfile(char *keypath, char *alg, unsigned char *hash, unsigned int *olen, int encode); /** Sign data with an RSA private key object @param[in] pkey The RSA private key object @param[in] alg The hash/signature algorithm to use @param[in] hash The hash to sign @param[out] olen A pointer that stores the size of the signature @param[in] Whether or not to base64-encode the signature. 1 for yes, 0 for no. @return The generated signature */ unsigned char *cl_sign_data(EVP_PKEY *pkey, char *alg, unsigned char *hash, unsigned int *olen, int encode); /** Sign a file with an RSA private key object @param[in] fd The file descriptor @param[in] pkey The RSA private key object @param[in] alg The hash/signature algorithm to use @param[out] olen A pointer that stores the size of the signature @param[in] encode Whether or not to base64-encode the signature. 1 for yes, 0 for no. */ unsigned char *cl_sign_file_fd(int fd, EVP_PKEY *pkey, char *alg, unsigned int *olen, int encode); /** Sign a file with an RSA private key object @param[in] fp A pointer to a FILE object @param[in] pkey The RSA private key object @param[in] alg The hash/signature algorithm to use @param[out] olen A pointer that stores the size of the signature @param[in] encode Whether or not to base64-encode the signature. 1 for yes, 0 for no. */ unsigned char *cl_sign_file_fp(FILE *fp, EVP_PKEY *pkey, char *alg, unsigned int *olen, int encode); /** Get the Private Key stored on disk * @param[in] keypath The path on disk where the private key is stored * @return A pointer to the EVP_PKEY object that contains the private key in memory */ EVP_PKEY *cl_get_pkey_file(char *keypath); void *cl_hash_init(const char *alg); int cl_update_hash(void *ctx, void *data, size_t sz); int cl_finish_hash(void *ctx, void *buf); void cl_hash_destroy(void *ctx); /* End of crypto/hashing functions */ #ifdef __cplusplus } #endif #endif /* __CLAMAV_H */ usr/sbin/0040755000000000000000000000000013365330320011322 5ustar rootrootusr/sbin/clamd0100755000000000000000000053717013365330320012342 0ustar rootrootELF> ]@@8@8 @@@@@@88@8@@@|F|F 8Q8Qb8Qbdl ``b`bppTT@T@ Ptd0&0&B0&BQtdRtd8Q8Qb8Qb^^/lib64/ld-linux-x86-64.so.2GNU iFP`k7q1lDJj&=.YfLo<2x|vzpZy6eth9E"OQ}) su3wr+5g  * /8#($0VK!\H,C-B[m?n@'{d:RMcUa>NS~ W^%TA]_b;I XG4]%> mpXNc edB Q |xx0hRAi !MZ,bD 6C R '5q5^aLA IbYeW 3&j% (bf(2@X{@#7+91 Pb4t< )Q (bl*wmKD*b=by^ :@`libclamav.so.7cl_engine_settings_copycli_unlinkmpool_getstats__gmon_start___Jv_RegisterClassescl_loadcl_engine_get_numcl_initcl_statfreecl_engine_set_clcb_virus_foundcl_engine_newcli_rndnumcl_scanfile_callback_ITM_deregisterTMCloneTablecl_engine_compilecli_strerror_ITM_registerTMCloneTablecli_calloccl_engine_settings_applycli_ctimecl_engine_set_clcb_hashcl_retdbdircli_chompcl_statchkdircli_malloccl_cvdheadcl_statinidircl_engine_settings_freecl_strerrorcli_regexeccl_set_clcb_msgcl_retflevelcl_engine_freecli_ftwcli_gentempfdcl_cvdfreecl_debugcl_scandesc_callbackcli_regfreecli_filecopycl_engine_set_strcli_realloccl_cleanup_cryptocli_writencl_engine_addrefcl_engine_set_numcli_regcompcl_retverlibxml2.so.2_finiliblzma.so.5libbz2.so.1libltdl.so.7libdl.so.2libssl.so.1libcrypto.so.1libz.so.1libjson-c.so.2libpcre.so.1libm.so.6libclammspack.so.0libpthread.so.0pthread_cond_initpthread_mutex_destroysendpthread_sigmaskpthread_mutex_initpthread_cond_waitpthread_exitpthread_cond_destroyrecv__errno_locationpthread_oncepthread_killpthread_mutex_lockpthread_setspecificpthread_cond_signalpthread_cond_timedwaitacceptlseek64fcntlpthread_createpthread_joinsigactionpthread_getspecificpthread_attr_initpthread_key_createconnectpthread_cond_broadcastpthread_attr_destroypthread_mutex_unlockpthread_attr_setdetachstaterecvmsgwaitpidlibc.so.6setuidsocketfflushinotify_init1sprintfgai_strerrorstrncmpoptindstrrchrpipe__strdupperrorftruncate64fts64_childreninitgroupsinet_ntoainet_ntopstrncpyforksigprocmasksigfillsetinotify_rm_watchputcharlistenselectmkdirmemchrgetpidfts64_openfanotify_initstrftimechmodlocaltime_rstrtolsyslogexeclefgetsgetpwnamstrlensigemptysetopenloggetaddrinfomemsetstrstrbindchdirmemcmpgetnameinfodup2__fxstat64shutdownvsnprintfpollsigaddsetgetgrnamstdoutfputsfclosestrtoulsetsockoptstrcatumaskstrcasecmpgetpeername__strndup__xstat64getenvoptargstderrsigdelsetsetrlimit64optoptreadlinkmallinfofilenochownfwritegettimeofdayrenamefanotify_markgeteuidstrerror_rstrchrfprintfinotify_add_watchsleepfreeaddrinfosetsidgetrlimit64memmovefopen64accessfts64_readopterrsetgidstrcmp__libc_start_mainstpcpycloselogfts64_close__cxa_atexit_edata__bss_start_endGLIBC_2.3.2GLIBC_2.2.5GLIBC_2.4GLIBC_2.9GLIBC_2.13GLIBC_2.23CLAMAV_PRIVATECLAMAV_PUBLIC   0ri 6 ui B `ii N ii X b m ui B Ex Ӈ_  Яbدbb=bJbbb b(b0b8b@bHbPbXb `b hb pb xb bbbbbbbbbȰbаbذbbbbbb b!b"b# b$(b%0b&8b(@b)Hb*Pb+Xb,`b-hb.pb/xb0b1b2b4b5b6b7b8b9b:ȱb;бb<رb>b?b@bAbBbCbDbEbF bG(bH0bI8bK@bLHbMPbNXbO`bPhbQpbRxbSbTbUbVbWbXbYbZb[b\Ȳb]вb^زb_b`babbbcbdbebfbg bh(bi0bj8bk@blHbmPbnXbo`bphbqpbrxbtbubvbwbxbybzb{b|b}ȳb~гbسbbbbbbbbb b(b0b8b@bHbPbXb`bhbpbxbbbbbbbbbbȴbдbشbbbbbbbbb b(b0b8b@bHbPbXb`bhbpbxbbbbbbbbbbȵbеbصbbbbHHu"Ht .$ H5u"%u"@%u"h%u"h%u"h%u"h%u"h%u"h%u"h%u"hp%u"h`%u"h P%u"h @%zu"h 0%ru"h %ju"h %bu"h%Zu"h%Ru"h%Ju"h%Bu"h%:u"h%2u"h%*u"h%"u"h%u"hp%u"h`% u"hP%u"h@%t"h0%t"h %t"h%t"h%t"h%t"h %t"h!%t"h"%t"h#%t"h$%t"h%%t"h&%t"h'p%t"h(`%t"h)P%t"h*@%zt"h+0%rt"h, %jt"h-%bt"h.%Zt"h/%Rt"h0%Jt"h1%Bt"h2%:t"h3%2t"h4%*t"h5%"t"h6%t"h7p%t"h8`% t"h9P%t"h:@%s"h;0%s"h< %s"h=%s"h>%s"h?%s"h@%s"hA%s"hB%s"hC%s"hD%s"hE%s"hF%s"hGp%s"hH`%s"hIP%s"hJ@%zs"hK0%rs"hL %js"hM%bs"hN%Zs"hO%Rs"hP%Js"hQ%Bs"hR%:s"hS%2s"hT%*s"hU%"s"hV%s"hWp%s"hX`% s"hYP%s"hZ@%r"h[0%r"h\ %r"h]%r"h^%r"h_%r"h`%r"ha%r"hb%r"hc%r"hd%r"he%r"hf%r"hgp%r"hh`%r"hiP%r"hj@%zr"hk0%rr"hl %jr"hm%br"hn%Zr"ho%Rr"hp%Jr"hq%Br"hr%:r"hs%2r"ht%*r"hu%"r"hv%r"hwp%r"hx`% r"hyP%r"hz@%q"h{0%q"h| %q"h}%q"h~%q"h%q"h%q"h%q"h%q"h%q"h%q"h%q"h%q"hp%q"h`%q"hP%q"h@%zq"h0%rq"h %jq"h%bq"h%Zq"h%Rq"h%Jq"h%Bq"h%:q"h%2q"h%*q"h%"q"h%q"hp%q"h`% q"hP%q"h@%p"h0%p"h %p"h%p"h%p"h%p"h%p"h%p"h%p"h%p"h%p"h%p"h%p"hp%p"h`%p"hP%p"h@%zp"h0%rp"h %jp"h%bp"h%Zp"h%Rp"h%Jp"h%Bp"h%:p"h%2p"h%*p"h%"p"h%p"hp%p"h`% p"hP%p"h@%o"h0%i"fAWAVAUATAUSHHxD$HD$ D$TTH$AĹ11HHHHDŽ$1H H1E1jAHD 0HHt"_AXH51H.p 0H=lt"H5w.x E~vAELd'fDH5Ht$HL9tDH+H5 HuH=s"H5L!.x mHn"fH=s"H5-HXHHHP5s"1E1ɹ1HA/HHHs"ZYHH5fH-x E1H=Bs"H55f-x Hm"H5;H=s"f?-H=s"P H59H+n"f-H=r"P H5Hr"f,H-m"H@H5H=r"HE,H}@ Hm"Hm"ffH=r"H5,H=qr"HPH59Hm"f,x Hfm"HH=8r"H5\,x ^1[H=H11A|$HH5 H=#HB11\|$t]DHT$ HsH=z11ACHsH=1,/H=k"H5ވ%x HH[k"H=^k"H5x%x iH=Ak"H5e%H@H=HHD$1H=k"H5l8%x H=j"H5d%x IPH=11E1[$VIvH=ݐ1@IVJ|=H5ː1II~HD $D<$Nd=A$Mv0MI~E1HDHHJt9,HHuH=1AH=j",AT$H5XH=P1E1H=i"H5}$x H=i"H5}#x tHPH=i" bH5H=i"H50H=yi"H=}i"H5#x HH=`i"H5#x tH=7i"8H=1i"H5U#x AH=i"H54#x YH=h"H5#x Ht^LpH5LH5#LtH=u0H=h"¾H=yh"H5s"x uA H=Uh"H5ry"x t\HhH5Ht/H5HtH5H҃H=g"H=g"H5~"x tHPH=g"H=g"H5!x AH=g"H5!x 8H=tg"H5!x HAH5Dg"H|$HT$DrvH|$dH=!g"H59E!x t$H=1H=f"H5!x$tHPH=f"H=f"H5؂ x$tHPH=f" YH=vf"qEgKH-1a"EffGt$H=1A2HZ"HSH5AH81CH=e" cH= 1teH=e"|AH=H16H=)1#H=e"H5}x IiAfH=AYH=1"H=J1A?H=e" H=L1A}H=l7AH=H1DH=1'$H=d"H5 |A$.ADx H=1AHXPH=1H=d" HPH=c" HuH=Ċ1H=G1AixH=e1V)H=71CAFA$.ADH=c"H;t+AJH=KH1HqiHdRH=8c""9)H=H1AH=b"vH=-1E11E1^IwH=1L $gL $IWH51J| lIHDE Nd MA$M0MIE1HDHL $HJt KHHL $nH=ď1AO H=H L%b"Hb"DH|$ !AfEHa"H=FHa"CtrHa"Ha"f8yH=HdH=W10QA^HuH=H1 18AH=H1 RH=>a"H5wbx fE#ŋD$H|$ pHHQT$H=`"HD$ L,JAEH=`"H5 ux tuH=`"H5uHhHt$( HAHD$(8tH/H DhH=[`"H5tHxDH=1`"H5tUx H=`"H5t8HxHt$(5HD$(8H=_"H5!tHxu+D$KH=H12 AH=_"H5tAHpH=1 jH=V_"H5sAoHpH=H1 53A $H=_"H5s&x It^E1Ll$Hl$ A:auzluzluzIDH ^"LHD M0M-IWHuH ^"Ht$H|$ 1DA,H=H1 SH=@H f1I^HHPTIQAHQAHF@fDH=X"HX"UH)HHvHnR"Ht ]fD]@f.H=X"H5X"UH)HHHH?HHtH)R"Ht ]f]@f.=YX"ubUHW!HPX"HATSHK!L%H-R"H}Ht HEHH[]3fAWAVAUATUSHH$8H$@H$HL$PL$Xt@)$`)$p)$)$)$)$)$)$HQ"f8tH[]A\A]A^A_@HAK"HD$D$0L0H$ HD$ H$0HD$(IIIoHD$(1AHD$ HL9sO|%uHD"A1D\$ Ƅ$:HD$ HD$h1I7AHD$(3E4Du EtAtMMI7HHۉH,HUHuH}uMD\$LLc\$ cH5VLHHD$HD$xD$HD$ Dd$(HD$XH$HD$ HD$dHD$PH$@HD$@MH$@HT$HUHHl$xHH!%tDHVHD@HH1H)fHH t X9|HcHHD$ Hl$xHGE<#;H5OH t- Hu  HuD\$0EtH6"T$ H5H81EHD$HtHH|$h1 fHUHtkAIcHHH @E0}t H}(HHDŽHHAHDŽPUXE|$ ~HcL$ }QD$ HcƄ:E0H}(HD$ Ƅ:/fDHHDŽHVLT$D\$HMWE0PHt$0H|$8LM LE(VZYD\$LT$H;5"H=,?1H0H|$hI7D$ @I7T$ @HHZHY1ҍpH"IH t 9|HcL$L~HHcAt HA~@v(@ t"zfALHxq@v uHuzHAA<$"3LD$hHLLD$HLD$UHcP,EH IHʋS4tIAtDT$(u>Mct$0HH3"H5L$ H81ZDD$(HLMYT$0HHn3"H5L$ H81MH$LD$PHL$@Ht$8|$4HD$d=:;H/HDD$LEt8;$XHD$@L$LHP81fDH ;Z9uH2"H5~H819uMMLD$hHLHLMIHH2"H51HH81MuMu {HsHtUC0H|$ ED$H‰D$HM8H|$ E111LH|$ D$3D$0C7fMPHt$X1LHD$LD$A8"{HT$xHMtKH=?AH HHLD$hE1M^I\$"HHA|$|IHcD$dHH@HH7"L rH0"H=)1HH|$hyHH[]A\A]A^A_ÃLD$hH5'ILLD$貼LD$tA<$1A|$E11HHH@CML 1E1HcLD$hgD$LD9AL=&HcD$LBƄHD$HHDŽ@HDŽPDŽXDŽHVHm/"H=*1HbH|$hHL%HLD$h1D$0CH /"HSH5H81H|$uH\$hdH|$tH|$MuH\$hH?L%4"A$9D$4*|$4)ǃHcHHC@A,$9l$4H|$8HcL,׉fI9l$4)HcI}H{HH\$hA$HC@)HcH<uH."H=H eHA"MHH-"H5H81eLD$h|$0 MH-"T$ H5HH81'L$0&C{H`-"HSH5H81H5EFLLD$袹1ɅLD$E1H-"HSH5H81A<$uCH,"HSH5H81gfLc(1kqmuH=HHgMIH~,"H5HH81 \$0HR,"H5LH81H2,"H=3H)oH ,"H=DHJH+"HSH5H81s~H+"IRH5H81RH+"IH5IRHH81+MIlHs+"H5HH81DL$0EHE+"L$ H5HH81ͿDT$0EmH +"L$ H50HH81蓿IH*"HSH5H81r(ABH*"IRH53H81AH*"H=&11H芾H|$hpHd*"H=1HYH|$h?CtrH(*"HSH5eH81賾IABtNH)"IRH5PH81膾Hh1[]A\A]A^A_H&'"H=.HHl$(IqHAA0H\$@L $H߃҃6L $t)H&"IQH5LH81OHl$($Ht$1E11HL $}H߉LH5L $AAK 'H\$H5?L $H蟲L $t;1Y{OHD$HT$H|$(HLL $L $KHD$(Hh[]A\A]A^A_L $蔷HHD$L $HHt$81H躺;"L $ HT$8M@,HHD$HDN@u+H|$H2IY(H\$$f.HH|$H|$ 1L $蓵HD$HL $KH=?HH WH|$H5=L $ HD$L $IQH5"Hy$"H5rLL $H81HD$L $DkkmuH=HLH5q1HD$f.fAWAVIAUATAUSH=zRIHmH1һ++ *"H=*"H-)"HLcEHcHcLMIOLI1H5*"2@u`@H)"I? r*"Hcɀ< tjDE9}DeH[]A\A]A^A_H2@t9ur '*"@:yW]tIcHcIT< uA)"DuDuE9XIcIDH -@+@-Du@HA9H -uztLLD]NHcA9ILDu{LA9~HcITfH2HHru9|HA9uHcMDuDufH[]A\A]A^A_@H!"IUH5UPH81JHcE ("IML4@;fMHcA<2z:8AV{("D9U H l'" .1:AD:fDA:A4Fը8:BHcȃA:EfDDBA-tlE(LLD'"A'"DuHH>A'"DuI1H7!zuADu zADuKTHJA9ܺDuDH "IUH5NH81莴: '"Du:?ff.AWAVAAUATH=?NUSHIHxDL$ HL$LD$HDL$ 1D$ ++H%"H=~&"D;HE9IcH<Ll=H|$ IU -@+@-LEfAHE9H -uztLD$HL$LHDD+E9AIcHt}RAMH~D9~'HcHDfHAHHPA9|HA9ωHcAH|uDzfE_ADE9}$D3DHx[]A\A]A^A_fAHxD[]A\A]A^A_z@-t@ELHDDAfDA$<:D$ A4VՁ<|$ :P3HcʃA< @:@|$ EfDE_H5$"DIEHHz$"-:5Iu~Ht$XlHt$X~-@@HD|$8HD$0<=D$gHcljHD=tHuT$gL$`HD$HHHD$PWD$`+D$8LD$PD|$HPH@E1DADfDHcЍHAHcA44@:t-Wu@;t"9uHxLH[D]A\A]A^A_HHcA<4:E͉|$8iH~!"A?E_H5IDIMHUH)"H81迯IEHD$XD$8D$` xH !"EA?2HHUH5IH"H81QDE_E9DSH "E1|$ : AGd:HHUH5IT$`H5u!"HcHT$XH=Ht$ HT5H5Q!"H$D`DCHt$D$`1+D$8Ll$(Dt$@D|$趘H='HHL1D 2DHcH)H{HI_fDLsHT$pL蚛H=HL10D訓H5(HP uPLA}H=FHL1ۿA}H=1F1¿H5'HNHxHt$pKHD$p8tH5|'H HpH=91nLAcHsH=`GH1>D趒HsH=F1D藒H=EL11xИ8EH=EH1վ}諘8ԖH=DH1賾D+SA>讖H=EHL1芾D*f.AUATIUS1ALH8菛u+FH5FHD1ϴH8[]A\A]@L1Ҿ HNHt$H|$ HD$HIzDH5PFDMHD1cH8[]A\A]AWAVE1AUATIUSIH"L%FHHT$ fH+LcH HLL7t#IIu1H[]A\A]A^A_Hi"LLHttG}twHI.L$ tLHTtALHDH[]A\A]A^A_f}tH= GL1蹼1kH=GL1衼1SH=FL1艼1;fDWHHEt$Ht\DH8HH5DI1DHt#D@8HHH5D1ϲO8H5D1鳲D@8H5DH1D闲DWHEt7HtzHH@8IHH5rDIDP1YH@HGt(DO8IHHH5BD1*f.DG8H5'D1 GDO8H5DIHD҉1DWHHEu!D@8HHH5C1鸱DH8HH5CI1D锱@H CH1Df.AUATIUSHHH蕔8HIӕH2H!%tHDHJHD@H. ERRORHLHHL]H[]A\A]Df.AWAVAUATUSHH8DoLg(DwHo HXHt$#t:H=D1{AUH8D[]A\A]A^A_LAHT$01 HsHHT$(HCH Dl$4H\$PDt$hLd$pD$HHCXHl$xHt$XH$HC@H$AwH\FHcHH=E10APDH5A1E1A AH5!HDl$8H5!HLx|@ DH5"HDE^H DH5 "HDE@p H{L ]EH PVLD$(AEDJAH$t AD$DDT$@DT$ D$$D)+T$1A践{/f.H$ސu$%=@SH{@蚑H{@D4D$AEA9,A芒H= @DD1$HsH =H2@H0DH5>1DK81IDLDZ^tmH5oHAWh |H=@1A茴HsH [=H"@HDHD$HD$1!H5?HA9OH{XA;D$ D$L$$)HL$H{X`DT$ fDHsH$-H$H$D4H{@H5{<1;HIH$AA^HT$ HL$$Ht$LH{@pHC@4H{@|T$DT$ D$$f.HD$13ٌ0H=<1H{XFH5tHbx H{XH5AH/x @f.AWAVAUATUSHHHXDgDo8Lw(w0HhtvHo?Hc H@H5>HH=*>1HCXH[]A\A]A^A_fHT?Hc HDH"H輍H"HǎH5:AD1yDhHT$9HIHT$HH{(HT$I$HCI|$(A,$ID$HCID$HCID$HC ID$ HC0ID$0HC8ID$8HC@ID$@HCHID$HHCPID$PHCXID$XHC`ID$`臊HT$TEAD$H >HcHDHHCX1~fH{ H5HxHSHs߆QH{ H5~ŽH@C`HCP-HI"H,H]"H7fSHH5.9AD1h1H{X@SHH58D1AD1襥8SHH5 8D1茥Dk8ALDh H5%8AD1[fDHi81H߽CCAD$It$X1HI|$@L H=8SI|$(覅L辄UC1It$XAD$CHufDIt$X1{H1f.HtKHH?Ht@USHHHoHHtHckHH[]DHBfD1f.H=-"1BfAWAVAUATE1USHHt2IH譈Ab t91H诉uAHD[]A\A]A^A_fDH=:12؅HPLXLt=LI1H=M:1HL迆H=R:1HP@(t 9}HXB,+09}M4 胀HHHx1HLhI?IGH(AGIoHXHP@B;0~$9,|3H{(?f.H=A91E1HsXH|$H: H蒁u,IoI/AGjH=?91質널HAUATE1USHՉE11HHLQL E1'f.H6I9LLH9HOHAHt&LH+FHi@BLH+FHyH6AHufDfH59fH*fH*ҸI*H*lj%8<Y^^^{Eu6MCT%9tHH58[]A\A]1PH[]A\A]@H5L8D1-뵐f.AWAVAUATUSH= !Ht$L荅H!1Ht H@HuH5881E1ПH!HHD$HD$`E1HD$(HD$ D$HHD$@HD$XHD$0HD$PHD$8HD$L MA$ H7tH7rH7H7HDHD$H-7H z7H57HxHE1E$8E$$H5"8A$0A$,1I$XI$PH5G7ߋRP1軞Ll$@1L|I$PLH0HPCI$XLH0HP*H561jM$@MLL%6MMIfDHD$hI+FH56fIfIVH*HD$`I+FHHDHIDH*Y9X^9IN0HMt"I;M1 I;LHL9uILHL$JHHT$;HHT$HL$HLHt$8HHT$0HD$lLT$MtHt$PH|$XHt$ H|$(D$HfDMv(MMAM1H5{51HD$H@HHD$t EiML|H|$@HD$`t$pDD$tT$|DL$x$$5H|$(>fH*D$(H|$ =28f(YffH*l$ fDfDff*f*Y*΋T$H*H55*ٸYYYYZZYZZZZZZZZT$LH5p41ϛH=!sHĘ1[]A\A]A^A_ME1MH531A1脛zA1]H541byL|$(fMAIM I*XHD$`1HD$(HD$ D$HHD$@(Lt$ fMAIM I*Xf.Ht5USHH] tHdH[]@,ǃ ~@D$fLwkA,= !cnHHt\H=!wHC HtHS(HP(HC(HtHS HP I;@Hq=!1nH=!oxLgx#H81[]A\A]A^A_fD8uHHH5&H=O!u=H!HlnI@HtHC(HX I@LI(wHC(I@>@f.1fAUATUSHHHt~HIHAmvCXH=+HލP1SX#HkwHDLmu*H/vCXH=M+HލP1SXH-wH[]A\A]HH[]A\A]ff.HUSHHuSXH=+1H~CduC`SXtr҉SXuHHvH=*H1?HuH{(.lHoH[]fH=a*1H{Xu H{(mH8vH1[]SXC\tfAWAVAUATUSHH8Ht$HT$HL$t{XvmH-!L%!Lt$ Lk(1@1avLHHLHD$ HD$(m{Xv#HstE<$HuEtDD1ҋC\HL$S`HD$HL$CdCXP҉SXu3HCuH=)H1H8H[]A\A]A^A_Ln@H=)H1跗HtH8[]A\A]A^A_SplH1@X@h@d@`H@\Hlu(H{(1 nu9H=&H18H[H=!)1"Hm1[fDH=))1HsHrm1[fD1[@US1HHtHrH]htH-!HrH!H sH[]HtSHrChH[sff.@AWAVHG(AUATUSHHHDHD$H?D$$ZrHCPH-_!L%!HD$HD$0HD$(fH!1ҾHHOH{E1HD$ML{AW EA;H{(qL;s8sm8H=*1HEoHA$Up:KpL|$(LhH=%L1ӒpH;E1E1 pH{tO@HCBt(t/H=%1蔒HCB|(eHCB|(eIIXL9swH RH;oH}nHA$oH5>!oHx'HH1[]A\A]A^A_H=^$11H= %1f.USHHH\$D$ HfH߾mH߾mH߾ mH߾mH߾mH߾m1H޿RmHt$ H%1cH}HtgH=^$1'D$ u1@H}XYt&uH=K)1}Gd}_dH}(6hHĘH[]EgDH!HlH!H߻mHftX uHH!=!tMH5oH3mHt=H=#1H;u'H!=d!ufHf.uH!vf@f.b!u,H;!H8!H5!H2!H5!Nc@f.AWAVAUATUSHHH$L$H|$x$HT$8H$@H$@L$LD$0H5H$h1HDŽ$HDŽ$HDŽ$ HDŽ$(HDŽ$0HDŽ$@HDŽ$HHDŽ$PHDŽ$XHDŽ$`HDŽ$HHDŽ$PHDŽ$XHDŽ$`HDŽ$pHDŽ$xHDŽ$HDŽ$DŽ$HLDŽ$HDŽ$HDŽ$HDŽ$HDŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$5P$tHP1He H|$811jHiH=B&1SH|$0H5Dx$EtHPH|$8e#H|$81ҾMjH H=U&H1H$Hnfd H$H|$81ҾiH9( H$H|$811iH9 H|$0H5\$Dp$EtHPH|$8d""H|$81ҾiH H=&16H|$0H5řD`$EtHPH|$8yd"H|$81Ҿ0iH H= '1׋H޿Ze H|$0H5Qh$tHPH|$8dE"Lt$81ҾLhH=l'H1jH|$0H5DX$EtHPLc!Lt$81ҾLchH='H1H|$0H5衘DP$EtHPLWci!Lt$81ҾL hH='H1躊H|$0H5lIDH$EtHPLb"Lt$81ҾLgH='H1bH|$0H5;D@$EtHPLbz Lt$81ҾL[gH='H1 H|$0H5虗x$tHPLQb Lt$81ҾLgH='H1贉H|$0H5Cp$tHPLa Lt$81ҾLfH='H1^H|$0H5H$tdHPLatOjcH='H1H|$8o`H[]A\A]A^A_H=!H1Lt$81ҾLfH='H1轈1ҾLeH='H1蝈1Ҿ LeH='H1}H|$0H5* P$t+HP!L`tbH='HH|$81Ҿ!ieH='H1Lt$0H5L褕@ H=V1AH5Lv@ !H|$0H5Z@ H='1A蚇H|$0H5)Dx EH='1AgH|$0H5Dp EoH='1A 7H|$0H5Ɣh .H=1A H|$0H5V蕔DX EuH|$0H5K{DH Et,H|$0H5BaDP EtH='1A@覆Lt$0H5<L2D@ EH=D1DqH5Lx  Lt$0H5Lp H=21*H5LD$X貓H  H|$0H5{薓P H=1݅L$X@H|$0H5Zd@ yH=1諅L$X@H|$0H52@ 4H= 1yL$XH|$0H5 @ H= 1JL$XH|$0H5ђ@ H= 1L$XH|$0H5蟒@ H|$0H5 胒Dp EH|$0H5eD` ELt$0H5-LDh H5=L*DX EtHPH|$8\Lt$81ҾLaH=&1BH|$0H5ёDP EtHPL\f H|$81Ҿ>aH=&1L|$0H5LzL$XD@ H5Lʁ΀EEAODH DEADƉD$XH|$0H5$H@H$$AH=]XH|$0H5dAx IDž3H=D1%L|$0H5L豐H5LLp螐H5LHh苐H@H5LA쉄$nH@H޿HD$H\;H=D1蟂H|$0H5D$&p HD$pH$ HWH߾^H߾^H߾ {^H߾n^H߾ a^H߾ T^H߾G^H߾:^H߾ -^H߾ ^H߾^H߾^1H޿ZI]HHH$|]H[H[Hu[ Hh[ H[[1LY1LY1LY1L Y1L pYH|$0H5蟎Hh$HH$(H$@1Hl$Ll$xHH$HD$`I HH9 At1ɺL7uH=M1膀H|$8WhH=1dH=1QYH=1>H=1+OH$H=KH=1E1,0ZH=iHZH=+HZH=HYH=/HH=1H==1~H=w1kVH=21XH=1EH=12H=l1EH=+1 l$XH=1D~H=1~H=1~H=(1~MH=1~Hl$HD$`HUH\$`HU$H[($1ɺH߉!5M$H|$`1ɺ5-H 1DDHHD$PHL$`H$H1TD$$H$HH$[H|$pH$DH$H\$h$EE1퉄$H$HD$H$H$HD$`HPH$H$HD$H$H$H$hNYH|$h3H$H9$xdH!$H|$hH6H$xD$\H|$\ IE1ҋt$\HAHT$@8Hc$HD$HHD$(@Ht$@HHFH$pH,Ћ] };$ E1 t } n }( E*}xH}mH}b}(XHEHE1HD$ H|$1 Hu$$EE$$D$X$HD$0H$HD$PH$HD$8H$HEPH$E,$HE8H$HE@H$E($U$)H]L9HD$fDH$HEt<1Cw$t H=1zDŽ$EH|$ Nd#XHD$(HEH$&$H]L9HLmK|%/H H=!OH!H=!Pf.H}L)J4'pLHuL)HHu>H={ 1s9fE($E1D$E,H$HEPH$HE89u0H=1r$4FH|$H5賷$DŽ$H]H=qE(1F<#grH=1E1QrH|$ 7PHD$(HUHEHLl$4L)HnHEH=I\$B4 1Ήu4rE4uE0$E$H}PE0E(H=1q1HE@L9A&H=1qAE4AHu8H9H)H=[1Hu8[qE4HUAM$L9w III)HHu}0D)DE4Kx;H=dH1LqHUI9E4L@H5LAH=1pE(E}(IH=1Ap}JH|$0H5(~@ H=!LH!H=!MH$EHH$xH=1pH$xwDt$HED$LDt$H=1oGH=1Ao}H51>f}(H=E(1oSLEH=1boH=1OoH}P]H}PH$xIE18H=1 oH=B!-KH^!H=/!4L}H=HH1nH|$H5ʳH}Dt$J4'GL)eH$BH$kL$H$H+$H9Q!d H=!qE H=1*nH|$8H!" H?JH-8!HEIKH$KH=1miHW!H;H|$0H5L{Dp EH@HzKBHHD$8 Mt?H|$8LGt&GH=YH1OmH=x1AmLyE$HT$LHt$8@H|$8nI$H=1lH|$8HIH=!EJHJH|$0H5SzDH Et$tHD$pHL$8HHH$uJUHD$8H=!HH!H=!I$H5MIHH=1lH|$PH|$0H5byD@ EtZ$tPH=v1kH-ۺ!HHH$ !IH IH$1zCH|$p BLt$8Mt1LBH$1HCLt$`I~(+H$hHI~PT>$>$>=ο!t H=!D$H%H5H=HB1jH$Ld$xHI,tA<$I6>I9uH|$0H5`xp HŅL$LHHt$ LCH=BH1jnH}HUE1Dt$H4H)CH)]E,OH=Ⱦ!3CwDH=H$H= 1jGDH= HH= 1L$XiH|$0H5lw@ tH= 1L$XiH|$0H5#}>wDx EH= 1L$X{iCH=H@CH=zH*CH=HmCH=.HH= 1L$XiKyFIH5$ADHHhH5?HD1vE5HCD.FsH$pHCH=1hHD$pL|$0H50LvH5-LX$AuD@D$EEAE)A9~ EyE9~H$H=^ D1EhE9@H= D1g*f. BH=H1HE H=DE9C6HA9?A9H= DO1DgeD[DH$h11*CH$xHH$pxtuHxPAH$pH|P tQH$pH=t1fH$p|9H$p|9H$pDHHXH9$xdH$h1CH=D1D$fH=1A f;H=1e@E;H=1el$XH= 11eH=!AH!H=!BH$hBE?H=H1leH|$8<\H=ENeMt& tH=1ScH= 1BcfH= 12cfH= 1"cfMt!SHIxLIp H?>C0[AUATUSHHZ8Ht]C8(tTHtOL"H H{ HIHMLDC LeH}u.HLL[]A\A]H= 1bH[]A\A]DH{HH5gp@ tLEHMH=, LL1=b띐f.AWAVIAUATIUSIԉ11HhIHt$HD$HC D{xB LDT$ XH=: L1`CDT$ fMH=p L1_CAH= L1DT$ _DT$ H!HHu1Mt.H\$ 1H?HT$0DD$DL$HL$8|$XHt$`H$HDŽ$HDŽ$Z+11|$X%H|$H5_P H|$h(%D%WH$tH|$H5|_H <L$,HT$`H5h|$(1VHHL$`T$H=`Ht$ 1QHT$Ht$`H=$D$D|$@D|$@D$D$$T$,|$(H551GT$Ht$ H=>1Q|$X$H|$H5^p tQH|$ht'D$T$,|$(H541iGT$Ht$ H= 1PH|$h%룅T$,|$(H51#GHԣ!f8 T$Ht$ H=n1[PH|$h%(D#D##T$,|$(H51FT$Ht$ H=1OD$HGHL$,|$(H5HE1H_Ft$H=H1OD"#D$-H$DL$,L$HT$`|$(H5H1FL$HL$`H=T$Ht$ I1?O)8>'H=H1OD"D"T$,|$(H5L1Et$H=1Nl$oH=1NDA"D$LAuJ(L$,|$(H5kH1.E(T$Ht$ H=]H1mN\$\$f.USHcHHHGG G$G(G,G0G4HG8HG@HGPGu"H?t\u8HCH1H[]H?HtC$HCHtH{H+HkHH1[]f.HG n"HHuH=jMDAWAVAUATIUSH5IHHHZP uHH[]A\A]A^A_H= H&HHD$#HE1H#HALHD$ Lq#Hx!HIt$HH5HL1H#Nt LI1#Hx!HIt$HH5HL1I#Ll JD HE1H$H @HxHH5pl$HuH<$"LI"HؾHD$I|'HH/Mtj11H4$LI@< I9vSHuLHHB<I9v@%uր<vuLHHT$H $,$HD$H $HT$L HB@H=)!'O'H= !~s(@;%8u11$tH|$tH|$ Ht!H!MtL!MHHL[]A\A]A^A_{!C(H=)1JE11fDH|$tH|$ HuH=LL$ HH5E1H1U$@f.AUATAUSAHHf)HHŅt5HD('y$8tH[]A\A]f.HD[]A\A]fHFAT1UE1S1HfD9teDH4H qHHH HHHJHHHJHHHJHH HJ HH(HJ(HH0HJ0HH8HJ8HH@HJ@HHHHJHH@PHBPAHSEHH9s;H HSHHH‹phH8HtHSEHH9r@DH9tmHDv+H HHHKH@BH;CHrH=^D1HkHHDH{HtEH!%EtHtHC[]A\DHC[]A\f.AWAVAUATUSHLO1IAAHXAMtD;o1H4H4sLA;ht{^L9HrD~KI4GHl$HHID$M|$DHSDHHHI|$x=ID$l1H[]A\A]A^A_IDDLcH[]A\A]A^A_øH=+1GH=>yGfUSHHH?Ht}#HMHt4H}Ht+1;YHAXu9fHHX9Xt$HH9uH}Ht"H[]W$AH}HuH[]fHMHuDAWAVAUATAUSHH1H{11HKHD HXH;CrH|$Xl$OH|$XLcIH{tZ11!@H9}(F IHHXH;Ss3HHsHFHHuMrHtL9LLHHXH;SrMD)D$H=1ELsL9s Lt=H{Ht CLsJ<LHHC5DL$Ls E~ iD$D$MtN11HsH E1|HsHXHĸ1[]A\A]fD t̃uH=@1=1fDAWAVIAUATEUSHH=!IHXDD$ Ll$DD$ 1҉MLLHl$HD$HD$Ht$Et LD$Mu;I$H=1H1V=H=/!HX[]A\A]A^A_fI$IMH=H1=DH=H1<=!qH=!Hu1n 4H=ݑ!1@AWAVIAUATUSHH!H$HH߾ H߾H߾H߾ H߾HH$01ҿ)1HHHH$8H$001H޿ a1H޿ R14!XMI~H5v_IDH EZH=c19;I~H5o/Ix HÅ=!LCHHsH=t1M;H[0HuI~H5HH@HD$@D$<H=1;I~H5L$ H@ LD$81H!P?I 0HcҸ?)HH L%Ҏ!H$A$-!E111LxtSA$t`t׿I~H5(GD@ EH=1(:H$8uA$u1H$HHD$HH$HD$HD$XHD$HD$PHD$ H$HD$(Ht$=Ž!HH$H8KH$H9L|$Ll$0MD|$<DtH=|H1B9ED@!"AED$\D$XIEA} bAEH)IHAEH9AUxH5H1HHIvA}HƄ/EAuD{!D$\t$XINDL$8HEFHT$ D\$ hD\$ IED$\@Ht$DH=^17A}n H1[]A\A]A^A_f.Ll$0A$.DŒ!E111Lx t#A$tӿ)H$8uDfD$ AuHT$(# DR!D$@H;$f|$ AuD$\t$X1fT$ 8Kp1H+D$HHH$ H=16DI~H5@HDp t|I~H51DH HÅ=!LCH Hs7H=1M6H[0HuH=i1*6H\$`HxH=16H$8H=KH15H=z151HD$HfA}7 H=15@AuH=51A} [8H$HH==H1S5;\H=S1<5IH=p1)56H=u15#1H0 HI!HDH=!Il$LHAD$IFID$IFID$ AFAD$] aL H=A14H H=H1f4sH=wH1L4=^!H=b!H=N! 1 fAWAVAUATIUSHEH8T$HHH= !HL$HL$(HD$(@tH8[]A\A]A^A_fDHD$(ALpAtMFHT$|$xAN4IF HXI;^(upLHH1L EAcT$WHL$EHL!%1IIHD$ H5Hx<:p HÅu<D}u6H={H1q,HsH=1_,H[0Ht7Hk}/tHH=e!1HHH[0HuHD$ H5CHx9H HÅunfDH[0Ht_HkHsH=!1HHI,uHsH=!1LHsPH=1+H[0HuHD$ H5~Hx9P HÅH$1H|$HH=g!G?I H?)ѺHH H$HD$@HD$ HHHHD$8H$PHL$0HD$(Ht$HE111 dH\$@=!HHQHIH9HD$w,͐@AG M|L;|$sIcH!MoL$ILHLHcHHpHD$HHt$HHA|/Ht$HHML1?AGRHT$(H0u$h%=>AG@3H=DLH1)HD$ ~!HpmHH=~!1HH@H=11Z)HĈ1[]A\A]A^A_fDHsH=]~! HsH=1)Ht$HoHML1H0Ht$0H|$8EMHLAHT$(Hu$h%= AG@DLHH=Ld$ fH[0HHkHH=h}!1HHuIT$At$H{ 3}!vt8HHsH=8H1'}HD$ H5Hxo5@ jH=-1'AFH=A1'3DH=11z'DK8=t|!fH= 1I'H=16'ATUISH(HHtL HhHXH@H@ []A\@HtHuLMAUATUSHLN_M1ɸ1@AЉЉ 1Ѝ1҉ Љ1ЍQI9HwÃIH!HcHL$I$Hthu7LhLhIE IEK19sE H[]A\A]fHHLiIM IELhKǸzHtH@H@I$HEHbDf.HtHHAHAuHu LDWE1ɸ1<>Љ 11Ǎ< 1AyH9IwAD!HIHt:uDATUISHZHHu$H[HtH;HuMtI$[]A\øHAHAuHu LD_E1ҸE1fDFDAADAA D1AAA1GD DAAD1EBL9MwAUSD!HHIHHHL$HD$XHL$Ht~HsHHtH9u H9t HRHuHҸt=H9tWH;KHA tdHtHQHPHAHQ HP HA HA+1HtHT$HUH[]HAHHCtH@ HHCtH@HA fHtSHH?H[fD@f.HtSf.H_HHu[ff.Ht+SHH H{5H{,H[#@f.HtSHHH[D@f.HWHHAVAUIATUE1SfEILHHt41tfDH{HGHCl;+rHpLIHAE;nsII>L[L]A\A]A^<5DufD!9uATUHS3HHEHt/HZB LeHI$1Ht[]A\H}@f.HtHuHGHpHGH~HFHw1DATUISHHtGHHH@H@HEHH:HI|$(Hz[1]A\[]A\fDHtkATUSHHHuH[]A\DHHIH;LHt.H[HuH[]A\f.HSHKH߉D$ HJHSHKHJD$ H[]A\Df.HtHuHAIAuHtUSHAHD$Icx,HȀ8/u.fDH8/tAAu1H[]À</ufDAX~HHL$tHD$HcHH@Hx uf.HtHuIAHAuHtUSHAHD$Icx,HȀ8/u.fDH8/tAAu1H[]À</ufDAX~HHL$¸uHD$LcJtHxHtHuQDf.HtHuAVAUATUHSHHHHIHcHڀ:/uXH:/KuHHLHIH8HMHHLL 1HPH$HD$E1}HIDLHH f{bu8HIHHǹLHHHH@H@IF HH@HH@IV IF(HBIF(IV HPC@AH{0H.IcHIFH HHcH€:/uH:/uHHHIFHAF1LHHu?H[Ht/f{buHspLu߸H[]A\A]A^DIcIvLHtHHIfJfDQ IFAF3IF LvZIF(LaEL1;H=H1  1_HcHcAWAVAUATUSH8HAHAuHuAH8D[]A\A]A^A_AHL$(HHt$H|$HD$(AtAfDHD$(ELpMn HCMmM;n(HAD$D$D|$IDf.HHH1LL$H|$HLLpMmM;n(tBI}mJ, HHItMINME|/uHHH1D|$H|$Ht$1HH|$(AHރxzHcHD$8/u `H8/tVuHH|$HHtEHHL$H|$IHHFHvuHc [H=gH11EDAWAVAUATUSHHHH\$ HH߾ H߾H߾H߾ H߾HH$1ҿ'1HHHSH$H$.1H޿ _1H޿ PEu1H]HUHEHH1[]A\A]A^A_fHuH=1H]HtH}H5~%%1Dh H1AtHMDEHT$HE1qDc@HuH=1L|$)H}H5 ~H]$H|$1ҾPDp H\$HD$HILHHf{buLpHHf{btH{011AH{0HMDEEL1Df.DAWAVAAUATL% UH- SIIL)HHWHt 1LLDAHH9uH[]A\A]A^A_Ðf.f.@Hc!HtH1:f.11'H Ht(UHSH HHHHuH[]Ho HERROR: %sWARNING: %sLog size = %lld, max = %lld -%Y%m%d_%H%M%S%s -> %s -> %sLOG_AUTHLOG_AUTHPRIVLOG_CRONLOG_DAEMONLOG_FTPLOG_KERNLOG_LPRLOG_MAILLOG_NEWSLOG_SYSLOGLOG_USERLOG_UUCPLOG_LOCAL0LOG_LOCAL1LOG_LOCAL2LOG_LOCAL3LOG_LOCAL4LOG_LOCAL5LOG_LOCAL6LOG_LOCAL7WARNING: Log size limit met but log file rotation turned off. Forcing log file rotation anyways. Need to rotate log file due to size but ran out of memory. Need to rotate log file due to size but could not get local time. ERROR: Can't open %s in append mode (check permissions!). WARNING: File locking not supported (NFS?)ERROR: %s is locked by another process You have to compile with libprelude using ./configure --enable-prelude ERROR: optaddarg: Unregistered option %s ERROR: optaddarg: strdup() failed ERROR: optaddarg: malloc() failed ERROR: optparse: Can't register new option (not enough memory) ERROR: optparse: longopts[] is too small ERROR: optparse: shortopts[] is too small ERROR: optparse: (short|long)opts[] is too small ERROR: Please edit the example config file %s ERROR: Missing argument for option at line %d ERROR: Missing closing parenthesis in option %s at line %d ERROR: Empty argument for option %s at line %d ERROR: Incomplete option passed (missing argument) ERROR: optparse: No corresponding long name for option '-%c' ERROR: Parse error at line %d: Unknown option %s WARNING: Ignoring unsupported option %s at line %u WARNING: Ignoring unsupported option --%s (-%c) WARNING: Ignoring unsupported option --%s ERROR: Can't register argument for option %s ERROR: Can't register argument for option --%s WARNING: Ignoring deprecated option %s at line %u WARNING: Ignoring deprecated option --%s (-%c) WARNING: Ignoring deprecated option --%s ERROR: optparse: Can't compile regular expression %s for option %s ERROR: Incorrect argument format for option %s ERROR: Incorrect argument format for option --%s (-%c) ERROR: Incorrect argument format for option --%s ERROR: Option --%s (-%c) requires a non-empty string argument ERROR: Option --%s requires a non-empty string argument ERROR: Can't parse numerical argument for option %s ERROR: Can't parse numerical argument for option --%s (-%c) ERROR: Can't parse numerical argument for option --%s WARNING: Numerical value for option %s too high, resetting to 4G WARNING: Numerical value for option --%s (-%c) too high, resetting to 4G ERROR: optparse: calloc failed ERROR: optparse: strdup failed ERROR: Problem parsing options (name == NULL) Dump authenticode certificate chain.Perform HTML, script, and text normalizationAlways generate MDB entries for PE sectionsMaximum number of mismatched signatures when building a CVD. Zero disables this limit.Feature level to put in the CVDVersion number of the CVD to buildCreate a hybrid (standard and bytecode) database fileForce using the interpreter instead of the JITTrust loaded bytecode (default yes)Load and print bytecode information without executingPrint IR of bytecode signatureInput file to run the bytecode nDon't show source line during tracingName of the analyzer as seen in prewikkaSave all reports to a log file.By default the log file is locked for writing and only a single daemon process can write to it. This option disables the lock.Maximum size of the log file. Value of 0 disables the limit.Log all clean files. Useful in debugging but drastically increases the log size.Use the system logger (can work together with LogFile).Type of syslog messages. Please refer to 'man syslog' for the facility names.Rotate log file. Requires LogFileMaxSize option set prior to this option.Log additional information about the infected file, such as its size and hash, together with the virus name.Save the process ID to a file.This option allows you to change the default temporary directory.This option allows you to change the default database directory. If you enable it, please make sure it points to the same directory in both clamd and freshclam.Only load the official signatures published by the ClamAV project.By default, yara rules will be loaded. This option allows you to exclude yara rules when scanning and also to scan only using yara rules. Valid options are yes|no|onlyPath to a local socket file the daemon will listen on.Sets the group ownership on the unix socket.Sets the permissions on the unix socket to the specified mode.Remove a stale socket after unclean shutdownA TCP port number the daemon will listen on.By default clamd binds to INADDR_ANY. This option allows you to restrict the TCP address and provide some degree of protection from the outside world.Maximum length the queue of pending connections may grow to.Close the STREAM session when the data size limit is exceeded. The value should match your MTA's limit for the maximum attachment size.The STREAM command uses an FTP-like protocol. This option sets the lower boundary for the port range.This option sets the upper boundary for the port range.Maximum number of threads running at the same time.This option specifies the time (in seconds) after which clamd should timeout if a client doesn't provide any data.This option specifies the time (in seconds) after which clamd should timeout if a client doesn't provide any initial command after connecting.This option specifies how long to wait (in milliseconds) if the send buffer is full. Keep this value low to prevent clamd hanging.Waiting for data from clamd will timeout after this time (seconds).Maximum number of queued items (including those being processed by MaxThreads threads). It is recommended to have this value at least twice MaxThreads if possible. WARNING: you shouldn't increase this too much to avoid running out of file descriptors, the following condition should hold: MaxThreads*MaxRecursion + MaxQueue - MaxThreads + 6 < RLIMIT_NOFILE (usual max for RLIMIT_NOFILE is 1024) This option specifies how long (in seconds) the process should wait for a new job.Don't scan files/directories whose names match the provided regular expression. This option can be specified multiple times.Maximum depth the directories are scanned at.Follow symlinks to regular files.Scan files and directories on other filesystems.This option specifies the time intervals (in seconds) in which clamd should perform a database check.This option allows you to disable clamd's caching feature.Execute a command when a virus is found. In the command string %v will be replaced with the virus name. Additionally, two environment variables will be defined: $CLAM_VIRUSEVENT_FILENAME and $CLAM_VIRUSEVENT_VIRUSNAME./usr/bin/mailx -s "ClamAV VIRUS ALERT: %v" alert < /dev/nullStop the daemon when libclamav reports an out of memory condition.Permit use of the ALLMATCHSCAN command.Enable debug messages in libclamav.Don't remove temporary files (for debugging purposes).Run the daemon as a specified user (the process must be started by root).With this option enabled ClamAV will load bytecode from the database. It is highly recommended you keep this option on, otherwise you'll miss detections for many new viruses.Set bytecode security level. Possible values: TrustSigned - trust bytecode loaded from signed .c[lv]d files, insert runtime safety checks for bytecode loaded from other sources Paranoid - don't trust any bytecode, insert runtime checks for all Recommended: TrustSigned, because bytecode in .cvd files already has these checks.Set bytecode timeout in milliseconds.Allow loading bytecode from outside digitally signed .c[lv]d files.^(Auto|ForceJIT|ForceInterpreter|Test)$Set bytecode execution mode. Possible values: Auto - automatically choose JIT if possible, fallback to interpreter ForceJIT - always choose JIT, fail if not possible ForceInterpreter - always choose interpreter Test - run with both JIT and interpreter and compare results. Make all failures fatal.^(none|None|bytecode|Bytecode|pcre|PCRE)$Collect and print execution statistics. Possible values: Bytecode - reports bytecode statistics PCRE - reports PCRE execution statistics None - reports no statisticsDetect Potentially Unwanted Applications.Exclude a specific PUA category. This directive can be used multiple times. See https://www.clamav.net/documents/potentially-unwanted-applications-pua for the complete list of PUA categories.Only include a specific PUA category. This directive can be used multiple times.In some cases (eg. complex malware, exploits in graphic files, and others), ClamAV uses special algorithms to provide accurate detection. This option controls the algorithmic detection.PE stands for Portable Executable - it's an executable file format used in all 32- and 64-bit versions of Windows operating systems. This option allows ClamAV to perform a deeper analysis of executable files and it's also required for decompression of popular executable packers such as UPX or FSG. If you turn off this option, the original files will still be scanned, but without additional processing.Executable and Linking Format is a standard format for UN*X executables. This option allows you to control the scanning of ELF files. If you turn off this option, the original files will still be scanned, but without additional processing.With this option enabled clamav will try to detect broken executables (both PE and ELF) and mark them as Broken.Executable.Enable the built in email scanner. If you turn off this option, the original files will still be scanned, but without parsing individual messages/attachments.Scan RFC1341 messages split over many emails. You will need to periodically clean up $TemporaryDirectory/clamav-partial directory. WARNING: This option may open your system to a DoS attack. Please don't use this feature on highly loaded servers.With this option enabled ClamAV will try to detect phishing attempts by using signatures.Scan URLs found in mails for phishing attempts using heuristics.Always block cloaked URLs, even if they're not in the database. This feature can lead to false positives.PhishingAlwaysBlockSSLMismatchAlways block SSL mismatches in URLs, even if they're not in the database. This feature can lead to false positives.Detect partition intersections in raw disk images using heuristics.Allow heuristic match to take precedence. When enabled, if a heuristic scan (such as phishingScan) detects a possible virus/phish it will stop scan immediately. Recommended, saves CPU scan-time. When disabled, virus/phish detected by heuristic scans will be reported only at the end of a scan. If an archive contains both a heuristically detected virus/phish, and a real malware, the real malware will be reported. Keep this disabled if you intend to handle "*.Heuristics.*" viruses differently from "real" malware. If a non-heuristically-detected virus (signature-based) is found first, the scan is interrupted immediately, regardless of this config option.Enable the Data Loss Prevention module.This option sets the lowest number of Credit Card numbers found in a file to generate a detect.This option sets the lowest number of Social Security Numbers found in a file to generate a detect.With this option enabled the DLP module will search for valid SSNs formatted as xxx-yy-zzzz.With this option enabled the DLP module will search for valid SSNs formatted as xxxyyzzzzPerform HTML/JavaScript/ScriptEncoder normalisation and decryption. If you turn off this option, the original files will still be scanned, but without additional processing.This option enables scanning of OLE2 files, such as Microsoft Office documents and .msi files. If you turn off this option, the original files will still be scanned, but without additional processing.With this option enabled OLE2 files with VBA macros, which were not detected by signatures will be marked as "Heuristics.OLE2.ContainsMacros".This option enables scanning within PDF files. If you turn off this option, the original files will still be scanned, but without decoding and additional processing.This option enables scanning within SWF files. If you turn off this option, the original files will still be scanned, but without decoding and additional processing.This option enables scanning xml-based document files supported by libclamav. If you turn off this option, the original files will still be scanned, but without additional processing.This option enables scanning HWP3 files. If you turn off this option, the original files will still be scanned, but without additional processing.Scan within archives and compressed files. If you turn off this option, the original files will still be scanned, but without unpacking and additional processing.Mark encrypted archives as viruses (Encrypted.Zip, Encrypted.RAR).This option causes memory or nested map scans to dump the content to disk. If you turn on this option, more data is written to disk and is available when the leave-temps option is enabled at the cost of more disk writes.This option sets the maximum amount of data to be scanned for each input file. Archives and other containers are recursively extracted and scanned up to this value. The value of 0 disables the limit. WARNING: disabling this limit or setting it too high may result in severe damage.Files/messages larger than this limit won't be scanned. Affects the input file itself as well as files contained inside it (when the input file is an archive, a document or some other kind of container). The value of 0 disables the limit. WARNING: disabling this limit or setting it too high may result in severe damage to the system.Nested archives are scanned recursively, e.g. if a Zip archive contains a RAR file, all files within it will also be scanned. This option specifies how deeply the process should be continued. The value of 0 disables the limit. WARNING: disabling this limit or setting it too high may result in severe damage to the system.Number of files to be scanned within an archive, a document, or any other container file. The value of 0 disables the limit. WARNING: disabling this limit or setting it too high may result in severe damage to the system.This option sets the maximum size of a file to check for embedded PE. Files larger than this value will skip the additional analysis step. Negative values are not allowed. WARNING: setting this limit too high may result in severe damage or impact performance.This option sets the maximum size of a HTML file to normalize. HTML files larger than this value will not be normalized or scanned. Negative values are not allowed. WARNING: setting this limit too high may result in severe damage or impact performance.This option sets the maximum size of a normalized HTML file to scan. HTML files larger than this value after normalization will not be scanned. Negative values are not allowed. WARNING: setting this limit too high may result in severe damage or impact performance.This option sets the maximum size of a script file to normalize. Script content larger than this value will not be normalized or scanned. Negative values are not allowed. WARNING: setting this limit too high may result in severe damage or impact performance.This option sets the maximum size of a ZIP file to reanalyze type recognition. ZIP files larger than this value will skip the step to potentially reanalyze as PE. Negative values are not allowed. WARNING: setting this limit too high may result in severe damage or impact performance.This option sets the maximum number of partitions of a raw disk image to be scanned. Raw disk images with more partitions than this value will have up to the value number partitions scanned. Negative values are not allowed. WARNING: setting this limit too high may result in severe damage or impact performance.This option sets the maximum number of icons within a PE to be scanned. PE files with more icons than this value will have up to the value number icons scanned. Negative values are not allowed. WARNING: setting this limit too high may result in severe damage or impact performance.This option sets the maximum recursive calls to HWP3 parsing function. HWP3 files using more than this limit will be terminated and alert the user. Scans will be unable to scan any HWP3 attachments if the recursive limit is reached. Negative values are not allowed. WARNING: setting this limit too high may result in severe damage or impact performance.This clamscan option is currently for testing only. It sets the engine parameter CL_ENGINE_TIME_LIMIT. The value is in milliseconds.This option sets the maximum calls to the PCRE match function during an instance of regex matching. Instances using more than this limit will be terminated and alert the user but the scan will continue. For more information on match_limit, see the PCRE documentation. Negative values are not allowed. WARNING: setting this limit too high may severely impact performance.This option sets the maximum recursive calls to the PCRE match function during an instance of regex matching. Instances using more than this limit will be terminated and alert the user but the scan will continue. For more information on match_limit_recursion, see the PCRE documentation. Negative values are not allowed and values > PCREMatchLimit are superfluous. WARNING: setting this limit too high may severely impact performance.This option sets the maximum filesize for which PCRE subsigs will be executed. Files exceeding this limit will not have PCRE subsigs executed unless a subsig is encompassed to a smaller buffer. Negative values are not allowed. Setting this value to zero disables the limit. WARNING: setting this limit too high or disabling it may severely impact performance.This option enables on-access scanning (Linux only)This option specifies a directory or mount point which should be scanned on access. The mount point specified, or the mount point containing the specified directory will be watched, but only notifications will occur. If any directories are specified, this option will preempt the DDD system. It can also be used multiple times.This option specifies a directory (including all files and directories inside it), which should be scanned on access. This option can be used multiple times.This option allows excluding directories from on-access scanning. It can be used multiple times. Only works with DDD system.Use this option to whitelist the root UID (0) and allow any processes run under root to access all watched files without triggering scans.With this option you can whitelist specific UIDs. Processes with these UIDs will be able to access all files. This option can be used multiple times (one per line). Using a value of 0 on any line will disable this option entirely. To whitelist the root UID please enable the OnAccessExcludeRootUID option.Files larger than this value will not be scanned in on access.This option toggles the dynamic directory determination system for on-access scanning (Linux only).This option changes fanotify behavior to prevent access attempts on malicious files instead of simply notifying the user (On Access scan only).Enables extra scanning and notification after catching certain inotify events. Only works with the DDD system enabled.When started by root freshclam will drop privileges and switch to the user defined in this option.This option defined how many times daily freshclam should check for a database update.Use DNS to verify the virus database version. Freshclam uses DNS TXT records to verify the versions of the database and software itself. With this directive you can change the database verification domain. WARNING: Please don't change it unless you're configuring freshclam to use your own database verification domain.DatabaseMirror specifies to which mirror(s) freshclam should connect. You should have at least two entries: db.XY.clamav.net (or db.XY.ipv6.clamav.net for IPv6) and database.clamav.net (in this order). Please replace XY with your country code (see https://www.iana.org/domains/root/db). database.clamav.net is a round-robin record which points to our most reliable mirrors. It's used as a fall back in case db.XY.clamav.net is not working.db.XY.clamav.net database.clamav.netThis option allows you to easily point freshclam to private mirrors. If PrivateMirror is set, freshclam does not attempt to use DNS to determine whether its databases are out-of-date, instead it will use the If-Modified-Since request or directly check the headers of the remote database files. For each database, freshclam first attempts to download the CLD file. If that fails, it tries to download the CVD file. This option overrides DatabaseMirror, DNSDatabaseInfo and Scripted Updates. It can be used multiple times to provide fall-back mirrors.mirror1.mynetwork.com mirror2.mynetwork.comThis option defines how many attempts freshclam should make before giving up.With this option you can control scripted updates. It's highly recommended to keep them enabled.With this option enabled, freshclam will attempt to load new databases into memory to make sure they are properly handled by libclamav before replacing the old ones.By default freshclam will keep the local databases (.cld) uncompressed to make their handling faster. With this option you can enable the compression. The change will take effect with the next database update.Download an additional 3rd party signature database distributed through the ClamAV mirrors. This option can be used multiple times.With this option you can provide custom sources (http:// or file://) for database files. This option can be used multiple times.http://myserver.com/mysigs.ndb file:///mnt/nfs/local.hdbIf you're behind a proxy, please enter its address here.A user name for the HTTP proxy authentication.A password for the HTTP proxy authentication.If your servers are behind a firewall/proxy which does a User-Agent filtering you can use this option to force the use of a different User-Agent header.Send the RELOAD command to clamd after a successful update.Run a command after a successful database update.Run a command when a database update error occurs.Run a command when freshclam reports an outdated version. In the command string %v will be replaced with the new version number.With this option you can provide a client address for the database downloading. Useful for multi-homed systems.Timeout in seconds when connecting to database server.Timeout in seconds when reading from database server.This option enables support for Google Safe Browsing. When activated for the first time, freshclam will download a new database file (safebrowsing.cvd) which will be automatically loaded by clamd and clamscan during the next reload, provided that the heuristic phishing detection is turned on. This database includes information about websites that may be phishing sites or possible sources of malware. When using this option, it's mandatory to run freshclam at least every 30 minutes. Freshclam uses the ClamAV's mirror infrastructure to distribute the database and its updates but all the contents are provided under Google's terms of use. See https://transparencyreport.google.com/safe-browsing/overview and https://www.clamav.net/documents/safebrowsing for more information.This option enables downloading of bytecode.cvd, which includes additional detection mechanisms and improvements to the ClamAV engine.Disable authenticode certificate chain verification in PE files.Initialize a supplementary group access (the process must be started by root).Define the clamd socket to connect to for scanning. This option is mandatory! Syntax: ClamdSocket unix:path ClamdSocket tcp:host:port The first syntax specifies a local unix socket (needs an absolute path) e.g.: ClamdSocket unix:/var/run/clamd/clamd.socket The second syntax specifies a tcp local or remote tcp socket: the host can be a hostname or an ip address; the ":port" field is only required for IPv6 addresses, otherwise it defaults to 3310 ClamdSocket tcp:192.168.0.1 This option can be repeated several times with different sockets or even with the same socket: clamd servers will be selected in a round-robin fashion.Define the interface through which we communicate with sendmail. This option is mandatory! Possible formats are: [[unix|local]:]/path/to/file - to specify a unix domain socket; inet:port@[hostname|ip-address] - to specify an ipv4 socket; inet6:port@[hostname|ip-address] - to specify an ipv6 socket./tmp/clamav-milter.socket inet:7357Define the group ownership for the (unix) milter socket.Sets the permissions on the (unix) milter socket to the specified mode.Messages originating from these hosts/networks will not be scanned This option takes a host(name)/mask pair in CIRD notation and can be repeated several times. If "/mask" is omitted, a host is assumed. To specify a locally originated, non-smtp, email use the keyword "local".local 192.168.0.0/24 1111:2222:3333::/48^(Accept|Reject|Defer|Blackhole|Quarantine)$Action to be performed on clean messages (mostly useful for testing). The following actions are available: Accept: the message is accepted for delivery Reject: immediately refuse delivery (a 5xx error is returned to the peer) Defer: return a temporary failure message (4xx) to the peer Blackhole: like Accept but the message is sent to oblivion Quarantine: like Accept but message is quarantined instead of being deliveredAction to be performed on error conditions (this includes failure to allocate data structures, no scanners available, network timeouts, unknown scanner replies and the like. The following actions are available: Accept: the message is accepted for delivery; Reject: immediately refuse delivery (a 5xx error is returned to the peer); Defer: return a temporary failure message (4xx) to the peer.This option allows you to set a specific rejection reason for infected messages and it's therefore only useful together with "OnInfected Reject" The string "%v", if present, will be replaced with the virus name.If this option is set to "Replace" (or "Yes"), an "X-Virus-Scanned" and an "X-Virus-Status" headers will be attached to each processed message, possibly replacing existing headers. If it is set to Add, the X-Virus headers are added possibly on top of the existing ones. Note that while "Replace" can potentially break DKIM signatures, "Add" may confuse procmail and similar filters.When AddHeader is in use, this option allows you to set the reported hostname. This may be desirable in order to avoid leaking internal names. If unset the real machine name is used.Execute a command when an infected message is processed. The following parameters are passed to the invoked program in this order: virus name, queue id, sender, destination, subject, message id, message date. Note #1: this requires MTA macroes to be available (see LogInfected below) Note #2: the process is invoked in the context of clamav-milter Note #3: clamav-milter will wait for the process to exit. Be quick or fork to avoid unnecessary delays in email delivery/usr/local/bin/my_infected_message_handlerChroot to the specified directory. Chrooting is performed just after reading the config file and before dropping privileges.This option specifies a file which contains a list of basic POSIX regular expressions. Addresses (sent to or from - see below) matching these regexes will not be scanned. Optionally each line can start with the string "From:" or "To:" (note: no whitespace after the colon) indicating if it is, respectively, the sender or recipient that is to be whitelisted. If the field is missing, "To:" is assumed. Lines starting with #, : or ! are ignored.Messages from authenticated SMTP users matching this extended POSIX regular expression (egrep-like) will not be scanned. As an alternative, a file containing a plain (not regex) list of names (one per line) can be specified using the prefix "file:". e.g. SkipAuthenticated file:/etc/good_guys Note: this is the AUTH login name!SkipAuthenticated ^(tom|dick|henry)$This option allows you to tune what is logged when a message is infected. Possible values are Off (the default - nothing is logged), Basic (minimal info logged), Full (verbose info logged) Note: For this to work properly in sendmail, make sure the msg_id, mail_addr, rcpt_addr and i macroes are available in eom. In other words add a line like: Milter.macros.eom={msg_id}, {mail_addr}, {rcpt_addr}, i to your .cf file. Alternatively use the macro: define(`confMILTER_MACROS_EOM', `{msg_id}, {mail_addr}, {rcpt_addr}, i') Postfix should be working fine with the default settings.This option allows you to tune what is logged when no threat is found in a scanned message. See LogInfected for possible values and caveats. Useful in debugging but drastically increases the log size.This option affects the behaviour of LogInfected, LogClean and VirusAction when a message with multiple recipients is scanned: If SupportMultipleRecipients is off (the default) then one single log entry is generated for the message and, in case the message is determined to be malicious, the command indicated by VirusAction is executed just once. In both cases only the last recipient is reported. If SupportMultipleRecipients is on: then one line is logged for each recipient and the command indicated by VirusAction is also executed once for each recipient. Note: although it's probably a good idea to enable this option, the default value is currently set to off for legacy reasons.yesExampleERROR: Unknown option passed footruehelp^(yes|true|1|no|false|0)$config-file/etc/clamd.conf/etc/freshclam.conf/etc/clamav-milter.confdebuggen-jsondumpcertsquietleave-tempsno-warningsshow-progressstdoutdaemonno-dnslist-mirrorsupdate-dbreloadmultiscanfdpassstreamallmatchdatabase/usr/share/clamavrecursivegen-mdbfollow-dir-symlinks^[0-9]+$follow-file-symlinksbellno-summaryfile-listinfectedsuppress-ok-resultscopyremoveexcludeexclude-dirinclude-dirstructured-ssn-formathex-dumpmd5sha1sha256impprint-certshtml-normaliseascii-normaliseutf16-decodebuildmax-bad-sigs3000flevelcvd-versionno-cdiffserverunpackunpack-currentinfolist-sigsfind-sigsdecode-sigstest-sigsvbavba-hexcomparerun-cdiffverify-cdiffhybriddefaultcolorsconfig-dir/etcnon-defaultgenerate-configforce-interpretertrust-bytecodeprintsrcPrint source code of bytecodeprintbcirinputtracebytecode trace levelno-trace-showsourcearchive-verbosebytecode-trust-allhttp-proxyproxy-userlog-verboseforcedisable-summarydisable-archiveno-archiveno-peno-elfno-ole2no-pdfno-htmlno-mailno-phishing-sigsno-phishing-scan-urlsno-algorithmicno-phishing-restrictedscanmax-ratiomax-space^[0-9]+[KM]?$unzipunrararjunzoolhajartartgzdebblock-maxPreludeEnableprelude-enableEnable preludePreludeAnalyzerNameprelude-analyzer-name/tmp/clamav.logLogFileUnlockLogFileMaxSizeLogTimeLog time with each message.LogCleanLogSyslogLogFacilityLogVerboseEnable verbose logging.LogRotatelog-rotateExtendedDetectionInfoPidFile/var/run/clam.pidTemporaryDirectorytempdir/tmpDatabaseDirectorydatadir/var/lib/clamavOfficialDatabaseOnlyofficial-db-onlynoYaraRulesyara-rulesLocalSocket/tmp/clamd.socketLocalSocketGroupvirusgroupLocalSocketMode660FixStaleSocketTCPSocket3310TCPAddr127.0.0.1MaxConnectionQueueLength30StreamMaxLength25MStreamMinPort1024StreamMaxPort2048MaxThreads120CommandReadTimeoutSendBufTimeout200300MaxQueueIdleTimeout^/proc/ ^/sys/MaxDirectoryRecursionmax-dir-recursion15FollowDirectorySymlinksFollow directory symlinks.FollowFileSymlinksCrossFilesystemscross-fsSelfCheck600DisableCachedisable-cacheVirusEventExitOnOOMAllowAllMatchScanForegroundDon't fork into background.DebugLeaveTemporaryFilesUserBytecodeBytecodeSecurity^(TrustSigned|Paranoid)$TrustSignedBytecodeTimeoutbytecode-timeout5000BytecodeUnsignedbytecode-unsignedBytecodeModebytecode-modeAutoStatisticsstatisticsNoneDetectPUAdetect-puaExcludePUAexclude-puaNetTool PWToolIncludePUAinclude-puaSpy Scanner RATAlgorithmicDetectionalgorithmic-detectionScanPEscan-peScanELFscan-elfDetectBrokenExecutablesdetect-brokenScanMailscan-mailScanPartialMessagesPhishingSignaturesPhishingScanURLsPhishingAlwaysBlockCloakphishing-cloakphishing-sslPartitionIntersectionpartition-intersectionHeuristicScanPrecedenceheuristic-scan-precedenceStructuredDataDetectiondetect-structuredStructuredMinCreditCardCountstructured-cc-countStructuredMinSSNCountstructured-ssn-countStructuredSSNFormatNormalStructuredSSNFormatStrippedScanHTMLscan-htmlScanOLE2scan-ole2OLE2BlockMacrosblock-macrosScanPDFscan-pdfScanSWFscan-swfScanXMLDOCSscan-xmldocsScanHWP3scan-hwp3ScanArchivescan-archiveArchiveBlockEncryptedblock-encryptedForceToDiskforce-to-diskmax-scansize100Mmax-recursion16max-files10000MaxEmbeddedPEmax-embeddedpe10MMaxHTMLNormalizemax-htmlnormalizeMaxHTMLNoTagsmax-htmlnotags2MMaxScriptNormalizemax-scriptnormalizeMaxZipTypeRcgmax-ziptypercg1MMaxPartitionsmax-partitions128MaxIconsPEmax-iconspe100MaxRecHWP3max-rechwp3TimeLimittimelimitPCREMatchLimitpcre-match-limit100000PCRERecMatchLimitpcre-recmatch-limitPCREMaxFileSizepcre-max-filesizeOnAccessMountPath/ /home/userOnAccessIncludePathon-access-include/home /studentsOnAccessExcludePath/home/bofh /rootOnAccessExcludeRootUIDOnAccessExcludeUIDOnAccessMaxFileSizeOnAccessDisableDDDdisable-dddOnAccessPreventionOnAccessExtraScanningDevACOnlydev-ac-onlyDevACDepthdev-ac-depthDevPerformancedev-performanceDevLiblogdev-liblogUpdateLogFile/var/log/freshclam.logDatabaseOwnerCheckschecksDNSDatabaseInfocurrent.cvd.clamav.netDatabaseMirrorPrivateMirrorMaxAttemptsScriptedUpdatesTestDatabasesCompressLocalDatabaseExtraDatabasedbname1 dbname2DatabaseCustomURLHTTPProxyServeryour-proxyHTTPProxyPortHTTP proxy's port8080HTTPProxyUsernameusernameHTTPProxyPasswordHTTPUserAgentNotifyClamddaemon-notifyOnUpdateExecuteon-update-executecommandOnErrorExecuteon-error-executeOnOutdatedExecuteon-outdated-executeLocalIPAddresslocal-addressaaa.bbb.ccc.dddConnectTimeoutReceiveTimeoutSafeBrowsingDisableCertChecknocertsMailMaxRecursionArchiveMaxScanSizeArchiveMaxRecursionArchiveMaxFilesArchiveMaxCompressionRatioArchiveBlockMaxArchiveLimitMemoryUsageMailFollowURLsmail-follow-urlsClamukoScanOnAccessClamukoScannerCountClamukoScanOnOpenClamukoScanOnCloseClamukoScanOnExecClamukoIncludePathClamukoExcludePathClamukoExcludeUIDClamukoMaxFileSizeAllowSupplementaryGroupsClamdSockettcp:scanner.mydomain:7357MilterSocketMilterSocketGroupMilterSocketModeLocalNetOnCleanAcceptOnInfectedQuarantineOnFail^(Accept|Reject|Defer)$DeferRejectMsgMTA specificAddHeader^(No|Replace|Yes|Add)$ReplaceReportHostnamemy.mail.server.nameVirusActionChroot/newrootWhitelist/etc/whitelisted_addressesSkipAuthenticatedLogInfectedBasicSupportMultipleRecipientsPOSIXLY_CORRECT%s: illegal option -- %c %s: unrecognized option `%s' %s: option `%s' is ambiguous %s: option requires an argument -- %c %s: option `--%s' doesn't allow an argument %s: option `--%s' requires an argument 0.100.2%s/daily.cvd%s/daily.cldClamAV %s ClamAV %s/%u/%s/dev/nullCan't open /dev/null dup2(%d, %d) failed %s/Unable to allocate memory for db directory... ERROR: This tool requires libclamav with functionality level %u or higher (current f-level: %u) ERROR: --file-list: Can't open file %s clamd [options]setrlimit--foreground-FERROR: initgroups() failed. ERROR: setgid(%d) failed. ERROR: setuid(%d) failed. #+++ Started at %sclamd/proc#Reading databases from %s #Excluded PUA categories:# %s.%s#Included PUA categories:#Not loading PUA signatures. ParanoidForceJITForceInterpreterTest#Bytecode support disabled. #Only using the A-C matcher. #Max A-C depth set to %u !%s #Loaded %u signatures. !Unknown group %s !Invalid LocalSocketMode %s !daemonize() failed: %s *Closing the main socket%s. Socket file removed. # none!Can't parse command line options Clam AntiVirus: Daemon %s By The ClamAV Team: https://www.clamav.net/about.html#credits (C) 2007-2018 Cisco Systems, Inc. --help -h Show this help --version -V Show version number --debug Enable debug mode --config-file=FILE -c FILE Read configuration from FILEPass in - as the filename for stdin.ERROR: Unable to allocate memory for config file ERROR: Can't open/parse the config file %s ERROR: Can't get information about user %s. ERROR: LogFile requires full path. ERROR: Can't initialize the internal logger !Can't initialize libclamav: %s !LogFacility: %s: No such facility. #Received %d file descriptor(s) from systemd. !Please define server type (local and/or TCP). #clamd daemon %s (OS: linux-gnu, ARCH: x86_64, CPU: x86_64) #Running as user %s (UID %u, GID %u) #Log file size limited to %lld bytes. #Log file size limit disabled. !Invalid StreamMinPort/StreamMaxPort: %d, %d *ScanOnAccess: OnAccessExtraScanning was requested, but has been disabled due to a known issue with thread resource cleanup. The OnAccessExtraScanning feature will be re-enabled in a future release when the issue is resolved. For details, see: https://bugzilla.clamav.net/show_bug.cgi?id=12048 !Can't initialize antivirus engine !Can't allocate memory for pua_cats !ExcludePUA and IncludePUA cannot be used at the same time !cli_engine_set_str(CL_ENGINE_PUA_CATEGORIES) failed: %s #Only loading official signatures. !cli_engine_set_str(CL_ENGINE_TMPDIR) failed: %s #Not loading phishing signatures. #Bytecode: Security mode set to "TrustSigned". #Bytecode: Security mode set to "Paranoid". !Unable to parse bytecode security setting:%s ^Invalid bytecode security setting %s: %s #Bytecode: Enabled support for unsigned bytecode. #Disabling URL based phishing detection. !cli_engine_set_num(PCREMatchLimit) failed: %s !cli_engine_set_num(PCRERecMatchLimit) failed: %s !Database initialization error: %s !Failed to change socket ownership to group %s !Cannot set socket permission to %s ^Can't change current working directory to root !Not listening on any interfaces !Can't unlink the socket file %s %lld!TCP: getaddrinfo failed: %s !TCP: socket() error: %s !TCP: getnameinfo failed: %s #TCP: Bound to [%s]:%s !TCP: setsocktopt(SO_REUSEADDR) error: %s !TCP: setsocktopt(IPV6_V6ONLY) error: %s !TCP: Cannot bind to [%s]:%s: %s #TCP: Setting connection queue length to %d !TCP: Cannot listen on [%s]:%s: %s #LOCAL: Unix socket file %s !LOCAL: listen() error: %s !LOCAL: Could not create socket directory: %s: %s !LOCAL: Ensure parent directory exists. Localserver: Creating socket directory: %s !LOCAL: Socket allocation error: %s !LOCAL: Socket file %s is in use by another process. #LOCAL: Removing stale socket file %s !LOCAL: Socket file %s could not be removed: %s !LOCAL: Socket file %s could not be bound: %s (unlink tried) !LOCAL: Socket file %s exists. Either remove it, or configure a different one. !LOCAL: Socket file %s could not be bound: %s #LOCAL: Setting connection queue length to %d ClamAV %s/%u/%s%cClamAV %s%c%u: %s: %s%c%u: %s%c%u: %s: %s %s%c%u: %s %s%c%u: %s: %s FOUND%cERRORCONTSCANMULTISCANMULTISCANFILEFILDES$Closed fd %d %u: INSTREAM*ftruncate failed: %d ALLMATCHSCANOKRELOADING%c%u: PONG%c COMMANDS:!cl_engine_addref() failed No file descriptor received.!thread dispatch failed UNKNOWN COMMANDQUITRELOADPINGVERSIONCOMMANDSVERSIONENDSHUTDOWNIDSESSIONDETSTATSCLEARDETSTATS$Command %s missing argument! $Command %s has trailing garbage! $Command sent as old-style when not supported: %s $Client disconnected while command was active ^Not enough threads for multiscan. Max: %d, Alive: %d, Multiscan: %d+1 Not enough threads for multiscan. Increase MaxThreads.FILDES: didn't receive file descriptor.$Rejecting ALLMATCHSCAN command. ALLMATCHSCAN command disabled by clamd configuration.!Invalid command dispatched: %d Command invalid inside IDSESSION.$SESSION: command is not valid inside IDSESSION: %d ENGINE VERSION MISMATCH: %s != %s. ERROR%c!Can't allocate memory for client_conn !Failed to allocate memory for filename !Invalid command dispatch: %d йPм@XXXXXX0PXXLuHHHHHHHHs!Mutex lock failed $THRMGR: contended, sleeping $THRMGR: contended, woken !pthread_create failed !Mutex unlock failed (INVALID timestamps: %u) (ERROR: %u != %u)INVALIDEXIT??PRIMARYN/APOOLS: %u NULL STATE: %s %s QUEUE: %u items %s %f %s END%cIDLE!Fatal: mutex lock failed !Fatal: mutex unlock failed $THRMGR: new group: %p min_wait: %.6f max_wait: %.6f avg_wait: %.6fTHREADS: live %u idle %u max %u idle-timeout %u ERROR: error encountered while formatting statistics MEMSTATS: heap %.3fM mmap %.3fM used %.3fM free %.3fM releasable %.3fM pools %u pools_used %.3fM pools_total %.3fM !Unable to add threadpool to list $THRMGR: queue (single) crossed low threshold -> signaling $THRMGR: queue (bulk) crossed low threshold -> signaling $THRMGR: active jobs for %p: %d $THRMGR: group_finished: %p, %d $THRMGR: group_finished: freeing %p $THRMGR: group finished freeing %p ^Failed to initialize group mutex^Failed to initialize group cond.A>!Main socket gone: fatal ^Syncpipe read failed $Acceptloop closed FD: %d $Got new connection, FD %d !fds_add failed !write syncpipe failed !accept() failed: %s $Shutdown: closed fd %d $Syncpipe write failed $Finished scanthread $Failed to write to syncpipe Archive support enabled. Archive support disabled. ELF support enabled. ELF support disabled. Mail files support enabled. Mail files support disabled. OLE2 support enabled. OLE2 support disabled. PDF support enabled. PDF support disabled. SWF support enabled. SWF support disabled. HTML support enabled. HTML support disabled. XMLDOCS support enabled. XMLDOCS support disabled. HWP3 support enabled. HWP3 support disabled. Self checking disabled. w!Can't save PID in file %s *Listening daemon: PID: %u *MaxQueue set to: %d !pipe failed !failed to add pipe fd !thrmgr_new failed $mode WAIT_REPLY -> closed $Client read timed out COMMAND READ TIMED OUT $mode -> MODE_COMMAND !Command dispatch failed $mode -> MODE_WAITREPLY $Moved partial command: %lu $Consumed entire command $Garbage: %s $mode == MODE_STREAM $Got chunksize: %u $Chunks complete INSTREAM size limit exceeded.$Quota Remaining: %lu Error processing command.$Shutdown closed fd %d !cl_statinidir() failed: %s !reload db failed: %s ^Write to syncpipe failed Stopping on-access scan Pid file removed. --- Stopped at %s!Failed to poll sockets, fatal ^Can't set socket to nonblocking mode, errno %d ^Can't get socket flags, errno %d $Scanthread: connection shut down (FD %d) !cl_engine_set_num(CL_ENGINE_MAX_SCANSIZE) failed: %s Limits: Global size limit set to %llu bytes. ^Limits: Global size limit protection disabled. !cl_engine_set_num(CL_ENGINE_MAX_FILESIZE) failed: %s Limits: File size limit set to %llu bytes. ^Limits: File size limit protection disabled. ^System limit for file size is lower than engine->maxfilesize ^System limit for file size is lower than engine->maxscansize ^Cannot obtain resource limits for file size !cl_engine_set_num(CL_ENGINE_MAX_RECURSION) failed: %s Limits: Recursion level limit set to %u. ^Limits: Recursion level limit protection disabled. !cl_engine_set_num(CL_ENGINE_MAX_FILES) failed: %s Limits: Files limit set to %u. ^Limits: Files limit protection disabled. *Limits: Core-dump limit is %lu. !cli_engine_set_num(CL_ENGINE_MAX_EMBEDDEDPE) failed: %s Limits: MaxEmbeddedPE limit set to %llu bytes. !cli_engine_set_num(CL_ENGINE_MAX_HTMLNORMALIZE) failed: %s Limits: MaxHTMLNormalize limit set to %llu bytes. !cli_engine_set_num(CL_ENGINE_MAX_HTMLNOTAGS) failed: %s Limits: MaxHTMLNoTags limit set to %llu bytes. !cli_engine_set_num(CL_ENGINE_MAX_SCRIPTNORMALIZE) failed: %s Limits: MaxScriptNormalize limit set to %llu bytes. !cli_engine_set_num(CL_ENGINE_MAX_ZIPTYPERCG) failed: %s Limits: MaxZipTypeRcg limit set to %llu bytes. !cli_engine_set_num(MaxPartitions) failed: %s Limits: MaxPartitions limit set to %llu. !cli_engine_set_num(MaxIconsPE) failed: %s Limits: MaxIconsPE limit set to %llu. !cli_engine_set_num(MaxRecHWP3) failed: %s Limits: MaxRecHWP3 limit set to %llu. Limits: PCREMatchLimit limit set to %llu. Limits: PCRERecMatchLimit limit set to %llu. !cli_engine_set_num(PCREMaxFileSize) failed: %s Limits: PCREMaxFileSize limit set to %llu. Archive: Blocking encrypted archives. BlockMax heuristic detection enabled. BlockMax heuristic detection disabled. Algorithmic detection enabled. Algorithmic detection disabled. Portable Executable support enabled. Portable Executable support disabled. Detection of broken executables enabled. Mail: RFC1341 handling enabled. OLE2: Blocking all VBA macros. Phishing: Always checking for cloaked urls Phishing: Always checking for ssl mismatches Raw DMG: Always checking for partitions intersections Heuristic: precedence enabled !cl_engine_set_num(CL_ENGINE_MIN_CC_COUNT) failed: %s Structured: Minimum Credit Card Number Count set to %u !cl_engine_set_num(CL_ENGINE_MIN_SSN_COUNT) failed: %s Structured: Minimum Social Security Number Count set to %u Self checking every %u seconds. ^MaxQueue value too low, increasing to: %d ^MaxThreads * MaxRecursion is too high: %d, open file descriptor limit is: %lu ^MaxQueue value too high, lowering to: %d ^MaxQueue is lower than twice MaxThreads, increasing to: %d !All recv() descriptors gone: fatal $client read error or EOF on read $Received oldstyle command inside IDSESSION: %s Only nCMDS\n and zCMDS\0 are accepted inside IDSESSION.$got command %s (%u, %u), argument: %s $RECVTH: mode -> MODE_WAITANCILL $RECVTH: FILDES command complete $Receive thread: have to terminate group $Receive thread: closing conn (FD %d), group finished $Receive thread: INSTREAM: %s fd %u $Breaking command loop, mode is no longer MODE_COMMAND $Unclaimed file descriptor received, closing: %d PROTOCOL ERROR: ancillary data sent without FILDES.^Client sent garbage after last command: %lu bytes ^INSTREAM: Size limit reached, (requested: %lu, max: %lu) Error writing to temporary file!INSTREAM: Can't write to temporary file. $Processed %llu bytes of chunkdata, pos %llu $Skipping shutdown of bad socket after error (FD %d) $Shutting down socket after error (FD %d) $Socket not shut down due to active tasks SIGHUP caught: re-opening log file. No stats for Database check - forcing reload SelfCheck: Database modification detected. Forcing reload. SelfCheck: Database status OK. ^Can't make a copy of the current engine settings ^Can't apply previous engine settings: %s ^Using default engine settings !Database initialization error: can't compile engine: %s Database correctly reloaded (%u signatures) *Waiting for all threads to finish *Shutting down the main socket%s. !Can't unlink the pid file %s !Unable to start on-access scan Terminating because of a fatal error. ^[LibClamAV] %s: %s~[LibClamAV] %s: %s*[LibClamAV] %s: %s$[LibClamAV] %s: %s(filename not set)~%s: %s(%s:%llu) FOUND ~%s: %s FOUND lstat() failed:^lstat() failed on: %s $Skipping symlink: %s Not supported file type*Not supported file type: %s Empty fileAccess denied.*Access denied: %s ~%s: %s ERROR ~%s: OK ExcludedExcluded (another filesystem)instream(%s@%u)fd[%d]Not a regular filepollPORT %u%cAccept %s. ERROR%c!ScanStream %u: accept %s. accept() ERROR%cread timeout ERROR%cread poll ERROR%cstream: %s(%s:%llu) FOUND%cstream: %s FOUND%cstream(%s@%u): %s FOUND stream: %s ERROR%cstream(%s@%u): %s ERROR stream: OK%cstream(%s@%u): OK $Client disconnected while command was active! ^Client disconnected while scanjob was active !Memory allocation failed during cli_ftw() on %s !Memory allocation failed during cli_ftw() ^Directory recursion limit reached, skipping %s *Client disconnected while scanjob was active *%s: reported CL_VIRUS but no virname returned! %s: Not a regular file. ERROR !ScanStream: listen() error on socket. Error returned is %s. !ScanStream: error transmitting port. !ScanStream %u: accept() failed. *Accepted connection from %s on port %u, fd %d cli_gentempfd() failed. ERROR%c!ScanStream(%s@%u): Can't create temporary file. ^ScanStream(%s@%u): Size limit reached (max: %lu) Temporary file -> write ERROR%c!ScanStream(%s@%u): Can't write to temporary file. !ScanStream(%s@%u): read timeout. !ScanStream(%s@%u): read poll failed. stream(%s@%u): %s(%s:%llu) FOUND !ScanStream: Can't find any free port. Can't find any free port. ERROR%c<\!add_fd: Memory allocation failed for command buffer $Number of file descriptors polled: %u fds !add_fd: invalid fd passed to add_fd !add_fd: Memory allocation failed for fd_buf $fds_poll_recv: timeout after %d seconds !realloc_polldata: Memory allocation failed for poll_data $Received POLLIN|POLLHUP on fd %d ^Message truncated at %d bytes ^Control message truncated at %d bytes, %d data read ^Control message truncated, no control data received, %d bytes read(Is SELinux/AppArmor enabled, and blocking file descriptor passing?) $Unclaimed file descriptor received. closing: %d $Receveived a file descriptor: %d !poll_recv_fds: poll failed: %s PATHCLAM_VIRUSEVENT_FILENAME%s=%sCLAM_VIRUSEVENT_VIRUSNAME%v-c/bin/sh!VirusEvent: fork failed. !poll_recv_fds FD mismatch $Closing unclaimed FD: %d *Client disconnected (FD %d) ^Error condition on fd %d /proc/%uScanOnAccess: %s: %s FOUND *Permission denied to stat /proc/%d to exclude UIDs... perhaps SELinux denial? $/proc/%d vanished before UIDs could be excluded; scanning anyway ScanOnAccess: %s: %s(%s:%llu) FOUND *ScanOnAccess: onas_fan_exit(), signal %d !ScanOnAccess: fanotify_init failed: %s ScanOnAccess: clamd must be started by root !Unable to start on-access scanner. Bad thread args. ScanOnAccess: preventing access attempts on malicious files. ScanOnAccess: notifying only for access attempts. !ScanOnAccess: Can't include mountpoint '%s' ScanOnAccess: Protecting '%s' and rest of mount. !ScanOnAccess: Can't include path '%s' ScanOnAccess: Protecting directory '%s' !ScanOnAccess: Please specify at least one path with OnAccessIncludePath ScanOnAccess: Max file size limited to %u bytes ScanOnAccess: File size limit disabled !ScanOnAccess: Internal error (failed to read data) ... %s !ScanOnAccess: File too large for fanotify ... recovering and continuing scans... !ScanOnAccess: Internal error (readlink() failed) *ScanOnAccess: %s skipped (excluded UID) !ScanOnAccess: Internal error (can't write to fanotify) !ScanOnAccess: Internal error (close(%d) failed) !Unable to start dynamic directory determination. /proc/self/fd/%d*ScanOnAccess: onas_ddd_exit(), signal %d *ddd: MOVED_TO - Adding %s to %s with wd:%d /proc/sys/fs/inotify/max_user_watches!ScanOnAccess: Could not init inotify.!ScanOnAccess: Failed to initialize 3D. !ScanOnAccess: Not including path '%s' while DDD is enabled !ScanOnAccess: Please use the OnAccessMountPath option to watch '%s' ScanOnAccess: Protecting directory '%s' (and all sub-directories) !ScanOnAccess: Can't exclude path '%s' ScanOnAccess: Excluding directory '%s' (and all sub-directories) !ScanOnAccess: Could not watch path '%s', %s !ScanOnAccess: When using the OnAccessPrevention option, please ensure your kernel was compiled with CONFIG_FANOTIFY_ACCESS_PERMISSIONS set to Y *ddd: DELETE - Removing %s from %s with wd:%d *ddd: MOVED_FROM - Removing %s from %s with wd:%d %s%s%s/%s!ScanOnAccess: Could not open '%s' *ScanOnAccess: onas_scth_exit(), signal %d ScanOnAccess: Performing additional scanning on directory '%s' ScanOnAccess: Performing additional scanning on file '%s' ;t8 6P8 =p=AK@pKxKKMPOpOP0`8ej0pppprh t u v v0 px @y Py y z z @{ ~H @ 0P h p @hX0p`X`Т8X@PPЪ P(Яx 0 0Hhh0`P@0@@`0h@XP  `@` h (PH   0!!h"#&(h)P++ +0 zRx  3*zRx $ FJ w?;*3$"LD(4*BBB B(A0A8J 8A0A(B BBBF ,9WAAD } DAH L89BBB B(A0A8G 8A0A(B BBBE LBBE B(D0A8M 8D0A(B BBBF \,BBD A(G^ (C CBBH  (F CBBD a(C ABBLPhBBE B(A0A8J% 8C0A(B BBBH Lp%BBB B(A0A8OB  8A0A(B BBBA 4,PAAJ j AAH q CAK ddBBB B(D0A8QP 8A0A(B BBBH  8D0A(B BBBH LnBBD A(L0u (F ABBK D(D ABBDfMCD :ABG IABdd.BBB B(A0A8D@ 8A0A(B BBBA U 8D0A(B BBBA 4AAI W AAL T AAJ LyBBB B(D0A8L 8A0A(B BBBI 4T(AAG } AAH DAA4BBC A(Q`v(A ABBL*BBD A(IU (C ABBA  (C CBBG LBBE B(D0A8Sw 8C0A(B BBBJ dXLML|_BBE B(A0A8G. 8C0A(B BBBK >ML:BBB B(D0A8Jpv 8C0A(B BBBG L4BBB B(D0A8Gpq 8C0A(B BBBG T(vUBD A(I0b (O ABBE D(A ABBTPWBE A(D0| (A BBBJ A(A BBBL4BBE B(D0A8Uk8A0A(B BBB<BBH A(K@] (A ABBE LhoBBB B(A0A8G%< 8C0A(B BBBG ,<BAD qABDDAcBA A(D0(A ABBD0,AD s ABA ,`~AI0 AAA "FO $F\,2FbL"FP<lbBE A(D0g(D BBB,p\AD M ABA +4jBAD P CBD AFB\, GAF G0I  AABF w FABX0l AAB,iAD0{ AAA ,iAD0{ AAA LPRBB A(D0J@- 0A(A BBBF L<BBB B(A0A8Dpa 8D0A(B BBBD p MLx ABBB B(A0A8J 8C0A(B BBBJ Dx eBBE B(H0H8M@r8A0A(B BBB< T )RA RAPRAHRARAXSA SA0SASA8RA #SA(.SA7SA@@SAKSAVSAaSAlSAwSASASAAhAAAAc&AAAA6AAAAcJAAAKAVAAAbAA+AAhAA)AAAvA:AAqAA\AA{AA:AAAAAAAAAAAAAAAA:AAAdAAAAAAAAAAAAAAAAAAAmAAAAAAAAAAAAzAAAtAA ]AAAdAAAArAAA AAP]AA(AAA\AcA^AAfAr_AAlATAl_A:AJAA_AAXAA(`AEAgAAoAAAAh`AAAA`AAASA`ASAAAAAAAAHaAAAAaAAAApbAAA%A-(bA-A2ADAA#pbALA\AqAA cAAAA`cAAAdAAA@dAAApdAAAAdAAAAl_A+ABAAuUA؟AUAPAWAc@>@&>@6>@F>@V>@f>@v>@>@>@>@>@>@>@>@>@?@?@&?@6?@F?@V?@f?@v?@?@?@?@?@?@?@?@?@@@@@&@@6@@F@@V@@f@@v@@@@@@@@@@@@@@@@@@A@A@&A@6A@FA@VA@fA@vA@A@A@A@A@A@A@A@A@B@B@&B@6B@FB@VB@fB@vB@B@B@B@B@B@B@B@B@C@C@&C@6C@FC@VC@fC@vC@C@C@C@C@C@C@C@C@D@D@&D@6D@FD@VD@fD@vD@D@D@D@D@D@D@D@D@E@E@&E@6E@FE@VE@fE@vE@E@E@E@E@E@E@E@E@dRbGCC: (GNU) 5.3.0GCC: (GNU) 5.5.0.shstrtab.interp.note.ABI-tag.hash.dynsym.dynstr.gnu.version.gnu.version_r.rela.dyn.rela.plt.init.plt.got.text.fini.rodata.eh_frame_hdr.eh_frame.ctors.dtors.jcr.data.rel.ro.dynamic.got.plt.data.bss.comment 8@8T@T !x@xL' @ /@ 7o~%@~%Do'@'S'@']Bh(@h(g:@:$b0:@0: mF@FvF@FW |hRAhRxRAxR0&B0&)B)8Qb8QHQbHQXQbXQ`Qb`Q\ `b`pqЯbЯ0bb0@b( 0("Jusr/sbin/clamav-milter0100755000000000000000000070325013365330320014011 0ustar rootrootELF>PV@@h@8 @@@@@@88@8@@@ ccPj mmcmcTT@T@ PtdBBDDQtdRtdcc\\/lib64/ld-linux-x86-64.so.2GNU *pJ&ylTK EskbU\D`#0G6 tRmFzW%}ve)@| YCnV~=x+3g>]:[!2'7B$91"Q M(,IHLXO5-AZ;j^q{fu4 _haSc</.8di PoNwr?Ww= 3'* "  >c  5k#hAOr  PcR  :; %A  p0 PS ~9 8KAoh !~ci M ${cadvcKD .3 YNm H~cvb ,I!  I شc~wApuWmL )W|yJ H~c8W[ q+ixT `vc@/'`HcNI ;@:glibssl.so.1X509_STORE_CTX_initEVP_SignFinalEVP_MD_size_ITM_deregisterTMCloneTableX509_VERIFY_PARAM_newEVP_DigestFinal_exEVP_VerifyFinalBIO_pushBIO_read_finiEVP_PKEY_freeSSL_library_initEVP_DigestInit_exBIO_set_flags__gmon_start__X509_verify_certX509_get_pubkeyX509_STORE_freeEVP_DigestUpdatePEM_read_bio_X509_AUXEVP_MD_CTX_set_flagsEVP_MD_CTX_destroyEVP_get_digestbynameBIO_newBIO_ctrlBIO_freeX509_VERIFY_PARAM_freeEVP_PKEY_sizeX509_STORE_newX509_freeSSL_load_error_stringsEVP_MD_CTX_md_Jv_RegisterClassesBIO_free_allERR_load_crypto_stringsPEM_read_bio_X509_ITM_registerTMCloneTableBIO_writeBIO_s_fileBIO_s_memEVP_MD_CTX_createlibcrypto.so.1X509_LOOKUP_filePEM_read_X509X509_STORE_add_lookupBIO_f_base64X509_STORE_CTX_newX509_STORE_CTX_freeX509_LOOKUP_ctrlX509_CRL_freeOPENSSL_add_all_algorithms_noconfOpenSSL_add_all_digestsEVP_cleanupX509_LOOKUP_hash_dirBIO_new_mem_bufX509_VERIFY_PARAM_set_flagsX509_STORE_set_flagsOpenSSL_add_all_ciphersX509_STORE_add_crlPEM_read_PrivateKeyPEM_read_X509_CRLX509_STORE_set1_paramX509_cmp_current_timeEVP_MD_block_sizelibz.so.1libjson-c.so.2libpcre.so.1libpthread.so.0pthread_mutex_destroysendpthread_selfpthread_sigmaskpthread_mutex_init__h_errno_locationrecv__errno_locationpthread_oncepthread_mutex_lockpthread_setspecificpthread_cond_signalpthread_cond_timedwaitacceptlseek64fcntlpthread_createpthread_joinsigactionpthread_getspecific__res_statepthread_key_createconnectpthread_detachpthread_mutex_unlocksigwaitsendmsgwaitpidlibc.so.6setuidchrootsocketfflushsprintfsrandstrncmpinet_atonoptindstrrchr__strdupperrorin6addr_anyclosedirinitgroupsstrncpyforksigfillsetunlinkputcharlistenselectreallocclockmemchrgetpidinet_ptonstrftimechmod__assert_faillocaltime_rstrtolctime_rsyslogfgetsgetpwnamcallocstrlensigemptysetopenloggetaddrinfomemsetwritevbindchdirmemcmpgetsockoptdup2__fxstat64strptimevsnprintfsigaddsetctimegetgrnamstdoutinet_addrfputsmemcpyfclosestrtoulsetsockoptmallocumaskstrcasecmp__lxstat64opendir__xstat64__ctype_b_locgetenvoptarggetservbynamestderrsigdelsetgethostbynameoptoptexecvpstrncasecmpfilenogethostnamechownfwritegettimeofdayrenamegeteuidatoistrchrfprintfreaddir64__ctype_toupper_loc__ctype_tolower_locfreeaddrinfosetsidmemmovefopen64opterrsetgidstrcmpstrerror__libc_start_mainstpcpycloselog__cxa_atexit__xstat__fxstat_edata__bss_start_endGLIBC_2.3.2GLIBC_2.2.5GLIBC_2.14GLIBC_2.30ri  ui   ii  ui  oc"oc#ocGocQococ~cdpc pc(pc0pc8pc@pcHpcPpcXpc `pc hpc ppc xpc pcpcpcpcpcpcpcpcpcpcpcpcpcpcpcpcqcqcqc qc! qc$(qc%0qc&8qc'@qc(Hqc)Pqc*Xqc+`qc,hqc-pqc.xqc/qc1qc2qc3qc4qc5qc6qc7qc8qc9qc:qc;qc<qc>qc?qc@qcArcBrcCrcDrcE rcF(rcH0rcI8rcJ@rcKHrcLPrcMXrcN`rcOhrcPprcRxrcSrcTrcUrcVrcWrcXrcYrcZrc[rc\rc]rc^rc_rc`rcarcbrccscescfscgsch sci(scj0sck8scl@scmHscnPscoXscp`scrhscspsctxscuscvscwscxscysczsc{sc|sc}sc~scscscscscscsctctctctc tc(tc0tc8tc@tcHtcPtcXtc`tchtcptcxtctctctctctctctctctctctctctctctctcucucucuc uc(uc0uc8uc@ucHucPucXuc`uchucpucxucucucucucucucucucucucucucucucucucvcvcvcvc vc(vcHH3#HtS IH54#%4#@%4#h% 4#h%4#h%3#h%3#h%3#h%3#h%3#hp%3#h`%3#h P%3#h @%3#h 0%3#h %3#h %3#h%3#h%3#h%3#h%3#h%z3#h%r3#h%j3#h%b3#h%Z3#hp%R3#h`%J3#hP%B3#h@%:3#h0%23#h %*3#h%"3#h%3#h%3#h % 3#h!%3#h"%2#h#%2#h$%2#h%%2#h&%2#h'p%2#h(`%2#h)P%2#h*@%2#h+0%2#h, %2#h-%2#h.%2#h/%2#h0%2#h1%2#h2%z2#h3%r2#h4%j2#h5%b2#h6%Z2#h7p%R2#h8`%J2#h9P%B2#h:@%:2#h;0%22#h< %*2#h=%"2#h>%2#h?%2#h@% 2#hA%2#hB%1#hC%1#hD%1#hE%1#hF%1#hGp%1#hH`%1#hIP%1#hJ@%1#hK0%1#hL %1#hM%1#hN%1#hO%1#hP%1#hQ%1#hR%z1#hS%r1#hT%j1#hU%b1#hV%Z1#hWp%R1#hX`%J1#hYP%B1#hZ@%:1#h[0%21#h\ %*1#h]%"1#h^%1#h_%1#h`% 1#ha%1#hb%0#hc%0#hd%0#he%0#hf%0#hgp%0#hh`%0#hiP%0#hj@%0#hk0%0#hl %0#hm%0#hn%0#ho%0#hp%0#hq%0#hr%z0#hs%r0#ht%j0#hu%b0#hv%Z0#hwp%R0#hx`%J0#hyP%B0#hz@%:0#h{0%20#h| %*0#h}%"0#h~%0#h%0#h% 0#h%0#h%/#h%/#h%/#h%/#h%/#hp%/#h`%/#hP%/#h@%/#h0%/#h %/#h%/#h%/#h%/#h%/#h%/#h%z/#h%r/#h%j/#h%b/#h%Z/#hp%R/#h`%J/#hP%B/#h@%:/#h0%2/#h %*/#h%"/#h%/#h%/#h% /#h%/#h%.#h%.#h%.#h%.#h%.#hp%.#h`%.#hP%.#h@%.#h0%.#h %.#h%.#h%.#h%.#h%.#h%.#h%z.#h%r.#h%j.#h%b.#h%Z.#hp%R.#h`%J.#hP%B.#h@%:.#h0%2.#h %*.#h%".#h%.#h%.#h% .#h%.#h%'#fAVAUIATUASE1H HH$H HHH H1HLHHH$H[H$^1H޿ 1H޿ 蛟H->#LHE1ADLHHH@EHE 1HEH ~HEHHE(HHE0HpHE8HsHEHHdtHEPHtHEXj.L%=#HI$_AXH5[HDh EI$H@@Ht1H0Ht)H=?1-I$H@@H4HHuI<$H5M]p I<$H5BHx)HHPA4$1E1ɹ1AH^HI$IZYgHH5'Lx Ht"Hx H{byI<$H5$'HXH50?HmI<$H5_&HXH=<HvHcO^HĀ HHMH쀃H= ?;I<$H5 IA} NHH=>H5>HZ_H5>H>CH5+HLkH5>LEHIUI<$H5[%LD1;:I_x tOI<$H56%IHXH$  HH$ :JƒLI<$H5x Ht+HxHI]pLI<$H5$x ցL4I<$H5{$|HpH=Q;1:.*I<$ABH=<H1>I<$H D[]A\A]A^I<$H5$x gL$ LƄ$^BML-8#Ha<H1L;AƅLmH5d<HLHHEH6#ILmuI<$H5Z x H)I<$H5,= x H(#H52I<$f I<$P H5HH0#f H-0#H@H5HI<$H H/#@ H;fH0#fI<$H5 x GH/#HI<$H5 x tDI<$H5o HxH5H=`4¾'H6#fH$ HHH=;H1+I<$H5 x tHPHY4#HI<$`kI<$LxZI<$H5" x tHxuE|I<$H5" x tHxG2I<$H5"f I<$P H5H=&#J x u#AvH=&&NI<$H5r H@H6#HHI<$H5' I<$HPH5#H#MH2#H8pI<$H5c x H0JAc E1?H=4H1uH=4H=4 I6H=81B H=4H=%5H=Q5 ZI<$q H=81A)%I<$J H=3A%HsH=51Av)lHpL$ LHzH#H=6,H$I<$A HsH=.51A(Hx+HH pH{}C}UH5X8H:#AH81I<$! wH=%4A*`I6H=;4H1A{H9H0#HxH+#H8 AH##H=95HI<$H5P HG+#fBz<L-2#H6H1LZH=H:PI<$H5HxH$ FH$ 8I<$H5rsH=6HpHsH=4HH=3H#H=6AHI<$UH5r60I6H=31&I<$W"H{H56A HHcH56H1,HDTHsH=2H=04.&HXH=C41&Z?!I<$AZ!I<$AxHl#HSH5q2AH81I<$HH=\31%H=n51A|%GZ>F8!I<$UH=4HK%!I<$ HsH=)51&%HsH=51%f.1I^HHPTIAH`AH@H@fDH='#H'#UH)HHvH>#Ht ]fD]@f.H='#H5z'#UH)HHHH?HHtH#Ht ]f]@f.=y'#ubUH"Hp'#HATSHۼ"L%̼"H)HHH9s@HH='#AH2'#H9r[A\]'#H="H?u .fDH9#HtUH]Ht]USHHHH;Ht H(t,H{Ht HtH[8HuH1[]DHH[]1Ðf.AUATIUSIHHxHHË@(u\S$uDHH{+HHHCHLkC$C 1H[]A\A]fDK$tHHIHtHHID$Ml$HHHB0HuLb0HCC$Hz@HCHHdC 1_HC1H#H51LH81<)H{#H=<"HHQ#H=:"HXH)#H="H0LAWAVMAUATIUSHIILHHT$H,HT$HHH2HHMLHHCMLHHCC HkHHvC D$PHC0HC8C$HC@C(D$XC,I$HtXHX8I$1H[]A\A]A^A_MHKMHCXHCC `IEI]I$HC8H1[]A\A]A^A_øH{/H;'HgDHt]USHHHH;Ht HXt,H{Ht HCtH[8HuH1[]DHH[]1Ðf.HATUISHG@Ht7H8Ht&f.kID$@H<HHuHQI\$0Ht5H{tgH;7H{.H{%Hk0HHHuI<$I|$I|$I\$8LHtIDH[0[]A\ff.AWAVIAUATEUSEHL$@t$4HT$8L$0HD$hHD$pMtLT$hHD$pL=)#A1D\$ Ƅ$:HD$ HD$h1I7AHD$(3E4Du EtAtMMI7HHۉH,HUHuH}uMD\$LLc\$ cH50LHHD$HD$xD$HD$ Dd$(HD$XH$HD$ HD$dHD$PH$@HD$@MH$@HT$HHHl$xHH!%tDHVHD@HH1H)fHH t X9|HcHHD$ Hl$xHGE<#;H5H t- Hu  HuD\$0EtH#T$ H5ϋH81UHD$HtHH|$h1 fHUHtkAIcHHH @E0}t H}(HHDŽHHAHDŽPUXE|$ ~HcL$ }QD$ HcƄ:E0H}(HD$ Ƅ:/fDHHDŽHVLT$D\$HMWE0PHt$0H|$8LM LE(VZYD\$LT$H;#H=L?1H@H|$hI7D$ @I7T$ @HHZH1ҍpH"IH t 9|HcL$LJ~HHcAt HA~@v(@ t"zfALHxq@v uHuzHAA<$"3LD$hHLLD$HLD$UHcP,EH IHʋS4tIAtDT$(u>Mct$0HH #H58L$ H81jDD$(HMYT$0HHn #H5׊L$ H81 MH$LD$PHL$@Ht$8|$4HD$d-=:;HHDD$LEt8;$XHD$@L$LHP81fDH ;Z9uH #H5H81IuMMLD$hHLHLMIHH #H5QHH81MuMu {HsHtUC0H|$ ED$H‰D$H蝱8H|$ E111LH|$ D$0D$0C76MPHt$X1LHD$LD$A8"{HT$xHMtKH=?AH HHLD$hE1M^I\$"H^HA|$|IHcD$dHH@HH#L rH #H=)1HH|$hyHH[]A\A]A^A_ÃLD$hH5GLLD$LD$tA<$1A|$E11HHH@CML 1(E1HcLD$hgD$LD9AL=&HcD$LBƄHD$HHDŽ@HDŽPDŽXDŽHVHm #H=*1HrH|$hHL%4LD$h1D$0CH #HSH5H81H|$uH\$hdH|$tH|$MuH\$hH?L%%#A$9D$4*|$4)ǃHc]HHC@A,$9l$4H|$8HcL,׉fI9l$4)HcI}HHH\$hA$HC@)HcH<uH#H=HeHA"MHH#H5H81uLD$h|$0 MH#T$ H5̃HH817L$0&C{H`#HSH5H81H5eLLD$1ɅLD$E1H#HSH5H81A<$uCH#HSH5H81wfLc(1kqmuH=HHgMIH~#H5HH81\$0HR#H5;LH81H2#H=3H9oH #H= HJH#HSH5H81~H#IRH5H81bH#IH5IRHH81;MIlHs#H5HH81DL$0EHE#L$ H5ʀHH81DT$0EmH #L$ H5PHH81IH#HSH5 H81(ABH#IRH5SH81QH#H=F11HH|$hpHd#H=1HiH|$h?CtrH(#HSH5H81IABtNH#IRH5pH81Hh1[]A\A]A^A_H&#H=.H-Hl$(IqHAA0H\$@L $H߃҃膦L $t)H#IQH5~LH81_Hl$($Ht$1E11HL $H߉c%LH5~L $AAK 'H\$H53L $HL $t;1Y{OHD$HT$H|$(HLL $L $KHD$(Hh[]A\A]A^A_L $dHHD$L $HHt$81H;"L $ HT$8M@,HHD$HDN@u+H|$H2IY(H\$$f.HH|$H|$ 1L $3HD$HL $KH=?HH WH|$H5L $pHD$L $IQH5{"Hy"H5~LL $H81HD$L $DkkmuH=HLH5}1HD$f.fAWAVAUATUSHH|$H$H$L$L$t@)$ )$0)$@)$P)$`)$p)$)$H$HHD$`H$D$XD$\0HD$hIIIOLl$h1A HL9sO|%uHDA"DuI1H7!zuADu zADuKTHJA9ܺDuDH"IUH5H81~: )"Du:?ff.AWAVAAUATH=USHIHxDL$ HL$LD$边HDL$ 1D$ ++H"H="D;HE9IcH<Ll=H|$ IU -@+@-LEfAHE9H -uztLD$HL$LHDD+E9AIcHt}RAMH~D9~'HcHDfHAHHPA9|HA9ωHcAH|uDzfE_ADE9}$D3DHx[]A\A]A^A_fAHxD[]A\A]A^A_z@-t@ELHDDAfDA$<:D$ A4VՁ<|$ :P3HcʃA< @:@|$ EfDE_H5"DIEHH"-:5Iu~Ht$XlHt$X~-@@HD|$8HD$0<=D$gHcljHD=tHuT$gL$`HD$HHHD$PWD$`+D$8LD$PD|$HPH@E1DADfDHcЍHAHcA44@:t-Wu@;t"9uHxLH[D]A\A]A^A_HHcA<4:E͉|$8iH"A?E_H5DIMHUH "H81诸IEHD$XD$8D$` xH3"EA?2HHUH5H"H81ADE_E9DSH"E1|$ : AGd:HHUH5mT$`H5"HcHT$XH=Ht$ HT5H5q"H$D`DCHt$D$`1+D$8Ll$(Dt$@D|$HƩ@HQ"ufHHH="E111HfAWAV1AUATUSHhHD$0HHHD$[H裪5"HD$ H"L5HD$DH1Lh*H2L-HxE1HD$DAE!IutH;t$| JtI9~81٫LIE]A}!H, H=ID1 AE!HAǃI(9vD)ƉrHPuH=11nHT$Ht$H=-"Hu%1^I9~LHD$8H)Ht$0H=l1苔HH[]A\A]A^A_@H=1b[fH\$(1Ht$@_H=H1#f.US1HLD$@HD$t$0D$HD$HD$L1HHD$ LƉHD$XHD$hHD$`HD$HD$ D$(D$,HD$PHtHĈ[]諙8H$^H=H1F?HĈ[]AWAVAAUAT1USEg?H8豝H"HEH$EIE1AMcHDA ?)HHD$HD$ HD$HD$0HD$1IH9HHD$(H)H1HT$ HHD$J E1HW"LD$AHH8MD11:~VD1H)Ht$D tgAfAF|0 AMH=&@11~H95H=N1D近1@8 H$0]H=gH1D}1H8[]A\A]A^A_f蛗8IEH=RC$C CC11ADtEуAD 9Lu؋sKS C$!s!K !S!CHq"HHHHm0H[1]A\A]A^C$C CCf 1LQS(ǃt9 v;u6H=LL1IH聎 []A\A]A^=wʅC$C CC1111fDC$C CCH=1vf.f.f.f.ATAԃUHSHAAH{HtxH{HtjH{Ht\H1"t2CLt+HS CLH<-CLuH{ [H1]A\ ~,x!載Au&{0e覉[Atf.{0~,耉AuA*@f.AWAVAUATIUSHHL5]"W4IH9HIHHlH4H9/AAD$4AD$(AD$8AD)H9HAυD|$ AT$PiA|$,PIt$POAD$8tMH=1LL1|"H[]A\A]A^A_DI|THHXE|$81H[]A\A]A^A_HHH)tA|$0HH螑uH=1LL{"H)AT$(HAAD$4HuyfHW(Hw0H,OH=V H5~AD$4LL*AD$4IPHAT$44A|$,Ht$ \A|$,HHD}I|THA|$,It$PAD$PE+t$8IT$TL)IHs"uNHtAAL$TuNA\$8II|$\LHIL$TILHLH)H H)HHAAL$TALLALfLf.HtkAUATIUSHI&HHu*7ˉHDX@uE HH]t'wIrfHL[]A\A]fHH="tfUSHHHt:HH"H1GHH5HHƄ$H[]f.H5wHtH=H1)Hf.SH5TH`t4H5}HM¸tH5&H3¸u[fDH5 H¸tH5Hu[H=H1{[fDAUATIUSIHH"8tdH ]"H HLLuH[]A\A]fDH=)H1[]A\A]҉͉u 5fDt*H5D1ɉLtH=1uօu8ft*H51ɉLxtH=1vuHz"H5LuGH5LLH= 5H[]A\A]H=1DH=1AUATIUSHIHHWP4HÅu=@1wD{0y068@Ht$haDH=H1ж51kLD$dD$dH="oH 7"H9^9Lt$H5WLH5LLH$H{IH{IH{IIH7"0KL1@HC HH=MMH AWLHt$1ѵ9kLXZwiKHSDH5H|$>4L$HL$HH1L6wƄ$~H|$LKHSDH|$H5QIHg"DEDKLEt1HC H='LH19kLwH=ܽH|$H5/H HH=MMLHEH1AWHt$迴A[][H|$H5HHH=LHE1致&HD$H$HDŽ$H8HD$HH$HD$H$H$HD$ H$HD$(H$HD$0H$HD$@H$HD$8H$vwHSHt7Hu 1[H=AH1迳[H5 Hwt-HEtHH=1耳[f1tH5ff.AVH5AUATUSHix tHhH5HvH- "EH5]H*p tL`H58L@vMH5HH :H5HےP HŅ"H5ШH贒Hŋ@ HHp"H5H艒Hŋ@ H H ="[]A\A]A^@H5Lu MHߺHcH@H}6H˺Hc H@H5Lat%H=¶L1fDH-"EDƹ""HH"%DH1H" DHHj"DHHR"DH H 2"DHH"1H9H5HH"#H‹@ LrL)uH<sHHH"IE1fDAMft2OuHHDQ@%]tUMHAMfuE1*HHR"1HH:"1A~vtyE%E%ME%HaHuH=-1@HuH=ŵ1ޮ@H=iH1迮xDEuSEsIHAH= 1膮H=w"s3H=1bH=Df.ATIUH5SHjHtHHu6I<$tBI4$H=71[]A\@H=H1ʭ[]A\vqHH¨"@4@8@0@,@<@@H@H@H@tH@ @LH":tHH8[]A\Ð@D@HH="fAUATIUSHH HtPH= 1ЫH=(1«H;Z腧@{H[] HuH=}1莫f.fAE1RDD ?tl<(LAA AHAD9fFvsDHcAAtM|@u%IAw@t HlHuHcM<At{E9uMdAfDIAt$A@t HlHtA9t>A)A}Hc/HHtGIcLHHn+HH[]A\A]A^A_1H[]A\A]A^A_I11m1H=1,1DEAWAVAAUATIUSHHHL$1E1f.AHkHt=HcAAtM|@u$fDIAw@t HkHuHcM<EEtkE9uMlAA@IAuA@t H^kHtA9t0Lt$A)LIcHLkmAHL[]A\A]A^A_H1[]A\A]A^A_I111AWAVAUATUSH(A9A}H9D DzE1ҍAHHD$HBE8AE1HD$AE8A)1AA fDD9wCD:|uLlE:Mt!DD9vE1H(L[]A\A]A^A_@HT$H|$HtDL$DT$lDT$DL$u뻐2H([]A\A]A^A_HdIHHt%HuHHVHO҈QuHHH= 1)1AUATUSHHtaHID1H9Hxt6HDI|siHuH9HvfDHH9IDuHH[]A\A]1ff.AWAVAUATAUSH(HM[HRLD$L$Ht$H<$iI gH<$L Ht$L$LD$IIHADT HtII9IADT HuI9҃-?+$?0>.A D$HE81II9gE115A0A9@ukI9wfI9uiD9ڽ}_II9tnMC\ut[ffۃ 7A)A"fDH([]A\A]A^A_@뢐MMc۽Mt$tIڅtL9tEt I9sA9uM1fII9s$LcH<$HT$ `ItHLCH<$DpHt7MLBDHLt&MTBDPMtHT$MBDPu LLI@AEA A fA J /Cf tPfvTf=wUf?ȀAIHtH=1 H1[]A\A]A^A_ˈf ƒ?fȀ?AʀQfDHxAWAVIAUATIUSIE1HIEI]@,IM9GC,7@\tT@DIMIEHYH9vHI}H9HBÉH-$HIMI]IEHYfINI9vCt7FHt$HLDWAHuA\RHDTHD[]A\A]A^A_fHA2RHTRHASAHAQAWAVIAUATMUSIHH(|$`8HL$1LALL$謦HILL$E11LLHߋl$HI0HTHIL|XHHD$PHHHǾ'T1LHVHT$LHBXLLHVuD$`LPHR+LPT$`tLPHRfDH([]A\A]A^A_f.E11LLHHItHSHILYPLHPL@PfDL0PCL Pt$`dfLPL$`tLOH߽Q;fDAVAUMATUISHASHt2HHMDLHH߉R[]A\A]A^fDfAWAVMAUATIUSH5pIAHTHtU111HH4LHHHt@SMDLLH@HRH[]A\A]A^A_DDSf.AVAUEATUISHARHt2HHEDLHH߉Q[]A\A]A^fDfAWAVEAUATIUSH5oIAHSHtU111HH4KHHHt@REDLLH@HQH[]A\A]A^A_DDRf.AWAVMAUATAUSHIMHPHtIHHLD$HHMMDHPH߉OXZH[]A\A]A^A_ffAWAVMAUATAUSIMHHt$H5nRHt`111HHJHHHtK_QHLMD$XMDHPHt$ H߉PXZH[]A\A]A^A_øQf.AWAVIAUATIUSHEH(HT$OHI;KHHLWMHcPHHH1O1LH$QLDSHt$HcHDStpHT$LHHOtYEu$T$AHMH(H[]A\A]A^A_t$HDHIHtKLLK‰D$뱐HKHMH(1[]A\A]A^A_Df.AWAVEAUATIUSH5lIIHPHtU111HHHHHHtAtOELLLH`HHuMHH[]A\A]A^A_1@3O1Df.AVAUEATUHSIHIHHT$ Ht6HHELHLHHJHH[]A\A]A^@1ff.ATUISHHHDD$ FDD$ HLHHމ[]A\XUSH5skH^OHt1111HHXGHHHt8NHH[]fD1@N1USHUEHt0H111HOIHHEHH[]f.1ff.USHHMHHHt]HlHHEHu'111H)OHH>EHH[]@H(EH1[]1@HATUSHPLgMt=HLHH v,8LHHtEttqHHHP1[]A\fDAD$<0tnH5AD$HLJHt1OHt$H|$HD$LD$0C HPH[]A\ÐAD$<0t.H59AD$DAD$0AD$9H5 AD$0AD$9H5q1f.HtsUSH5iH MHHtI111HCHHKHt+HHx HtGxHH[]@HHDH1[]1DAWAVIAUATIUSHHFH1HIFHLHKHHML!HIHL:KLHIH|ILLCHHHuHHSHtsE1HDuLBJMtLECMt$L8IH[]A\A]A^A_L JH[]A\A]A^A_GLHJHtE11ҹHCLHHiLkHHtv1HHLDHtlGFHALFMtLBMtLrHLZIHbI1EH[]A\A]A^A_E1E1HEELIMtLBMtL HHILHLAf.AWAVAUATUSH(H|$Ht$EIĸM7HD$1E1@LKHx.tHXH5HtL}LJ4.JHIH|$hDHI]DI|BHL$ID HHHL$HT$H5JHH1LMDL@KHXLL$HLLIHHtQHT$JD 1HeHAtDHHHt[HH=11[H=?H=H11[ÐHFSHH=_ wk?Ht[@H=11[H=@R?H=CH11[f.HFATUSHH=_ wI?HHt-H[]A\DH=)110H[]A\H=Ž>H=]1HMtL8@HSt:H8Ht[H=>H8H=11[H=111[@f.USHHv$Hx;>HtYH[]f.H=!1HH[]@HH5HRHH[]A\AUATAUSAHHfD)HHŅtmHD5tDy-:8tH満YH=H1HĈ[]A\A]DHĈD)[]A\A]DHĈD[]A\A]AUATAUSAHHfD)HHŅtUHDUSHH(H1҅u$1E11HH1 kH~H([]AWAVHcAUATHUSHIHXHD$(HRH|$Ht$0T$HHD$HHD$$H u 1H$H|$0 HD$0H\$HHHHL$ -H\$H<$wH|$I4$HH7I$HD$ID$HIHD$@HD$8LIMM9HHOHt$LӃPLt$ MIH\$?fHLAԅx>u" $nIIIII)D$I)M9MuA+yM9LMLt$ w3$IEIIMII)D$IM9MBHLINjD$?HD$0HT$MHLHD$8I)H)L9IO…lHcLHH)<$L :@HHI9NPuLML)I)H)L9IGHc~-HLH)HI@AIHM9ANPuIcH9LIcH9,1I)HLD$HD$0fD<$Hct$LL9HHHH@xQcDD$LMMLt$ H\$0HH\$H9\$@LD,$IH$HH\$@H9\$HshL)LIHIHH9fDLHӅ~9EH8IHUIHEM)L)H9|$sHMuŋEA+MHL|$@HD$@H;$uHX[]A\A]A^A_f.Ht$(LLDHH9HHHHHxHQB@<$HcL$Lt|f.A0HIHHAvPP@H|$AE+=4$H|$8IMHHIEHl$8D$ HL$(fIH0HIHHIvHPH|$0HT$HHHHHH(HIHMD4 HHcIH|$McIHHILAׅLLAׅLl$LLAׅMHMHD$LM4HHD$ LHD$HAׅ`LLAׅLd$LLAׅMIHD$ L4LLHD$HAׅ5HLAׅLt$HLAׅLILLAׅLLAׅLLA׋<$MIM<$Hct$HD$fDA $HHIHHAT$\LML)I)H)L9IGHcHcLH)Ѓ<$Hf.IH0HIHHIvHHIcH91H|$LHHLD$L $H$LD$L $<$HcL$HD$8IfA6HHIH@pAVKMILl$LL$A4$IڋA99f)ƅ39MIM%AׅLLAׅMIMHHHDHHHHHHHOHPLML)I)H)L9IGхHcLH)HLAׅLt$HLAׅLHH|$HcLcL A9MA29>AA)EHIA4$IOA9M4AAA)EINM)E.AA9AA)EEDA)MILI999MIMLLAׅLd$LLAׅMHAׅALl$LLAׅMIM%Ht$(HI $HHIHHHIT$cHL$(HI6HHIHHpIV9AA)LIT$IMAHcT$Ht0f.A $0HIHHAt$HHT$(DI $H0HIHHIt$HHhLd$0HD$LH(II9Ld$~D,$H$LL<$L9|$shMHI)LILI:f.HHAօ~4EHu[HEHHUHL)L)H9|$sMIuȋ+ELLH,$H$H9D$zHX[]A\A]A^A_AHcT$Ht%fA $0HIHHAt$HHT$(I $H0HIHHIt$HHM9A9xRDMMA9)IMIډM)IMI։M9xMILL$AWAVHcAUATHUSHIHhHD$8HRH|$ Ht$@LD$HT$,HD$XHD$ D$H u 1HD$H|$@ HD$@H\$ IILHN4XILl$X|$H\$ IHHIHD$ MD$HHHD$PHD$HLMIL9IMwHT$ HH|$AՃpLLd$0MLd$ INfLLH|$AօxCu%L$xIIUIIEI)D$I)L9MuAA+$yLL9MLd$0Iw2T$HIHII)D$HL9I&LMINjD$FHD$@H|$ HHL HD$HH)H)H9HOƅHcHH)Ѓ|$Lf.HHI9OPuLML)M)H)L9IG…Hc~/HLH)HH@A$IHL9AL$PuHcH9|IcH901I)HLL$ HD$@{@|$Hct$,LLf:HHHH@xJ[DLMMINjD$Ld$0H\$@HH\$ H9\$PLDd$IH\$HH\$PH9\$ skIHL)LMIH<@HLH|$Ӆ~9EMHEIHUIL)M)L9T$ sHIuA+EMHL|$PHD$PH;D$tHh[]A\A]A^A_@Ht$8LLDHH:HHHHHxHJ:@|$HcT$,L|DA $0HIHHAt$HJf.H|$ +3t$H|$HHHHHHl$HD$HT$8@I $H0HIHHIt$HHH\$@H|$ HHHH(L,HHIDMmC$McHJ'HcHHH|$HD$AׅHHt$H|$&AׅHHt$ H|$AׅHH\$ H\$K&ILLd$0MH|$LAׅHLH|$AׅHLH|$MAׅLIHD$0H|$I\L$HLAׅlLHH|$AׅLLH|$LAׅIILHt$H|$ALd$HLLAׅMLt$LHLA׋|$LI6|$HcT$,HD$ +A6HHIH@pANLML)M)H)L9IG…HcHcLH)Ѓ|$Hf.I $H8HIHHI|$HHHcH91LD$H|$ HLHLL$LT$HLL$LT$N|$HcT$,HD$HmA4$HHIH@pAL$HD$ MLHD$kH|$ AMAE79q)…9IIIAׅLt$HLLAׅLHHHLHHHHLGHHLML)M)H)L9IG҅HHcLH)LHH|$AׅLLH|$LAׅIHH\$ IcEH< Ic܋7LA9NAA)ELIAIOA9M$AA $A)EMOT I)A$A9AMAA)EAډA)MIMI99W9LIMIHLH|$AׅhHLH|$AׅIIILAׅHHt$ H|$AׅHI\$ H\$HT$8HI6HHIHHpINHT$8HI4$HHIHHpIL$9lj)LHI|$ IAHcT$,Lt'fAM0HIHHAuHNHT$8fDIMH0HIHHIuHHLd$@HD$ LH(II9Ld$5LDl$IH\$HH\$H9\$ seIHL)LMIH6fHLH|$Ӆ~5EMuWHEIHUIL)M)L9T$ sHIuA+EMHL|$HD$H9D$zHh[]A\A]A^A_AHcT$,Lt%fA $0HIHHAt$HHT$8I $H0HIHHIt$HHQAM99xUMMA 9AA)IMIډMAA)IMIԉM9xLMH|$ f.DAWAVAUATIUSHL/HOI9s)LfDx9tPI$HHBH9rI$uAD$u AD$HV"I$ID$1H[]A\A]A^A_8]uH9sH-G"HL)Ht:L5G"Lcf.LLH2uB|=t,II.Huڃt/AT$pAD$bAFH[]A\A]A^A_AEVff.USHHhtOHH[]ÐtHH[]fDHLcH Lc@LP1IMt fDNH (F HI9uKD H9t f.Hh HH H%H Hf.ATLgUSHHI9vR11%fHH4H]SL9TrtDH0BDFu΅~[]A\1fEuE HT"HEHE[]A\ff.HHWH9r$OHJT"H DT"HGHHHH9v8[ux.uHS.HHHHKH9sHrH9v :.t=DSuCH5S"H3Hs[f.Gk@z]uHH[ÐH9w | fUSHHH4HHCHtHCHk H[]CuC HKS"HHCf.AUATUSHH)Lo(t6HHHw HIhHCHK(JH4H<Lc(HL[]A\A]fUSHHHHO(HG H9}HCHqH Hs(HH[]DHHT$HH?HHH4@HK(HT$@f.GATUHSHLg(rH}HEHHN$HH9|HHHPPH9HHPPHH9uHHHHU(H4H|HHEL$[]A\f.AWAVL=cAUATIUSHoHAAHCLC(ueAB<~1A@Ǎ<AD~1AwIcLfDHAQ"CHHCH[]A\A]A^A_@LLHAIcfDLs(H[]A\A]A^A_DM)LxIPHiIvDHHS(DkL)EvHHkHS(DcL)EQLHQD[E91ҾHDSEHC(HHpDKELLxL)HLD$HDCHS(L)ELD$IvIPHAAIfDM)LHIPH9CcHS(PL)HH[]A\A]A^A_@LLH*AIAf.H߾cHS({LD$L)DLHsLD$)1ҾH"KLD$ HC(HHpSLD$HLD$AWAVAUATIUSHHHPH9WvQH='bHu'AL$HI$H[]A\A]A^A_H=aHID$8h UP AT$0ID$89LchHxH HPH HcݍEHHIC HCHCHLLIՃL+)CI$M|$L91D$fL9]Z-HHu L9Y-[u L9LIT$I$H9s 8-&@ʼnƃHK C 9uI$M|$L9qA|$JHL"I$ID$HI|$8H[]A\A]A^A_(AT$11ҾLI$P:= HL9I$r"Al$u AD$HDL"I$ID$<-<]=L#HK C I$M|$L9BHPI9v 8=1EL$EuAD$DHK"I$ID$I0AD$uAD$ @LpM9M4$AD$u AD$HvK"I$ID$fK"<]t<-E|$Eu AD$H@K"1I$ID$IL=B"Mt4L-B"HLLuA"I_(MNfD+?{LM7M;wAĉs A>,iDHLIMgL9s,8}Lpu8IA~} M9M7uAGuAG fH1>"I_(IIGIIIW(HپHLH)HEGEM7MgIO(M9sAPրv<A)S;A.qA[A(IG8H@hIG8L`hI  IG(KD@EOEOIIWH9s$HHH9v 8\)\LI  IG(KEGEIIOH9vLHPH9vC8\qAu2Mw(AGHG7"IIGH1A$L@1Mw(EoHIEGIG8H@IG8@DMw(IIOLeA{ADD`HIHHAOMcFHLHKAGIG8@dIIODH9s%*HpH9v \IIOMw(DID(A\EgEuAGH5"IGHHBIDAEA)AwtwDIW(HLIHLL)H6IW(EOL)EHLXLEGMw(E]IIOL11f.A*u#uEWEuAG H&5"IIGALKIIOH;L$ t(AWMNMO(IG8H@IG8@HI_(H9\$HH[]A\A]A^A_@IG8@$E_Ez1Ҿ(LIIOf.LIIO@EWEAG fDA}Awf.L`LH)Mw(I1IO1LvfDPLIW(L)5E_EuAGH3"IIG@x{IHLIoM'IGI9s A<$,LLIIOH9rcAwuAG I_(H9\$H 3"IIGXAGuAGH2"IIGHH[]A\A]A^A_fDHPH9v 8\H9tz\tIHHH9uIl@:}uH9ZAO^AG QfIT$H9IL$QAT$HL$DPL19ÉAuAG H2"IIG@HD$ M'LIOD$<^D$= D$>]IHD$(HL$D$?IG'HL$M'LIO[LpLIIOH96HPH9)fDLhLL@LL8LHD$cHD$Hfx}PMw(H1I1Lx)ERx)HI{1Ҿ L1ҾLf.AWAVAUATAUSAHtO AIHuUHIǿVHHŹ tH L$ I9v.HL$ H[]A\A]A^A_LI9rI)LHH|@H|$0NHHD$(HD$8tLt$MHl$HLt$Lt$D$ D$@IF@IfHH@PHH9uHHHEHEHExHHEP)HDžpEx1E Dm$E@EDEHHEXE`HEhELHEdDD$ EHT$8AHBHE0AWLD$ HT$8HHRHU8HE(HD$8H|$(H4IHHET$ HEE1E1E1AHpHHLQHHXtXHp!Hxt1LIIfDHB<u9uAAI됋ELAEЍPAĉULACtjMِA9uJM HEALcmQH~(088u"1fDD<8D8<0u L9uE!AIAupHD$8I9_({ HD$@$~fDID4I%IKHH9ufHD$HHPH9\$"H2H{B HCIG H9SI9_( H9sHp@_I9_(q3HpHfI9_(; rfH=pMaH=xH=hIAHI+T$IHHLID$LMLMH(HD$xPLL$0HT$H^_ID$J,0{ HL$A$fAGAGAGI9_({ HL$A$DAGHD$@$@AHO|Ll$A/HDIO%IDH4LxL9LEHMLD$xHLPLL$0yHAXAYI$JH0J%H9uf.ID$8HL$ HH9YHHAD$xLML)HLPLt$0HT$MHAZA[:LMHHD$ @HD$ IT$8MHHHD$ AHI+T$IHLLID$MHLMHhHPD$xPLL$0HT$fHZYID$Jl01f.L\$HMD$xLHLPLL$0HT$HA^Z]L\$AO4;D$pdP6H9\$&fDHl$ MHD$H9Df.AWAVIAUATMUSIHH8HT$LL$ M9 M<$IL|$MIWf.H=DH= RH=(H9\$HIM9KJ4H%H=0SvH9 H9oH9I9_(vU3@ @t$T$H8Wu0_t+I9_ s%sHpHL_C1H8[]A\A]A^A_H=`LMM~NLL%H=X'AH=HH=P H=8uEAIcHID$L@ImHI)HT$L\$(HL$L)H9FID$LHLD$H>&T$pL\$(HL$LD$A@IcI9t@J9MuMLÉT$pH=H9\$8HCHDI9_ >I9_({ HD$@$~fDID4I%IKHH9ufHD$HHPH9\$"H2H{B HCIG H9SI9_( H9;sHp@_I9_(3HpHfI9_(; rfH=pMaH=xH=hIAHI+T$IHHLID$LMLMH(HD$xPLL$0HT$H^_ID$J,0{ HL$A$fAGAGAGI9_({ HL$A$DAGHD$@$@AHO|Ll$A/HDIO%IDH4LxL9LEHMLD$xHLPLL$0yHAXAYI$JH0J%H9uf.ID$8HL$ HH9YHHAD$xLML)HLPLt$0HT$MHAZA[:LMHHD$ @HD$ IT$8MHHHD$ AHI+T$IHLLID$MHLMHhHPD$xPLL$0HT$fHZYID$Jl01f.L\$HMD$xLHLPLL$0HT$HA^Z]L\$AO4;D$pdP6H9\$&fDHl$ MHD$H9Df.AWAAVAUATUSHˉHD$8IH9ALAHL$DɽAL$A~L$M4H LHX?H0t_QHtH H(uA~Tf.HMH9u[]A\A]A^A_fAAL|$ILHH9Bf.|$%HrA0HI8@f.AWAVIAUATMUSHHHHGhH;w HT$(HL$ H_PHD$HG`HD$8FD$HE1HHP(%HD$ HAILH}HSHwAZL;}(A[HD$HD$|$ E7|$1E1A H}AtK~IDt$0LD$Lt$ H}HHwEAPLLI_AYuDt$0H}HD$At8|$H|$0ZL$HH|$0B_t_fuZAt*H|$0'HAH|$0Q!A_\$؃t0H|$0HH|$0Bf|$_ A${/Ld$HL$H_(Ht$C<,LHIEHL$?L;|$(HLLLd$8IL"HEHt$HHP( H}HESHT$0MLHwL;}(HD$XZDt$|$ A fDH}G$E1A AtEj1AAt%AABA_AHHwLLD$EAPHT$0H}HD$Y^DEcH}A _DA_G$bAAEAĂ_HAE+@AHD$HH[]A\A]A^A_D$]@AWAVAUATIUSH8L9LD$HIIHEHJHD$JHƁHXHxHHLt$H|$HHH_]HhHXLt IUILLH;LD$HLHHI"I9uLD$ILLLHHLD$LLLHIMH;\$H8L[]A\A]A^A_ÐLD%HHHH9uHLIUILLH{LD$HLHHIbI9uIFH|$H\$HHEHHH8%Mt6fHEI^IHJ%IJIV%H9LDMHLLHI9uHMH\$HJ<2H|$&fH(tH0tHt IDII@%LH+UHHEIH{fHp%LH+UHHEIHPELIUILLHLD$HLHHII9uIFH\$ ML|$(H\$MHD$IH MIHLILLHI9tHLH\$ ML|$(t9LD$HL$HxIMwHxLMAWAVAAUATUSH?etHD[]A\A]A^A_@HGxEHD$uՋ@@AljD$AtAHD$DIIIHx(@vNHD$@$LEAHHHD$HHAHD$8HL$8H9L$IAT@$LEAHHHD$HHAHD$8HL$8H9L$wHD$L@XMHD$HH9{A\$LLd$ Ll$(HIAIL9 E8,$uHL$HL)HcQ`H9|HLuL\$Ld$ Ll$(H9l$8HD$H|$8Ll$hL$HD$pD$Hp8HH0H$$L$HDŽ$HHHD$HL$HHDŽ$HH$HDŽ$H$HDŽ$IHDŽ$HDŽ$IH|$@HL\$xIHD$PH$D$IIHD$`ID$HLALLHD$8L$HMAP[]IHD$($HD$ D$X$@HD$HL$@H9D(L9D$(HD$ HDD$|$ HD$ 11|$A %A@t>~fDHT$HB1"Afnf ^H!H!HD$HHT$PAT$@ft f f\$BfHL$HT$B1蕜Af.Lt$L#HHI!dLLH$D$@J$%=L9L8U!HT$ILBD1ݛAf!ft$@ofHT$LpB1蜛AHT$L8B1xaIGLD$ HHD$(LD$ Lf|$@ D$Df\$BHDŽ$HDŽ$HDŽ$DŽ$0A]H$Iw LD$ LD$ H$H$f\$BA]HD$HHT$PD$D賠8HT$HB1cLAY{8HT$HB1+A(K8THIHT$`BD$@8"HT$H BaHt$(H$ LD$LD$D$ȟ8HT$HB1xaDD$oHT$L龂BPAMHL$HT$B1*A)HT$HcB1A*83L$HT$IB1֘还AfDH HHMHD !1ExAUATAUSLAHH~IHBY1`c͚`cHMDDH!xe=0`c1H[]A\A]ff.HUAB1ӗ`c虡HUHپ؟B1誗`cpfS`cH N!xCH=L!t %uIJH3!!HtHlH!`cH [fDHBuD$%=t=uܖH![!HtH$HvBzH$H9$t($%=UH衘H@HD$H9$uɋ$%=t=fAWAVAUATUSHHt$(HL$ D1IЉD$0j!H$L$PE1D$D$ D$D$4A`c蒞D5;!EBHDHH !ALLHHH DH !LLD$@HHD$@HD$HȍyHLH P1ND!DA ?)A@?IEAIHLH|$`1HT$4Ht$`HD{A`cID0胞ED$4tD$`;!DAsAFE1AF|`c&AAzHsB11.`cDH[]A\A]A^A_fDA u E1fAcE1fD`cIʼnT$,萝T$,A׸+BAA%BLNHIM15B11D/D1HL$0A D< zHI1$LHD$(H{EaIY AA HD$ IAH{ H{(H{0H{8H{@H{HS_H{pH{hH|$81LɺALL$`D$ +BA%BDt$ 0BALNH1ՐLL$IcLt$PH\$HD$PHD$XL1111M肑AMtIH\$¾pB1LL$qLL$DLL$OLL$L肓|$ %E1D$D$SA}_HHB1 E1D$D$ D$IA8IA8IA8DA+B袏D$DLt$PD$%BLOHHM1BvHcD$HD$XHD$P1111M3{AMt߉¾pB1/|$E1D$8@A}GHHUB1II8H{ VII8H{(III8H{0DII8H{8?II8 H{@:II8@H{H5II8+fD蛔HDD8B1Q`c fIA8kII8`cH5BB1IH\$~AMXAMAMrAMVHtKUSHHؑHH譔tH1H[]H($@f.MA8MAWAVAUATMUSAH8HH|$LLD$T$HD$(HD$ 9LLp-LxEK7HH耎HHAD AHt$J|%LM裖J|5LL蓖HD$T$Ht$ IH85H螏H8[]A\A]A^A_DHHHtE1øH9AWAVIAUATHUSMH(HHL$T$HD$HD$(MHXLLhIlI9HiHIHt$HL蝕H9I<LL腕T$A>Ht$IL4L蔎H([]A\A]A^A_HHIt Ht$HLH-f뷹ТBBB ТBBBHB<v 12tD1.uAWAVAUATUSH1HLdALkE*HBD`HHuA1B|-.tZ[]A\A]A^A_1DE1LcIO4/EEx;HBDpt&IIuAB#HcЀ|EEu1Eq1tATUHSHI.t%HsH{M[Ih]A\D@[]A\fDAUATIUSHIHQ.t-u$HHsH{MM[]A\A]iH[]A\A]AUATIUSHAHH-tt>ATUHS@IH-t+HsH{M[He]A\?f[]A\fDHStIHt=w8HcHHuH2HH[fD[ùBFBBHtC>t>ATUHSIH,t+HsH{M[H2]A\of[]A\fDHt[>tVUSHHHP,tLHCHHD$H$胊{L@H+H\0H[]Df.fHt[>tVUSHHH+tLHCHHD$H${L@H-H/H[]Df.fAWAVAUATUSHII~HtzL=+tiIGHD$E1AH$D)A~*DANIcκbLLcH)/tH[]A\A]A^A_fDH[]A\A]A^A_ff.H>AUATIUS HH*|HCLHD$H$賈HhHHItOHLHQ{ILqHk.LaH[]A\A]@f.fHHAWAVIAUATHUSHIHH Hr4<dLkEVAHBDjBHC5DB*MALL虇LhHtjEtI  HHDEt'fDA A HDEuH7H=MlL莅HILHH LߛBL MtwLLL HtLߛBL LHL IHt蝆MH1[]A\A]A^A_DH[]A\A]A^A_@Hu볐ADf.AWAVAUATIUSHxHH|$HL$XLD$`LL$hHHIHA,$E<I\$AHDZID$DBM>LL虅HXH$HhD$(E1Ht$0Ht$@Ht$8D$(0snHL$@ƒD$(HL2MtkLEH=w+HAHA!u tIAt uHx[]A\A]A^A_fDHT$0L2HBHD$0MuHHFHHtAM(ABHLH1V ABH1hߛBMLH|$ + H$HD$@HD$PHD$HXZHT$XHD$( tzHپߛBH@ IfDHT$8D$(L"MtLAA~xHT$BHH HLH D$(0rHT$0L"HBHD$0MuHD$HHt调HD$HHx1[]A\A]A^A_D$ AߛBHLH1. AߛB@4BAB LEHt H1øÐf.Ht H1f.HCH:AWAVAUATUSH8IHHׂHu {HD$D$ Dd$Dl$ IFHMHD$IHtWI8uHNHLՅtYEtHt$L迅tCEtHt$ L詅t-HL3MuIL;|$uH81[]A\A]A^A_DHCH8[]A\A]A^A_DD$ {\$!D$"}D$#4}}ED$D$ 1ÐHt3HHGHE11ɺpHD$H$'H@fHtHtHt1f.fJ!fScÆ9-!}%!P[c饇DUSH1HH|$H|$ H|$H|$Ht$ H|$D$ Tt?tىH1آBK}~5rkLLoL@LyLD%H$oHDž$IG L9H$H<$fmHIHD$E1A ID$AGQDHHt$CnHPHt$LL9$ruI<LD$QuLD$IIJHtIXH9$wBtBB.lfDA>4tKB tBBkBtB}BkAUATUSHHt0HHHG HtHHHHtHHu#H@P1HtЉH[]A\A]HGHD$DgHsH$хAuH{HG @HKHDwADDf.Hclj~c$fwHcNj~c%t!t߸@f.ATIUSCfHcIH{PHt lHCPHHtlHǃu[]A\f.AWAV1AUATAUSHE1E1HhGH|$XD$HG H@XHD$cH;AEHD$8AAljD$HEHD$0zHE |$HT$'HL$(Ht$0L HIT$'DM A1DHHcH8@BHHuAHu1BfgMAD$Dmt H|$A tHE HP`HtHEtL'kH1MHh[]A\A]A^A_@L$(HuȹB1fDM T$'/fDHHH@BHpHHt$ ADpAADDdMHD$(Ld$HEDuHD$@AFD$HH|$@HPBD$PHD$ЃAAtMt LE1#jt$HT$0HD?AAFPAFAHLBMDmAA1A!bfD} ~=IcAH~cDDHuDAERBD1WeXZEtH|$t HHD$DMaLHE1!iALBA8} MA@IcHuDD~cD1BdAMHD$(Ld$HHD$@LHLBDDfDHHDB} T$'HuB1E1E17dfHALBYADJE1} Hu`B1cDHHDBcHAALBHHD$DmPAHu1BwcMA} /MAAA!MA!E1E1HuB1&cHu1BcMAHtkATUSGHHp%HCH@ HtXHh01Ht.H{H3IĸMtH{LLf[]A\f.f.1ff.Ht3SHHHG HtH@`HtH{1[DfHGUS1H(H_H{ GHHߍp?LEC(I HUDAAADDMDCHBȅHcHDHBȅHcHH}HK LIHO HLK0yLQxMHD$HD$H4$HK8tHL$HʀHD$ E11HcPHD$ PHD$ PLL$ AH 1H$LHHC0HD$HC8HC@H1AHL!H9u@ DHcHL!H9t%H9uHH!C@fDHC8HC@IcHH!H9HC H IȷBH1aH([]@HC H A BH1`H([]???X@1DHC H A0BH1`zDLK@LIcHL!H9AtAu ILK@AtAu ILK@IcHL!H9HC H BH1`f.HS HLH AhB1H_XZDLK0_LHHC8AHs0HC@HC@DH{ Hc@5HH`BLK8LC01H3C^ǐHtkATUSGHHpeHCH@ HtXHh(1Ht.H{H3AIĸMtH{LLa[]A\f.f.1ff.HtCSGHHpH{HG Ht+H@ Ht"HHt"Hs|u[@f1[@[ÐHtvAUATUSHHxGHpjL[IC HtUHhHtLLSL A:1 I9r HA<uHBI9wHx[]A\A]fD1@A41HIH@Ut~HBLBI9vQC| Elu@4tx@6@LIC I DƿPBH11]mIC I BH1 ]HL1L>1(Ht$I<eHCBHP H1H\I4H|$lYHkwkf$HsL[L{HT$I4 jtfHCBHP H1HF\fEf$tfDl$HC0BHP H1H \EfEf$ bf.HATUHSx [EHHt^HDžHtHE .BH1[HL1HH;Ht ^HHL9u[H]A\g^B&tBB>\@f.Ht#H tt Hc1Hw0t1 1@H!H=!ÐAWAVGAUATAUSAADHXHHt$HL$8I$G?IHT$(LD$0IE1E1 HHD$?)HHt$H|$PDHL tPH$HLD$<$H$Ht$P1L ZxZHD$HT$HHD$@DL)J48HV[HH9IUfD_8?,$D$HT$0I5B1BfYHD$(1HX[]A\A]A^A_f.Lh\HD$(1@HD$(1@H$?_8HH $HT$0IHB1XHD$(1HD$(1mfDd$@D$DHT$(D$DAAEjMcL;%p!L2ZHI1H|$P1HHL tPHH$HLD$<$H$Ht$P0L Yx_HD$HT$HLI4/DH)HHL$ }YHHL$ }H9HNfD$ ]DD$ 3LD$D$ZD$@HD$(1HD$(LZ1H$]8HH $HT$0IpB12WAHD$(LHZ1HD$(L1Z1HD$8L LHD$(1f.AWAVAUATUSHL9!|$MItHɸA@HɈT$HD$(ȉD$HD$HD$ aHL$0LD$8AL$AHD$H\$ Hl$@DqI$DHMMEAuRfAHE31H|$H[]A\A]A^A_@H)HA9HJtΐHCHtH1H$11MHDL l@Vxe|$DH\HtPHD$H1fDHJH9HcɃHBH)HD9|A9n6f[[ PGAfAWAVAAUATL%+!UH-~+!SIIL)HH7SHt 1LLDAHH9uH[]A\A]A^A_Ðf.f.@Ha!HtH1Vf.11VHHWHZH*!Ht(UHSH*!HHHHuH[]HmHERROR: optaddarg: Unregistered option %s ERROR: optaddarg: strdup() failed ERROR: optaddarg: malloc() failed ERROR: optparse: Can't register new option (not enough memory) ERROR: optparse: longopts[] is too small ERROR: optparse: shortopts[] is too small ERROR: optparse: (short|long)opts[] is too small ERROR: Please edit the example config file %s ERROR: Missing argument for option at line %d ERROR: Missing closing parenthesis in option %s at line %d ERROR: Empty argument for option %s at line %d ERROR: Incomplete option passed (missing argument) ERROR: optparse: No corresponding long name for option '-%c' ERROR: Parse error at line %d: Unknown option %s WARNING: Ignoring unsupported option %s at line %u WARNING: Ignoring unsupported option --%s (-%c) WARNING: Ignoring unsupported option --%s ERROR: Can't register argument for option %s ERROR: Can't register argument for option --%s WARNING: Ignoring deprecated option %s at line %u WARNING: Ignoring deprecated option --%s (-%c) WARNING: Ignoring deprecated option --%s ERROR: optparse: Can't compile regular expression %s for option %s ERROR: Incorrect argument format for option %s ERROR: Incorrect argument format for option --%s (-%c) ERROR: Incorrect argument format for option --%s ERROR: Option --%s (-%c) requires a non-empty string argument ERROR: Option --%s requires a non-empty string argument ERROR: Can't parse numerical argument for option %s ERROR: Can't parse numerical argument for option --%s (-%c) ERROR: Can't parse numerical argument for option --%s WARNING: Numerical value for option %s too high, resetting to 4G WARNING: Numerical value for option --%s (-%c) too high, resetting to 4G ERROR: optparse: calloc failed ERROR: optparse: strdup failed ERROR: Problem parsing options (name == NULL) Dump authenticode certificate chain.Perform HTML, script, and text normalizationAlways generate MDB entries for PE sectionsMaximum number of mismatched signatures when building a CVD. Zero disables this limit.Feature level to put in the CVDVersion number of the CVD to buildCreate a hybrid (standard and bytecode) database fileForce using the interpreter instead of the JITTrust loaded bytecode (default yes)Load and print bytecode information without executingPrint IR of bytecode signatureInput file to run the bytecode nDon't show source line during tracingName of the analyzer as seen in prewikkaSave all reports to a log file.By default the log file is locked for writing and only a single daemon process can write to it. This option disables the lock.Maximum size of the log file. Value of 0 disables the limit.Log all clean files. Useful in debugging but drastically increases the log size.Use the system logger (can work together with LogFile).Type of syslog messages. Please refer to 'man syslog' for the facility names.Rotate log file. Requires LogFileMaxSize option set prior to this option.Log additional information about the infected file, such as its size and hash, together with the virus name.Save the process ID to a file.This option allows you to change the default temporary directory.This option allows you to change the default database directory. If you enable it, please make sure it points to the same directory in both clamd and freshclam.Only load the official signatures published by the ClamAV project.By default, yara rules will be loaded. This option allows you to exclude yara rules when scanning and also to scan only using yara rules. Valid options are yes|no|onlyPath to a local socket file the daemon will listen on.Sets the group ownership on the unix socket.Sets the permissions on the unix socket to the specified mode.Remove a stale socket after unclean shutdownA TCP port number the daemon will listen on.By default clamd binds to INADDR_ANY. This option allows you to restrict the TCP address and provide some degree of protection from the outside world.Maximum length the queue of pending connections may grow to.Close the STREAM session when the data size limit is exceeded. The value should match your MTA's limit for the maximum attachment size.The STREAM command uses an FTP-like protocol. This option sets the lower boundary for the port range.This option sets the upper boundary for the port range.Maximum number of threads running at the same time.This option specifies the time (in seconds) after which clamd should timeout if a client doesn't provide any data.This option specifies the time (in seconds) after which clamd should timeout if a client doesn't provide any initial command after connecting.This option specifies how long to wait (in milliseconds) if the send buffer is full. Keep this value low to prevent clamd hanging.Waiting for data from clamd will timeout after this time (seconds).Maximum number of queued items (including those being processed by MaxThreads threads). It is recommended to have this value at least twice MaxThreads if possible. WARNING: you shouldn't increase this too much to avoid running out of file descriptors, the following condition should hold: MaxThreads*MaxRecursion + MaxQueue - MaxThreads + 6 < RLIMIT_NOFILE (usual max for RLIMIT_NOFILE is 1024) This option specifies how long (in seconds) the process should wait for a new job.Don't scan files/directories whose names match the provided regular expression. This option can be specified multiple times.Maximum depth the directories are scanned at.Follow symlinks to regular files.Scan files and directories on other filesystems.This option specifies the time intervals (in seconds) in which clamd should perform a database check.This option allows you to disable clamd's caching feature.Execute a command when a virus is found. In the command string %v will be replaced with the virus name. Additionally, two environment variables will be defined: $CLAM_VIRUSEVENT_FILENAME and $CLAM_VIRUSEVENT_VIRUSNAME./usr/bin/mailx -s "ClamAV VIRUS ALERT: %v" alert < /dev/nullStop the daemon when libclamav reports an out of memory condition.Permit use of the ALLMATCHSCAN command.Enable debug messages in libclamav.Don't remove temporary files (for debugging purposes).Run the daemon as a specified user (the process must be started by root).With this option enabled ClamAV will load bytecode from the database. It is highly recommended you keep this option on, otherwise you'll miss detections for many new viruses.Set bytecode security level. Possible values: TrustSigned - trust bytecode loaded from signed .c[lv]d files, insert runtime safety checks for bytecode loaded from other sources Paranoid - don't trust any bytecode, insert runtime checks for all Recommended: TrustSigned, because bytecode in .cvd files already has these checks.Set bytecode timeout in milliseconds.Allow loading bytecode from outside digitally signed .c[lv]d files.^(Auto|ForceJIT|ForceInterpreter|Test)$Set bytecode execution mode. Possible values: Auto - automatically choose JIT if possible, fallback to interpreter ForceJIT - always choose JIT, fail if not possible ForceInterpreter - always choose interpreter Test - run with both JIT and interpreter and compare results. Make all failures fatal.^(none|None|bytecode|Bytecode|pcre|PCRE)$Collect and print execution statistics. Possible values: Bytecode - reports bytecode statistics PCRE - reports PCRE execution statistics None - reports no statisticsDetect Potentially Unwanted Applications.Exclude a specific PUA category. This directive can be used multiple times. See https://www.clamav.net/documents/potentially-unwanted-applications-pua for the complete list of PUA categories.Only include a specific PUA category. This directive can be used multiple times.In some cases (eg. complex malware, exploits in graphic files, and others), ClamAV uses special algorithms to provide accurate detection. This option controls the algorithmic detection.PE stands for Portable Executable - it's an executable file format used in all 32- and 64-bit versions of Windows operating systems. This option allows ClamAV to perform a deeper analysis of executable files and it's also required for decompression of popular executable packers such as UPX or FSG. If you turn off this option, the original files will still be scanned, but without additional processing.Executable and Linking Format is a standard format for UN*X executables. This option allows you to control the scanning of ELF files. If you turn off this option, the original files will still be scanned, but without additional processing.With this option enabled clamav will try to detect broken executables (both PE and ELF) and mark them as Broken.Executable.Enable the built in email scanner. If you turn off this option, the original files will still be scanned, but without parsing individual messages/attachments.Scan RFC1341 messages split over many emails. You will need to periodically clean up $TemporaryDirectory/clamav-partial directory. WARNING: This option may open your system to a DoS attack. Please don't use this feature on highly loaded servers.With this option enabled ClamAV will try to detect phishing attempts by using signatures.Scan URLs found in mails for phishing attempts using heuristics.Always block cloaked URLs, even if they're not in the database. This feature can lead to false positives.PhishingAlwaysBlockSSLMismatchAlways block SSL mismatches in URLs, even if they're not in the database. This feature can lead to false positives.Detect partition intersections in raw disk images using heuristics.Allow heuristic match to take precedence. When enabled, if a heuristic scan (such as phishingScan) detects a possible virus/phish it will stop scan immediately. Recommended, saves CPU scan-time. When disabled, virus/phish detected by heuristic scans will be reported only at the end of a scan. If an archive contains both a heuristically detected virus/phish, and a real malware, the real malware will be reported. Keep this disabled if you intend to handle "*.Heuristics.*" viruses differently from "real" malware. If a non-heuristically-detected virus (signature-based) is found first, the scan is interrupted immediately, regardless of this config option.Enable the Data Loss Prevention module.This option sets the lowest number of Credit Card numbers found in a file to generate a detect.This option sets the lowest number of Social Security Numbers found in a file to generate a detect.With this option enabled the DLP module will search for valid SSNs formatted as xxx-yy-zzzz.With this option enabled the DLP module will search for valid SSNs formatted as xxxyyzzzzPerform HTML/JavaScript/ScriptEncoder normalisation and decryption. If you turn off this option, the original files will still be scanned, but without additional processing.This option enables scanning of OLE2 files, such as Microsoft Office documents and .msi files. If you turn off this option, the original files will still be scanned, but without additional processing.With this option enabled OLE2 files with VBA macros, which were not detected by signatures will be marked as "Heuristics.OLE2.ContainsMacros".This option enables scanning within PDF files. If you turn off this option, the original files will still be scanned, but without decoding and additional processing.This option enables scanning within SWF files. If you turn off this option, the original files will still be scanned, but without decoding and additional processing.This option enables scanning xml-based document files supported by libclamav. If you turn off this option, the original files will still be scanned, but without additional processing.This option enables scanning HWP3 files. If you turn off this option, the original files will still be scanned, but without additional processing.Scan within archives and compressed files. If you turn off this option, the original files will still be scanned, but without unpacking and additional processing.Mark encrypted archives as viruses (Encrypted.Zip, Encrypted.RAR).This option causes memory or nested map scans to dump the content to disk. If you turn on this option, more data is written to disk and is available when the leave-temps option is enabled at the cost of more disk writes.This option sets the maximum amount of data to be scanned for each input file. Archives and other containers are recursively extracted and scanned up to this value. The value of 0 disables the limit. WARNING: disabling this limit or setting it too high may result in severe damage.Files/messages larger than this limit won't be scanned. Affects the input file itself as well as files contained inside it (when the input file is an archive, a document or some other kind of container). The value of 0 disables the limit. WARNING: disabling this limit or setting it too high may result in severe damage to the system.Nested archives are scanned recursively, e.g. if a Zip archive contains a RAR file, all files within it will also be scanned. This option specifies how deeply the process should be continued. The value of 0 disables the limit. WARNING: disabling this limit or setting it too high may result in severe damage to the system.Number of files to be scanned within an archive, a document, or any other container file. The value of 0 disables the limit. WARNING: disabling this limit or setting it too high may result in severe damage to the system.This option sets the maximum size of a file to check for embedded PE. Files larger than this value will skip the additional analysis step. Negative values are not allowed. WARNING: setting this limit too high may result in severe damage or impact performance.This option sets the maximum size of a HTML file to normalize. HTML files larger than this value will not be normalized or scanned. Negative values are not allowed. WARNING: setting this limit too high may result in severe damage or impact performance.This option sets the maximum size of a normalized HTML file to scan. HTML files larger than this value after normalization will not be scanned. Negative values are not allowed. WARNING: setting this limit too high may result in severe damage or impact performance.This option sets the maximum size of a script file to normalize. Script content larger than this value will not be normalized or scanned. Negative values are not allowed. WARNING: setting this limit too high may result in severe damage or impact performance.This option sets the maximum size of a ZIP file to reanalyze type recognition. ZIP files larger than this value will skip the step to potentially reanalyze as PE. Negative values are not allowed. WARNING: setting this limit too high may result in severe damage or impact performance.This option sets the maximum number of partitions of a raw disk image to be scanned. Raw disk images with more partitions than this value will have up to the value number partitions scanned. Negative values are not allowed. WARNING: setting this limit too high may result in severe damage or impact performance.This option sets the maximum number of icons within a PE to be scanned. PE files with more icons than this value will have up to the value number icons scanned. Negative values are not allowed. WARNING: setting this limit too high may result in severe damage or impact performance.This option sets the maximum recursive calls to HWP3 parsing function. HWP3 files using more than this limit will be terminated and alert the user. Scans will be unable to scan any HWP3 attachments if the recursive limit is reached. Negative values are not allowed. WARNING: setting this limit too high may result in severe damage or impact performance.This clamscan option is currently for testing only. It sets the engine parameter CL_ENGINE_TIME_LIMIT. The value is in milliseconds.This option sets the maximum calls to the PCRE match function during an instance of regex matching. Instances using more than this limit will be terminated and alert the user but the scan will continue. For more information on match_limit, see the PCRE documentation. Negative values are not allowed. WARNING: setting this limit too high may severely impact performance.This option sets the maximum recursive calls to the PCRE match function during an instance of regex matching. Instances using more than this limit will be terminated and alert the user but the scan will continue. For more information on match_limit_recursion, see the PCRE documentation. Negative values are not allowed and values > PCREMatchLimit are superfluous. WARNING: setting this limit too high may severely impact performance.This option sets the maximum filesize for which PCRE subsigs will be executed. Files exceeding this limit will not have PCRE subsigs executed unless a subsig is encompassed to a smaller buffer. Negative values are not allowed. Setting this value to zero disables the limit. WARNING: setting this limit too high or disabling it may severely impact performance.This option enables on-access scanning (Linux only)This option specifies a directory or mount point which should be scanned on access. The mount point specified, or the mount point containing the specified directory will be watched, but only notifications will occur. If any directories are specified, this option will preempt the DDD system. It can also be used multiple times.This option specifies a directory (including all files and directories inside it), which should be scanned on access. This option can be used multiple times.This option allows excluding directories from on-access scanning. It can be used multiple times. Only works with DDD system.Use this option to whitelist the root UID (0) and allow any processes run under root to access all watched files without triggering scans.With this option you can whitelist specific UIDs. Processes with these UIDs will be able to access all files. This option can be used multiple times (one per line). Using a value of 0 on any line will disable this option entirely. To whitelist the root UID please enable the OnAccessExcludeRootUID option.Files larger than this value will not be scanned in on access.This option toggles the dynamic directory determination system for on-access scanning (Linux only).This option changes fanotify behavior to prevent access attempts on malicious files instead of simply notifying the user (On Access scan only).Enables extra scanning and notification after catching certain inotify events. Only works with the DDD system enabled.When started by root freshclam will drop privileges and switch to the user defined in this option.This option defined how many times daily freshclam should check for a database update.Use DNS to verify the virus database version. Freshclam uses DNS TXT records to verify the versions of the database and software itself. With this directive you can change the database verification domain. WARNING: Please don't change it unless you're configuring freshclam to use your own database verification domain.DatabaseMirror specifies to which mirror(s) freshclam should connect. You should have at least two entries: db.XY.clamav.net (or db.XY.ipv6.clamav.net for IPv6) and database.clamav.net (in this order). Please replace XY with your country code (see https://www.iana.org/domains/root/db). database.clamav.net is a round-robin record which points to our most reliable mirrors. It's used as a fall back in case db.XY.clamav.net is not working.db.XY.clamav.net database.clamav.netThis option allows you to easily point freshclam to private mirrors. If PrivateMirror is set, freshclam does not attempt to use DNS to determine whether its databases are out-of-date, instead it will use the If-Modified-Since request or directly check the headers of the remote database files. For each database, freshclam first attempts to download the CLD file. If that fails, it tries to download the CVD file. This option overrides DatabaseMirror, DNSDatabaseInfo and Scripted Updates. It can be used multiple times to provide fall-back mirrors.mirror1.mynetwork.com mirror2.mynetwork.comThis option defines how many attempts freshclam should make before giving up.With this option you can control scripted updates. It's highly recommended to keep them enabled.With this option enabled, freshclam will attempt to load new databases into memory to make sure they are properly handled by libclamav before replacing the old ones.By default freshclam will keep the local databases (.cld) uncompressed to make their handling faster. With this option you can enable the compression. The change will take effect with the next database update.Download an additional 3rd party signature database distributed through the ClamAV mirrors. This option can be used multiple times.With this option you can provide custom sources (http:// or file://) for database files. This option can be used multiple times.http://myserver.com/mysigs.ndb file:///mnt/nfs/local.hdbIf you're behind a proxy, please enter its address here.A user name for the HTTP proxy authentication.A password for the HTTP proxy authentication.If your servers are behind a firewall/proxy which does a User-Agent filtering you can use this option to force the use of a different User-Agent header.Send the RELOAD command to clamd after a successful update.Run a command after a successful database update.Run a command when a database update error occurs.Run a command when freshclam reports an outdated version. In the command string %v will be replaced with the new version number.With this option you can provide a client address for the database downloading. Useful for multi-homed systems.Timeout in seconds when connecting to database server.Timeout in seconds when reading from database server.This option enables support for Google Safe Browsing. When activated for the first time, freshclam will download a new database file (safebrowsing.cvd) which will be automatically loaded by clamd and clamscan during the next reload, provided that the heuristic phishing detection is turned on. This database includes information about websites that may be phishing sites or possible sources of malware. When using this option, it's mandatory to run freshclam at least every 30 minutes. Freshclam uses the ClamAV's mirror infrastructure to distribute the database and its updates but all the contents are provided under Google's terms of use. See https://transparencyreport.google.com/safe-browsing/overview and https://www.clamav.net/documents/safebrowsing for more information.This option enables downloading of bytecode.cvd, which includes additional detection mechanisms and improvements to the ClamAV engine.Disable authenticode certificate chain verification in PE files.Initialize a supplementary group access (the process must be started by root).Define the clamd socket to connect to for scanning. This option is mandatory! Syntax: ClamdSocket unix:path ClamdSocket tcp:host:port The first syntax specifies a local unix socket (needs an absolute path) e.g.: ClamdSocket unix:/var/run/clamd/clamd.socket The second syntax specifies a tcp local or remote tcp socket: the host can be a hostname or an ip address; the ":port" field is only required for IPv6 addresses, otherwise it defaults to 3310 ClamdSocket tcp:192.168.0.1 This option can be repeated several times with different sockets or even with the same socket: clamd servers will be selected in a round-robin fashion.Define the interface through which we communicate with sendmail. This option is mandatory! Possible formats are: [[unix|local]:]/path/to/file - to specify a unix domain socket; inet:port@[hostname|ip-address] - to specify an ipv4 socket; inet6:port@[hostname|ip-address] - to specify an ipv6 socket./tmp/clamav-milter.socket inet:7357Define the group ownership for the (unix) milter socket.Sets the permissions on the (unix) milter socket to the specified mode.Messages originating from these hosts/networks will not be scanned This option takes a host(name)/mask pair in CIRD notation and can be repeated several times. If "/mask" is omitted, a host is assumed. To specify a locally originated, non-smtp, email use the keyword "local".local 192.168.0.0/24 1111:2222:3333::/48^(Accept|Reject|Defer|Blackhole|Quarantine)$Action to be performed on clean messages (mostly useful for testing). The following actions are available: Accept: the message is accepted for delivery Reject: immediately refuse delivery (a 5xx error is returned to the peer) Defer: return a temporary failure message (4xx) to the peer Blackhole: like Accept but the message is sent to oblivion Quarantine: like Accept but message is quarantined instead of being deliveredAction to be performed on error conditions (this includes failure to allocate data structures, no scanners available, network timeouts, unknown scanner replies and the like. The following actions are available: Accept: the message is accepted for delivery; Reject: immediately refuse delivery (a 5xx error is returned to the peer); Defer: return a temporary failure message (4xx) to the peer.This option allows you to set a specific rejection reason for infected messages and it's therefore only useful together with "OnInfected Reject" The string "%v", if present, will be replaced with the virus name.If this option is set to "Replace" (or "Yes"), an "X-Virus-Scanned" and an "X-Virus-Status" headers will be attached to each processed message, possibly replacing existing headers. If it is set to Add, the X-Virus headers are added possibly on top of the existing ones. Note that while "Replace" can potentially break DKIM signatures, "Add" may confuse procmail and similar filters.When AddHeader is in use, this option allows you to set the reported hostname. This may be desirable in order to avoid leaking internal names. If unset the real machine name is used.Execute a command when an infected message is processed. The following parameters are passed to the invoked program in this order: virus name, queue id, sender, destination, subject, message id, message date. Note #1: this requires MTA macroes to be available (see LogInfected below) Note #2: the process is invoked in the context of clamav-milter Note #3: clamav-milter will wait for the process to exit. Be quick or fork to avoid unnecessary delays in email delivery/usr/local/bin/my_infected_message_handlerChroot to the specified directory. Chrooting is performed just after reading the config file and before dropping privileges.This option specifies a file which contains a list of basic POSIX regular expressions. Addresses (sent to or from - see below) matching these regexes will not be scanned. Optionally each line can start with the string "From:" or "To:" (note: no whitespace after the colon) indicating if it is, respectively, the sender or recipient that is to be whitelisted. If the field is missing, "To:" is assumed. Lines starting with #, : or ! are ignored.Messages from authenticated SMTP users matching this extended POSIX regular expression (egrep-like) will not be scanned. As an alternative, a file containing a plain (not regex) list of names (one per line) can be specified using the prefix "file:". e.g. SkipAuthenticated file:/etc/good_guys Note: this is the AUTH login name!SkipAuthenticated ^(tom|dick|henry)$This option allows you to tune what is logged when a message is infected. Possible values are Off (the default - nothing is logged), Basic (minimal info logged), Full (verbose info logged) Note: For this to work properly in sendmail, make sure the msg_id, mail_addr, rcpt_addr and i macroes are available in eom. In other words add a line like: Milter.macros.eom={msg_id}, {mail_addr}, {rcpt_addr}, i to your .cf file. Alternatively use the macro: define(`confMILTER_MACROS_EOM', `{msg_id}, {mail_addr}, {rcpt_addr}, i') Postfix should be working fine with the default settings.This option allows you to tune what is logged when no threat is found in a scanned message. See LogInfected for possible values and caveats. Useful in debugging but drastically increases the log size.This option affects the behaviour of LogInfected, LogClean and VirusAction when a message with multiple recipients is scanned: If SupportMultipleRecipients is off (the default) then one single log entry is generated for the message and, in case the message is determined to be malicious, the command indicated by VirusAction is executed just once. In both cases only the last recipient is reported. If SupportMultipleRecipients is on: then one line is logged for each recipient and the command indicated by VirusAction is also executed once for each recipient. Note: although it's probably a good idea to enable this option, the default value is currently set to off for legacy reasons.yesExampleERROR: Unknown option passed footruehelp^(yes|true|1|no|false|0)$config-file/etc/clamd.conf/etc/freshclam.conf/etc/clamav-milter.confdebuggen-jsondumpcertsquietleave-tempsno-warningsshow-progressstdoutdaemonno-dnslist-mirrorsupdate-dbreloadmultiscanfdpassstreamallmatchdatabase/usr/share/clamavrecursivegen-mdbfollow-dir-symlinks^[0-9]+$follow-file-symlinksbellno-summaryfile-listinfectedsuppress-ok-resultscopyremoveexcludeexclude-dirinclude-dirstructured-ssn-formathex-dumpmd5sha1sha256impprint-certshtml-normaliseascii-normaliseutf16-decodebuildmax-bad-sigs3000flevelcvd-versionno-cdiffserverunpackunpack-currentinfolist-sigsfind-sigsdecode-sigstest-sigsvbavba-hexcomparerun-cdiffverify-cdiffhybriddefaultcolorsconfig-dir/etcnon-defaultgenerate-configforce-interpretertrust-bytecodeprintsrcPrint source code of bytecodeprintbcirinputtracebytecode trace levelno-trace-showsourcearchive-verbosebytecode-trust-allhttp-proxyproxy-userlog-verboseforcedisable-summarydisable-archiveno-archiveno-peno-elfno-ole2no-pdfno-htmlno-mailno-phishing-sigsno-phishing-scan-urlsno-algorithmicno-phishing-restrictedscanmax-ratiomax-space^[0-9]+[KM]?$unzipunrararjunzoolhajartartgzdebblock-maxPreludeEnableprelude-enableEnable preludePreludeAnalyzerNameprelude-analyzer-name/tmp/clamav.logLogFileUnlockLogFileMaxSizeLogTimeLog time with each message.LogCleanLogSyslogLogFacilityLOG_LOCAL6LOG_MAILLogVerboseEnable verbose logging.LogRotatelog-rotateExtendedDetectionInfoPidFile/var/run/clam.pidTemporaryDirectorytempdir/tmpDatabaseDirectorydatadir/var/lib/clamavOfficialDatabaseOnlyofficial-db-onlynoYaraRulesyara-rulesLocalSocket/tmp/clamd.socketLocalSocketGroupvirusgroupLocalSocketMode660FixStaleSocketTCPSocket3310TCPAddr127.0.0.1MaxConnectionQueueLength30StreamMaxLength25MStreamMinPort1024StreamMaxPort2048MaxThreads120CommandReadTimeoutSendBufTimeout200300MaxQueueIdleTimeout^/proc/ ^/sys/MaxDirectoryRecursionmax-dir-recursion15FollowDirectorySymlinksFollow directory symlinks.FollowFileSymlinksCrossFilesystemscross-fsSelfCheck600DisableCachedisable-cacheVirusEventExitOnOOMAllowAllMatchScanForegroundforegroundDon't fork into background.DebugLeaveTemporaryFilesUserBytecodeBytecodeSecurity^(TrustSigned|Paranoid)$TrustSignedBytecodeTimeoutbytecode-timeout5000BytecodeUnsignedbytecode-unsignedBytecodeModebytecode-modeAutoStatisticsstatisticsNoneDetectPUAdetect-puaExcludePUAexclude-puaNetTool PWToolIncludePUAinclude-puaSpy Scanner RATAlgorithmicDetectionalgorithmic-detectionScanPEscan-peScanELFscan-elfDetectBrokenExecutablesdetect-brokenScanMailscan-mailScanPartialMessagesPhishingSignaturesPhishingScanURLsPhishingAlwaysBlockCloakphishing-cloakphishing-sslPartitionIntersectionpartition-intersectionHeuristicScanPrecedenceheuristic-scan-precedenceStructuredDataDetectiondetect-structuredStructuredMinCreditCardCountstructured-cc-countStructuredMinSSNCountstructured-ssn-countStructuredSSNFormatNormalStructuredSSNFormatStrippedScanHTMLscan-htmlScanOLE2scan-ole2OLE2BlockMacrosblock-macrosScanPDFscan-pdfScanSWFscan-swfScanXMLDOCSscan-xmldocsScanHWP3scan-hwp3ScanArchivescan-archiveArchiveBlockEncryptedblock-encryptedForceToDiskforce-to-diskmax-scansize100Mmax-recursion16max-files10000MaxEmbeddedPEmax-embeddedpe10MMaxHTMLNormalizemax-htmlnormalizeMaxHTMLNoTagsmax-htmlnotags2MMaxScriptNormalizemax-scriptnormalizeMaxZipTypeRcgmax-ziptypercg1MMaxPartitionsmax-partitions128MaxIconsPEmax-iconspe100MaxRecHWP3max-rechwp3TimeLimittimelimitPCREMatchLimitpcre-match-limit100000PCRERecMatchLimitpcre-recmatch-limitPCREMaxFileSizepcre-max-filesizeOnAccessMountPath/ /home/userOnAccessIncludePathon-access-include/home /studentsOnAccessExcludePath/home/bofh /rootOnAccessExcludeRootUIDOnAccessExcludeUIDOnAccessMaxFileSizeOnAccessDisableDDDdisable-dddOnAccessPreventionOnAccessExtraScanningDevACOnlydev-ac-onlyDevACDepthdev-ac-depthDevPerformancedev-performanceDevLiblogdev-liblogUpdateLogFile/var/log/freshclam.logDatabaseOwnerCheckschecksDNSDatabaseInfocurrent.cvd.clamav.netDatabaseMirrorPrivateMirrorMaxAttemptsScriptedUpdatesTestDatabasesCompressLocalDatabaseExtraDatabasedbname1 dbname2DatabaseCustomURLHTTPProxyServeryour-proxyHTTPProxyPortHTTP proxy's port8080HTTPProxyUsernameusernameHTTPProxyPasswordHTTPUserAgentNotifyClamddaemon-notifyOnUpdateExecuteon-update-executecommandOnErrorExecuteon-error-executeOnOutdatedExecuteon-outdated-executeLocalIPAddresslocal-addressaaa.bbb.ccc.dddConnectTimeoutReceiveTimeoutSafeBrowsingDisableCertChecknocertsMailMaxRecursionArchiveMaxScanSizeArchiveMaxRecursionArchiveMaxFilesArchiveMaxCompressionRatioArchiveBlockMaxArchiveLimitMemoryUsageMailFollowURLsmail-follow-urlsClamukoScanOnAccessClamukoScannerCountClamukoScanOnOpenClamukoScanOnCloseClamukoScanOnExecClamukoIncludePathClamukoExcludePathClamukoExcludeUIDClamukoMaxFileSizeAllowSupplementaryGroupsClamdSockettcp:scanner.mydomain:7357MilterSocketMilterSocketGroupMilterSocketModeLocalNetOnCleanAcceptOnInfectedQuarantineOnFail^(Accept|Reject|Defer)$DeferRejectMsgMTA specificAddHeader^(No|Replace|Yes|Add)$ReplaceReportHostnamemy.mail.server.nameVirusActionChroot/newrootWhitelist/etc/whitelisted_addressesSkipAuthenticatedLogInfectedBasicSupportMultipleRecipientsERROR: %sWARNING: %sLog size = %lld, max = %lld -%Y%m%d_%H%M%S%s -> %s -> %sLOG_AUTHLOG_AUTHPRIVLOG_CRONLOG_DAEMONLOG_FTPLOG_KERNLOG_LPRLOG_NEWSLOG_SYSLOGLOG_USERLOG_UUCPLOG_LOCAL0LOG_LOCAL1LOG_LOCAL2LOG_LOCAL3LOG_LOCAL4LOG_LOCAL5LOG_LOCAL7WARNING: Log size limit met but log file rotation turned off. Forcing log file rotation anyways. Need to rotate log file due to size but ran out of memory. Need to rotate log file due to size but could not get local time. ERROR: Can't open %s in append mode (check permissions!). WARNING: File locking not supported (NFS?)ERROR: %s is locked by another process POSIXLY_CORRECT%s: illegal option -- %c %s: unrecognized option `%s' %s: option `%s' is ambiguous %s: option requires an argument -- %c %s: option `--%s' doesn't allow an argument %s: option `--%s' requires an argument 0.100.2/dev/nullCan't open /dev/null dup2(%d, %d) failed %s/ERROR: --file-list: Can't open file %s From:To:file:!Cannot open whitelist file '%s' !Out of memory loading whitelist file !Failed to compile regex '%s' in whitelist file !Cannot allocate memory for SkipAuthenticated file !Failed to compile regex '%s' for SkipAuthenticated successLocalRemoteunix:tcp:^Can't resolve hostname %s !No ClamdSocket specified *Probe for slot %u returned: %s ^No clamd server appears to be available *Killing the monitor and stopping !Out of memory while initializing the connection pool!Out of memory while initializing the connection pool !Unix clamd socket must be an absolute path !Out of memory allocating unix socket space *Local socket unix:%s added to the pool (slot %d) *%s socket tcp:%s:%s added to the pool (slot %d) !Failed to parse ClamdSocket directive '%s' !Can't resolve LocalNet hostname %s !Unsupported address type for LocalNet %s *Failed to establish a connection to clamd !Connection closed while sending data !clamfi_eom: FD send failed: %s !Timed out while reading clamd reply !Connection closed while reading from socket !recv failed after successful select: %s !Failed to create temporary file !Failed to communicate with clamd !Out of memory while resolving LocalNet !Bad netmask '/%s' for LocalNet %s *connect failed: %s !send failed: %s !Failed to stream to clamd !Overlong reply from clamd !malloc(%d) failed !Failed to create socket: %s !fcntl_get failed: %s !fcntl_set failed: %s nPING PONG nFILDES !FD scan request failed nINSTREAM *Cannot resolv %s local!Failed to initiate streaming/fdpassing !Failed to write temporary file ^Failed to quarantine message ^Failed to remove existing X-Virus-Scanned header ^Failed to remove existing X-Virus-Status header ^Failed to add X-Virus-Scanned header ^Failed to add X-Virus-Status header ^Failed to insert X-Virus-Scanned header ^Failed to insert X-Virus-Status header *Skipping scan (all destinations whitelisted) *Not scanning an empty message ~Clean message %s from <%s> to <%s> with subject '%s' message-id '%s' date '%s' ~Clean message from <%s> to <%s> ~Message %s from <%s> to <%s> with subject '%s' message-id '%s' date '%s' infected by %s *VirusEvent: about to execute '%s' '%s' '%s' '%s' '%s' '%s' '%s' '%s' !VirusEvent: waitpid() failed: %s *VirusEvent: child exited with code %d *VirusEvent: child killed by signal %d ~Message from <%s> to <%s> infected by %s *Skipping scan for %s (in LocalNet) !Invalid setting %s for option LogInfected !Invalid setting %s for option LogClean !Invalid action %s for option OnFail !Invalid action %s for option OnClean !Failed to allocate memory for RejectMsg !RejectMsg contains non printable characters !%%v may appear at most once in RejectMsg !Invalid action %s for option OnInfected *Skipping scan for authenticated user %s *Skipping scan for %s (whitelisted from) !Failed to allocate CLAMFI struct !Failed to allocate array for new recipient !Failed to allocate space for new recipient From clamav-milter !Streaming failed UNKNOWN5.7.1550quarantined by clamav-milterRejectBlackhole!Unknown action %s X-Virus-ScannedX-Virus-StatusSubjectDateMessage-ID: !FD send failed !Failed to flush STREAM !No reply from clamd : OK {i}{mail_addr}{rcpt_addr} FOUND Infected (%s)*VirusEvent: child lost !VirusEvent: fork failed: %s !Unknown reply from clamd localhostOffFull{auth_authen}CEFEEF,FDFF G*clamav-milter: milter_exit, signal %d !Can't unlink the socket file %s !Can't parse command line options Clam AntiVirus: Milter Mail Scanner %s By The ClamAV Team: https://www.clamav.net/about.html#credits (C) 2009-2018 Cisco Systems, Inc. --help -h Show this help --version -V Show version --config-file -c Read configuration from fileUnable to allocate memory for config file%s: cannot parse config file %s !Cannot change directory to %s !chroot to %s failed. Are you root? !Please configure the MilterSocket directive !Failed to change socket ownership to group %s ERROR: Can't get information about user %s. !Failed to change socket ownership to user %s !Cannot set milter socket permission to %s ERROR: LogFile requires full path. !LogFacility: %s: No such facility. ERROR: Can't initialize the internal logger ^Can't change current working directory to root ^Invalid MaxFileSize, using default (%d) !Failed to init the socket pool Socket file removed. clamav-milter: stopped ClamAV %s [-c ] ^Ignoring option %s clamav-milter %s Noclamav-milter %s at %sclamav-milter %sAdd!smfi_setconn failed !smfi_register failed !Failed to create socket %s inet:inet6:local:!Unknown group %s !Invalid MilterSocketMode %s ERROR: initgroups() failed. ERROR: setgid(%d) failed. ERROR: setuid(%d) failed. #+++ Started at %s!daemonize() failed w!Can't save PID in file %s %u cli_hex2ui(): Malformed hexstring: %s (length: %u) cli_hex2str(): Malformed hexstring: %s (length: %u) cli_hex2num(): Malformed hexstring: %s (length: %d) cli_xtoi(): cli_malloc fails. cli_strtok: Unable to allocate memory for buffer cli_unescape: Unable to allocate memory for string utf16 length is not multiple of two: %lu UTF16 surrogate encountered at wrong pos cli_utf16toascii: length < 2 cli_strrcpy: NULL argument 0123456789U`V`V`V`V`V`V`V`V`V`V`V`V`V`V`V`V`V`V`V`V`V`V`V`V`V`V`V`V`V`V`V`V`V`V`V`V`V`V`V`V`V`V`V`V`V`V`V`V`VU`V`V`VU`V`V`V`V`V`V`VU`V`V`VU`VU0V V`VU  %y%m%d%H%M%S%Y%m%d%H%M%S.crt%s/%scli_malloc(): Attempt to allocate %lu bytes. Please report to https://bugzilla.clamav.net cli_malloc(): Can't allocate memory (%lu bytes). cli_calloc(): Attempt to allocate %lu bytes. Please report to https://bugzilla.clamav.net cli_calloc(): Can't allocate memory (%lu bytes). cli_realloc(): Attempt to allocate %lu bytes. Please report to https://bugzilla.clamav.net cli_realloc(): Can't re-allocate memory to %lu bytes. cli_realloc2(): Attempt to allocate %lu bytes. Please report to https://bugzilla.clamav.net cli_realloc2(): Can't re-allocate memory to %lu bytes. cli_strdup(): s == NULL. Please report to https://bugzilla.clamav.net cli_strdup(): Can't allocate memory (%u bytes). Unable to readdir() directory %s: %s cli_gentemp('%s'): out of memory cli_gentempfd: Can't create temporary file %s: %s malloc_problemcalloc_problemrealloc_problemstrdup_problembuffer too small for ctime invalid timestampTMPDIRcli_readn: read error: %s cli_writen: write error: %s %02x%s/clamav-%s.tmp(?i)>(((ȜȜȜȜȜݜXȜȜȜȜȜȜp@@@PP@@@@@@@@@@@@@@@@@@P@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@x[:<:]][:>:]]NULSOHSTXETXEOTENQACKBELalertBSbackspaceHTnewlineVTvertical-tabFFform-feedCRcarriage-returnSOSIDLEDC1DC2DC3DC4NAKSYNETBCANEMSUBESCIS4FSIS3GSIS2RSIS1USexclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stopzerotwothreefourfivesixseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketbackslashreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-brackettildeDELalnumalphablank cntrlgraphlowerabcdefghijklmnopqrstuvwxyzprintpunct upperABCDEFGHIJKLMNOPQRSTUVWXYZxdigit0123456789ABCDEFabcdefABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ !"#$%&'()*+,-./:;<=>?@[\]^_`{|}~Unknown%s: smfi_register: version mismatch application: %d != milter: %d%s: missing connection information%s: Couldn't start signal thread%s: empty or missing socket information%s: UNIX socket name %s too long%s: Invalid numeric domain spec "%s"%s: Unknown protocol for %s (%d)%s: Unable to create new socket: %s%s: Unable to set close-on-exec: %s%s: %s is not a UNIX domain socket%s: Unable to bind to port %s: %s%s: can't malloc(%d) for sockpath: %s%s: Opening listen socket on conn %s%s: Unable to create listening socket on conn %s%s: fd %d is larger than FD_SETSIZE %d%s: listenfd=%d corrupted, terminating, errno=%dMI_SLEEP(): select() returned non-zero result %d, errno = %d%s: %s() returned exception for socket, abort%s: accept() returned invalid socket (%s), %s%s: malloc(ctx) failed (%s), %s%s: thread_create() failed: %d, %sunixinetinet6%s: unknown socket type %stcp%s: unknown port name %s%s: Unknown host name %s%s: set reuseaddr failed (%s)%s: Unable to stat() %s: %s%s: Unable to remove %s: %s%s: listen call failed: %saborttry againselect%s: %s() failed (%s), %s%s: set keepalive failed (%s)%s: mi_stop=%dsmfi.clen > l1offset < lenctx != ((void *)0)4.0.05.0.0-smfi_setsymlistsend2%s: sigwait returned error: %d%s: sigwait returned unmasked signal: %d%s: Couldn't initialize control pipe mutex%s: Couldn't mask HUP and KILL signals%s: Couldn't start signal thread: %d%s: Couldn't spawn signal threadIPv6:Operation not permittedTimeout on file openSymbolic links not allowedHard links not allowedRegular files onlyExecutable files not allowedWorld writable directoryGroup writable directoryFile changed after openWorld writable fileGroup writable fileGroup readable fileWorld readable fileMemory allocation failedGDBM is not supportedUnsupported actionKey already existsDatabase open failedKey not foundUnknown database typeDB sync did not finishKey is emptyLock unavailableLock not held by lockerDatabase panic, run recoveryI/O errorDatabase opened read-onlyName too longInvalid parameterOnly one cursor allowedInvalid cursorError %dSupport for database type not compiled into this programLocker killed to resolve deadlockBerkeley DB file is an old version, recreate itBerkeley DB version mismatch between include file and libraryAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA`AApAAAAAAAAApAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA`APA@AA AAAAAAAAAPA@A0A AAAAAAA0ApAAxAAAAAAAAAHAAAAPAA`AhAAA0AAAALAAAAAAAAAAAAAAAXAhAAA0AAAAAAAAAAAAAAAAAAAXA @mi_clr_ctxmilter_addsymlistA PADAB AC0AE AHAL@AM@AOPAN@AQ ATARAU AKA%s: milter claimed not to reply in state %d but did anyway %d [%lu] mi_engine: mi_rd_cmd error (%x) [%lu] cur %x new %x nextmask %x [%lu] abort: cur %d (%x) new %d (%x) next %x [%lu] function returned abort %s: st_optionneg[%ld]: len too short %d < %d%s: st_optionneg[%ld]: protocol version too old %d < %d%s: st_optionneg[%ld]: xxfi_negotiate returned %d (protocol options=0x%lx, actions=0x%lx)%s: st_optionneg[%ld]: 0x%lx does not fulfill action requirements 0x%x%s: st_optionneg[%ld]: 0x%lx does not fulfill protocol requirements 0x%x[%lu] milter_negotiate: mta_actions=0x%lx, mta_flags=0x%lx actions=0x%lx, flags=0x%lx %s: connect[%ld]: wrong len %d >= %d%s: connect[%ld]: inet_aton failed%s: connect[%ld]: mi_inet_pton failed%s: connect[%ld]: path too long%s: connect[%ld]: unknown family %dengine.clen + (4 * 3) > lenoffset + 4 < lenoffset + l <= len[%lu] milter_abort [%lu] got cmd '%c' len %d [%lu] cmd '%c' unknown [%lu] cmd '%c' not impl [%lu] cmd='%c', buf=NULL %s: private data not NULL%s, mi_rd_cmd: read returned %d: %s%s: mi_rd_cmd: read returned %d: %s%s: mi_rd_cmd: %s() returned %d: %s;D0x``00 0  ` 0 `@ p  PH 0 0H @` Px hp(`` H`@`x(` P@@`8` 0H@@ 8 `@80 X@ PpH@X`8p0H (`Hp!@$($@%``'0*8*P@--. . 0h 1 1!10!1H!2`!2!3"5P"P6"6"P7 #7p#p8# 9 $`:$;$p; %;P%<%`<%<%>8&>p&@&C@'pCx'C'C'D' D'0D(PD (@F(pF(F(F(G) I8)0Jh)@K)K)L)pL*L@*PMh*M*N*`N+O`+O+`P+pVP,Vh, X,X-PZh-Z-[-`[-gH.Ps.pt/tP/ uh/@u/u/v/w0pwH0wx0x0{(11P1`22033H445h55H6`6777P`8088@8`9(9@9X909P99:(:p:P::P ;p;<`< <<8=P== = > P>>>x??@ @ @`@@@A@AXAAAA B` C 8C C C8DPDhD@DDDDD(EhEHFFF`F0GPhGG#G$(Hp$XH&H'H'H'I+XI-I.I .JP. J`.8JzRx (*zRx $x@ FJ w?;*3$"4D0eFAJ } CAF DDA<|hBBD A(J0h (A ABBG dBBE B(D0A8RP 8A0A(B BBBH L 8C0A(B BBBA 4$ eFAJ } CAF DDA,\XKAD AB\BBE B(D0A8J,,D,X,C, 8D0A(B BBBA 8BBE B(D0A8IGUBW 8C0A(B BBBA n 8C0A(B BBBA U 8A0A(B BBBA L|8*BBB B(A0A8J 8A0A(B BBBF ,WAAD } DAH LHBBB B(A0A8G 8A0A(B BBBE LLȴK BBB B(A0A8G  8D0A(B BBBK 4ȽbBDH A ABF AFBd4BBE B(D0A8N@ 8A0A(B BBBI D 8F0A(B BBBE |<BBE B(H0A8J^ 8A0A(B BBBJ J 8D0A(B BBBI v 8G0D(B BBBE  <HAA h ABK  HBK D0L\(BBH A(H@/ (F ABBA B (C ABBA DBAF MX  CABD X  EABH  < ~BAH GM  CABK G CAB$LHuAAD lAA<tBBH A(Jy (A ABBA 4@lAAG z CAI TFALx|BBG B(A0A8T 8A0A(B BBBD <7T_LT~BBD B(A0A8Da8C0A(B BBB,AAD  AAI CBBG B(A0A8L 8A0A(B BBBG  8A0A(B BBBD W 8A0A(B BBBG  8A0A(B BBBI ` 8A0A(B BBBF \XBBB B(A0A8D@} 8D0A(B BBBH g8C0A(B BBBe\ 0VKAC Tph FABTpi  AABK U  FABB Ld 0BBB B(D0A8N( 8C0A(B BBBA l KBE B(D0A8Q7 8A0A(B BBBE jC4$ AAP CAI xCAL\ JBBE B(C0A8K 8A0A(B BBBJ , AAQb AAI 4 hzAAG O CAL OAAD BAD J0W  AABD p  FABG <\ hlBAC D@x  CABH U CAB$ D b J i G $ ;AAD rAAT 89BIB A(A0/ (C BBBI e (F BBBA D \ t  , BGD  FBL d BBB B(D0A8GP 8A0A(B BBBF ^ 8A0A(B BBBH << xGBD A(Q0E(D ABB,| vKAJKFA 3Kg$ @AH G s A U\ pBBD A(G0K (A ABBG K (C ABBE  (A ABBD tLBBD A(J@K (A ABBD  (D ABBC  (C ABBD T(A ABB\BBD A(J@S (A ABBD L (C ABBD D (C ABBD $$P7AAG iCALhi BBB B(A0A8GX 8A0A(B BBBE NADn3DbAXSADLA$@DT H W I v J < BIB A(A0 (A BBBE DL7BDH J ABE Y ABD  ABB <BBD A(G0k (A ABBG , AAO h AAE ttBBE A(D0JTBDeAV 0D(A BBBA |4BAD x DBK V DBD 8v4BAD  ABG T CBG $jAJ A C A YLD@BBA A(G0] (A ABBH D (D ABBE ,AAR0 AAA 4 AAD Z AAF ^CA,x>BAD qCB,iFZL=MBE B(D0A8G@ 8D0A(B BBBA F 8A0A(B BBBA LC@t)OBE B(D0A8GP 8D0A(B BBBA D 8C0A(B BBBA IdLHBBB B(A0A8D` 8D0A(B BBBE y 8A0A(B BBBH @Di A <tBBA A(D0\ (D ABBA LPBBB B(D0A8D`x 8A0A(B BBBE LdBBB B(D0A8D` 8A0A(B BBBA <Ar E CdJBBE B(A0A8DPe 8A0A(B BBBH z 8C0A(B BBBA lTKBE B(D0A8JPk 8A0A(B BBBH CP Fd( BBB B(A0E8GP 8A0A(B BBBG ` 8H0A(B BBBE D \)Ddt dBBE B(A0A8Gp  8A0A(B BBBH O 8A0A(B BBBG LBBE B(D0A8J 8A0A(B BBBA LD@BBD A(J0U (D ABBG L(C ABB$$AAJ IGALBBE B(D0A8MP 8C0A(B BBBE L< BBE B(D0A8JP 8D0A(B BBBC L BBE B(D0A8L`- 8C0A(B BBBK <WBBE A(D0t (A BBBG LBBE B(D0A8Q@O 8A0A(B BBBF <lWBBE A(D0t (A BBBG L(BBE B(D0A8Q@O 8A0A(B BBBF TxwBBE B(D0A8M@NHZPPHA@F 8A0A(B BBBJ TTBBE B(D0A8JP{XT`UXAPF 8A0A(B BBBA d1BBE B(D0A8J` 8D0A(B BBBD D8C0A(B BBBLBBE B(D0A8Q@Q 8A0A(B BBBD Dd dBBE A(D0M@x 0A(A BBBE ,H8BAD J0S LAB,XYAAK r AAG , DAAD m AAK 4<|AAG P AAE L CAH LtKAA DpJ  CABG O  DABB P4{FAK D DAE LCA|SBBE B(D0A8G@ 8A0A(B BBBA L 8F0A(B BBBI  8A0A(B BBBD L|BBB B(A0A8D`[ 8A0A(B BBBA 4aAAD  DAF IFA.NN,?AAD j CAD Ld |( d(BBE B(D0A8MPh 8A0A(B BBBA O 8D0I(B BBBL  &A`4  L ,d DAAJA) AAI , 4AAJA AAC ,  AAJA AAF $ AJAA$!!VEV E T A `$D!!oEo D U A `$l!("SEV E Q A `4!`"|FAA _ ABF T ABI $!"RDP A g D QL!"AAD ] AAK R HAE _ DAD KDAD" ##KW,\"8#HBDH vAB\"X#BBD A(OW (F ABBF G (F ABBF G(D ABBL"#BBD A(OU (F ABBH G(D ABB<<##BAC z DBE H FBA \|#h$ BBE B(A0A8GVGaBP 8A0A(B BBBB #*.\#0*vBBE B(D0A8OBXAW 8A0A(B BBBB 4T$P+yBAA F0k  AABW d$+BBB B(D0A8D4 8D0A(B BBBA f 8A0A(B BBBA 4$,AAJ v AAD sFA,%8-($D%P-IAAL@vCAdl%x- BBE B(E0A8J 8A0A(B BBBK  8A0A(B BBBH d%81 BBE B(E0A8J 8A0A(B BBBE U 8A0A(B BBBA d<&DBBB B(D0A8D@] 8A0A(B BBBH  8A0A(B BBBA 4&PEJAAI a AAB WAA&hEX&E4 'EBEA W CBA kAB$D' FIL[N,l'FfQAR Z AAH 4'FWBBA A(D0C(D ABB,' GbAAJ0d AAF ,(`GMAD |AB|4(GBBI B(D0A8QPt 8A0A(B BBBE h 8A0A(B BBBF b 8D0A(B BBBI |(pJ BBB B(D0A8DPy 8A0A(B BBBD  8I0A(B BBBM  8O0A(B BBBL L4)TBBA A(I@I (A ABBB J (A ABBH d)PU" BBF B(D0A8I 8A0A(B BBBF  8A0A(B BBBA d)_BBE B(A0A8D 8A0A(B BBBE  8A0A(B BBBG LT*fBDB B(D0A8S[ 8C0A(B BBBA *mQBBE B(D0A8Op7 8A0A(B BBBH xbSxApxQOxBpMx^WxBpUxdSxApjxQTxAp<+sQBBE B(D0A8Op7 8A0A(B BBBH xbSxApxQOxBpMx^WxBpUxdSxApjxQTxApD+zBHB B(A0A8 0A(B BBBJ ,H~BBE B(D0A8D\JYGQAHQD 8A0A(B BBBA L,BBE B(A0A8D`' 8D0A(B BBBK D,PBBE B(A0A8 0A(B BBBE <-؈BBE B(D0A8GMXKF{IRBFD^AQTA 8A0A(B BBBA L-0BBB B(D0A8Dp0 8D0A(B BBBB $.BBH B(A0A8GO 8D0A(B BBBE fdFAHSEJQASHNDHZBEHUBAzAIRADYAVQKA HYADHZA$D/PuQS D Hl/:d/ТtBBE B(D0A8JPr 8D0A(B BBBG  8A0A(B BBBH </BBD A(G@ (A ABBG ,0Z<D0ФBAA  ABD O ABF 0@DP0H60p 0h ,0`gKAG zAAQ 1,1Dk A LL1HBBB B(A0A8J 8D0A(B BBBD 1ȯDID1jBD A(M0b(A ABBZ0$17ALc AG L$2BBD B(A0A8J) 8A0A(B BBBG 4t2VFAL ` CAI Pl2(^BB B(D0A8Gp 8A0A(B BBBF XFpl3غITBE B(D0A8G` 8A0A(B BBBD hH`\3jBB B(A0A8I@J8A0A(B BBBQ@43hJBAD ` NBI AFBL$4`BBD A(Q0V (Q ABBJ D(F ABBLt4pBBD A(R0g (N ABBK D(F ABBD4ZLAD `IBT AFB$ 5ȼhD} G F A D45ZLAD `IBT AFB,|5(wKAO0}AAV0,5xwKAO0}AAV0\5ȽBBB B(A0A8FP 8A0A(B BBBG D8F0A(B BBBD<6(TBD A(L@n(A ABBU@|6TBE B(D0A8M@o 8C0A(B BBBF D 8F0A(B BBBE St7BBB B(D0A8D1 8F0A(B BBBG \LmA 8C0A(B BBBD |77t7OTBB B(A0A8Dp 8C0A(B BBBF H 8A0A(B BBBF |$8>I j<8$T8l8+A`<8AAL CAA A CAK 8 ,8AAQs CAF 9`L,9XEBB D(A0e (A BBBF J(A BBB,|9>EDC jAB9}G_ J F J F J F J F J F J F J F J F J F J F J F J F J F J F J F J F J F J F J F J F J F J F J F J F J F J F J F J F J F J F J F J F J F J F J l$:HJl J @PL:BBD A(J0M (D ABBG D (G ABBH L;PBBE B(D0A8J@ 8D0A(B BBBF \d;BBB A(A0D 0A(A BBBH t 0D(A BBBA ;@3;h6;> <C$$<GDb J H H L<d<s4|<BAD } ABI qCB<<&WAE  ABG YFB<BBB B(D0A8L` 8A0A(B BBBE { 8A0A(B BBBK Y 8A0A(B BBBE Y 8A0A(B BBBE Y 8A0A(B BBBE  8A0A(B BBBJ D 8C0A(B BBBH <=BBA A(I@y (C ABBH >R,,>XVEDC FAB\\>XBBD B(G0A8M8 8C0A(B BBBE s_PA4>GAA YAB[ >>Fld?JAF@HTPFXF`L@ AAE e FAD XH@HFPbHF@4|?GAA YAB[ ,?_F|NC E FL?CLBA A(Gc(A ABBH,4@EAD  DBE d@,|@L@BBE B(D0A8QZ 8A0A(B BBBK L@pBBB B(A0A8G 8A0A(B BBBE D4AeBBE B(H0H8M@r8A0A(B BBB|AA)A(A ]Bh ]BBB:]BcF]BBB:]BV]BBB:]Bcj]BBBk_BV ]BBB]B ]B+BB]B ]B)BB`Bv ]B:BB]B ]BAB]B ]B:BB]B ]BBB]B ]BBB]B ]BBB]B ]B:BB]Bd ]BBB]B ]BBB]B ]BBB]BBB]B ]BBB]Bm ]BBB^B ]BBB ^B ]BBB^Bz ]BBBjB ]B@AB^Bd$^BBB6^Br ]BBB@^B ]BpABH^B\^BBBe^B\^BBBz^B ]BBB^B ]BBB^BfBB^Bi ]BBB^Bo ]BBB^BBB^BBB^B ]BBB^BBB^BBB7lBBB^BBB^B\^BBB^B ]B BB^B ]B BB_B ]B BB_B ]B BBD^B ]B BB _B ]B BB_B BB_B BB+_B BB;_B BBH_Bb BBN_B\^B A[_B`_B\^B] ABg_B\^B ABfB ]B BBs_B ]B BB|_B BB_Bu BB_B BB_Bi BB_Bl$^B BB_Bf$^B BB_B ]B BB_B BB_B BB_B BB_Bd BB_Bc BB_Br BB_B BB_B ]B @AB_Bd ]BBB`Bc`B@BB`Bn ]B@BB$`Bg@BB4`Bf ]BxABF`Bt ]BAB_Bi ]BABU`Bp ]B^`BB|`Bc ]BAB`Br(AB`BT\^B`BB`Bs ]BPAB`Ba ]BBB`Bt ]BBB`BBB`BBB`BBBaB ]BBBaB ]BBBaB ]BBB&aB ]BBB1aB ]BBB7aB ]BBB>aB ]BBBFaB ]BBBMaB ]BBBUaB ]BBB]aB ]BBBnaB ]BBBaB ]BBBaB ]BBBaB\^BBBaBaBBBaB]BBBaB]BBBaB]BBBaB]BBBaB]BBBaB]BBBaB]BBBaB]BBBaB]BBB1pBaB ]B BBbBbB ]B!bB0bBDbBxAbmB}mBlAZbBjbB ]BA\BxbBaBHAydBbB ]BbB\BbB ]BA\BbB ]BA\BbBbBAbBbB ]BbB\BcB cB ]BhA\BcB ]BA\B,cBBcBp(A4cBFcBYcB-HAacBfcBxcB$^B#AcBcBcB ]B 8AcBcBcBA\BcB(AcBcB`AcBdBAdBdB ]BA\B+dB\^BA5dB:dB0ABdBLdB\^BAedBhdBaBAxdB|dB\^BAdBdB\^BAdBdB\^B 0AdBdB\^BxhAdBdB\^BA(eBdB\^BpAdBdB\^BxAdBdB\^Bd@AdBdB\^BAdBpB(AdBdBeB\^B A'eB*eB ]BBeBcB]eB ]BAcBpeBeB ]B B\BeB\^BX8BeBeBeB ]B BcBeBBBeB ]BB\BeB ]BHB\BeBeBF ]BeBcB fB ]BpBcBfB ]BBcB&fBBcB+fBs`B ]B B\B4fBEfB^fBB^fBjfBzfB\^B BfBfBfB ]B HBcBfBfBBfB BfBfBfBBBfBfBfB ]B B\BgBgB BgB)gB4gB B@gBPgBegB ]B  B\B{gBgB ]B B\BgBgB ]B ` B\BgBgB ]B P B\BgBgB ]B B\BgB ]Bp BcBgB`aB ]B hB\BgBqaB ]B B\B hB%hB ]B BcBB4hB ]B BBAhBWhB ]B B\BnhBhB ]B `B\BhBhB ]B BcBhBhB\^B B(eBhBiB\^B B(eB&iB ]BB\B@iB ]BHBcB\iBeiB ]B B\BoiBxiB ]B XB\BiBiB ]B (BcBiBiB ]B B\BiBiB ]B `B\BiBiB ]B B\BiBiB ]B B\BiBiB ]B XB\BjBjB ]B BcB,jB8jB ]B HBcBoBFjBaB@ (BSjBkBkBaB HBxdBoBXjB\^B BfjBpBijB\^B' BsjByjBjBaB BjBjBjBaB BjBjBjBaB !BjBjBjBaBP "BydBkBkBaB #B!kB$kB2kB\^B2 %BAkBEkBPkB\^Bd 8&B\kB`kBkkB\^B X'BfjBwkBkB\^B(BBkBkB\^B H)BkBkBkB\^B *BfBkBkBaB x,BxdBypB ]B-BcBkB.B lBlB-lB`/B?lBOlB0BclBtlB ]B0BcBlB\^B1BBlBaBPH2BydBlBlB ]B2BcBlB ]B2B\BlB ]B3B\BlBmB ]B BBmBmB\^B BB(mB7mB ]B BBGmBQmB ]BBB\mB}mBlAjmBmB`BucB3BcBmBmBc\^B `4BdBmBmB4BmBmB5B7BmB7B:BmB\^B0:B(eBmB ]B:B\BmB ]B:B\B nB ]B;BB!nBhB^BnBX>B`BnBnBF]B>B\BnBnB8?BoBoBoBp?BoB0oBBoB?BoBVoBeoBa0@BsoBoB\^B@BedBoB\^B@BedBoB ]BAB\B+fB ]B DB\BoBoB ]B DBcBoBBBoBBBoBBBoBBBpBBB*pB ]BBB:pB ]BBBRpBapB ]B BBrpB ]BBBpB\^BBBpB ]BBBpB ]BBBpB ]BBBpBBBpBBBpB\^BBB qBaBPBBqB ]BDBcB5qB@EBAqB[qBGBHBhqBIBcBzqBXIBdBqBIBJBqBJBqBKBqBqBJBqBKBqBqBqBqBLBqBqBPNBqBqBqBcB(OBrBrBPB-rBArB`QB8SBMrBhSBTrB]rBSBgrBrBUBVBrB WBrBbBhYBrBrB ]B8ZB\BjB ]BBBfcBBB fB ]BBBgB ]BBBfB ]BBBcBBBRpB ]BBBoBaBBBpB\^BBBoB\^BBBgB ]BBBiB ]BBB\iB ]BBBgB ]BBBoiB ]BBB{gB ]BBBhdBaBBB:dBBB+dB\^BBBFcBBBsB sBP(sBH1sB@>@&>@6>@F>@V>@f>@v>@>@>@>@>@>@>@>@>@?@?@&?@6?@F?@V?@f?@v?@?@?@?@?@?@?@?@?@@@@@&@@6@@F@@V@@f@@v@@@@@@@@@@@@@@@@@@A@A@&A@6A@FA@VA@fA@vA@A@A@A@A@A@A@A@A@B@B@&B@6B@FB@VB@fB@vB@B@B@B@B@B@B@B@B@C@C@&C@6C@FC@VC@fC@vC@C@C@C@C@C@C@C@C@D@D@&D@6D@FD@VD@fD@vD@D@D@D@D@D@D@D@D@E@E@&E@6E@FE@VE@fE@vE@E@E@E@E@E@E@E@E@F@F@&F@6F@FF@VF@fF@vF@F@F@F@F@F@F@F@F@G@G@&G@6G@FG@VG@fG@vG@G@G@G@G@G@G@G@G@H@H@&H@ cd&a Hِ!| @BB˜BƘBʘBΘBҘB֘BژBBBB B gB B B B B B B B (B+B.B2B6B:B>BBBFBJBNBRBUBYB]BaBdBhBkBoBrBvBaB yB!B"B#B$B%B&șB'әB(B)B*B+ B,B-B-#B.*B.͚B/ۚB/4B0fB19B2=B3CB4HB5MB6QB7WB8]B9fB:bB;lB<{B=B>B?B@B[ɚB\ӚB\B]B^B^B_ B_)B`6B{AB{TB|bB}nB}B~BB BBB`BBBBBBBBB1;讟\X|\.^u|@i0Ĥ(T߲LH)'6گ_ X&kRZXK'?`SB;W*-+PIYB[&H O*]`x ڥ^sJmܻ~67+JI'[F𦷵e28btN]/'?["Nf0\"YK+8L; O%t xjj\loqq, LVVϳ9 M t~|O>ץW+X>~|<1~^ģq$T*NȷR\yzFd N0^>"Us/`D?ˢ:!s'SGjŲu @f,o3Tڳx`͊ `@v)D"|+R2'8H+( "nCͭ9A:hN\܈ ](# O8[+G4=#"jFCq#%C/u| Ds2GѱlDoE/*,:Y .,*#KD<΅ҥ,8w~}:8o8%z&7ມb^QkB؋qKA[YmX^@֋,NNώ^H0' tHjM +(O*pe[^񾇔_2Kkxcfo^B~$ G#T#mʚ88 , ŌX1y11ղ>Hq[z웝ihg(j (q*z^5mJx57SkԚ H=1j{<[VWk<:ۚ&Q$8}/依7O$2xK!txmQ-Cx,؆6uD-E~$Geҙoީ< 8!CR{\]"倳0Em1ϗwRHŧ.sOp8]`UGÅg`Mu=+t *ARb'O0vAthkM?^4!^oN\;*U"ah(n#EyZޛkzPM/)t[Nv ?izi@KMfÃ5 FΡQtb {ST$Rfp^۠Jjb^tl6N^'<ŘAT,@J4ugoex6 qdjF1аmғZ^H#Pkպ\>tǀ3x}O~geHH&<(Syʅz6_—ݝ5۹O)]ug:<&!E]Ի4cd3D~{P,046%PSXfn!jxC?uC"lH8qR5਌ ,YU9(vGd栍P|;_T0nr^Ґܣ޴O-jb{{sI2w(}Ԓ%D$=k Z/BoqdW|hLt6D(L+ldy.1EBT=A@MvOޜ&c`񌹯QK[mlhaj0DUOIǻ,,zHEfY*>6YM5:eV wy9'm2,_乡+\(&R&I \X] ƑuS EJvrwT04hw r#! 7᭰B&E$mQSúOfc ]ïݼ^vзyiFcbT[8:X-7|UUE -{ 6shSWmјpW4ѫ2 At0iRw$w6' uL?&:!3x/GX D`@F0QQk,iIG;C(3J:e@/6a!䩍Z:y=.EH+2ᨩkZB̉ƭ]ТSOLcBгsP-y9umQ#mY\umo44Z7J|5yq %pQU0H4KyE(Fm o5U(5I@6GTzBC_϶Z|)QuE Fp+BQ]{L'>ޭ*WNҎ1WcHd58o?"b+Ƿ? T}? zGCgqIaS!"}cq9"Gn0hA8uLNusr/man/man5/clamav-milter.conf.5.gz0100644000000000000000000000774513365330317016210 0ustar rootrootϰ[clamav-milter.conf.5Zms6_sciFt/SٱO(gmN $Xk߳ d;݇,v>`VtDrsT 2٢#:ߕٟF߉KeN n4Ǜ~qXVܟ |˪6XD)z'z},TR̊rKK׽;R\MnǣYh XmK+ OSZ.WBˊ ĥV"љ+E+хO> zҹIB/3SXw}. ğB'ևV ]7ʩ཰18# ٵ/ޔ$AgKQreG[΍IF&ݝpgYTt!o/Nȡ~tv{ m '7Dfkd!#܂mm%oVBgpH &g1c:8=BCl׳;upg_iw2uV%@tc".LNAL/m,U2T85(¤\Z~kC?U ˳@| `Uk&[S1ڭ9ZŊx(b]` 2:#rK ԕDֹziMD]n\*慉B(UF[@G#{eZk!kf* W_ߴq%T&0s:ʰՃbU(BJ&NiNt# 8hq!TlוA%HkQ9 t>Rtu}̐!45?u@YV\peq+͔)[Tb?,hA .*{= wjp$ ٗdS @ 7ע߁*ɣ&J#_G  G.T,_8{tr?Jnr% "ڨB:x#}Ђ\{q#n`uVI|C:3n|tŅj% Z FO$__5"i}m[mKrEl@.OVgvUv(GI'TRQ꘤F2F/r *h [ua秪N׎foH8. y --#Cc\_䨕µj; [~.xQHu%S|%B"KpߠG& uf%tIbxfzRPEEe'#JnD\<(R94-'r8oU :Ei:qiWWۭPEW*hjaT%U !]ź_n/<_D?zm$k?ɮ7Lnb^,ersyd!&%Z\xQ콛.UQn|T I2e-Uܟ@$ޣRrG6.!r e]p( }\Z S2 Mq2'.5tjy-_SuXYOvuȅƽ }TR5]]TugGB7UCVJѕq7ՏS:B:>X3OhYoe2KeC2?(*\Gsi\{;tu&MOl*_f2c&'s8(٨6[#\ѹu^jџL]Y踡roe;bŇ5_%9\_E;o,9Dm}P^= 2ǣ ь1Z0u=KZj+PKH&sZz,h+}dwJQ>xEn:g>)-0|YZv1H\ dlmQ{/O{xGA8VqN%XGknCT4D"iƥu]jDF›ɛ7-`w@LM3jxj8/.CZ7TU7㧌@ Ɉ%H`=~EBホf{X`"* -^v2|A%iS}qvY_ã:MkwlSq q;Kv)w2\%xvaz(4.۩&lNߟ$*ɳ&ν-\/@`\nj*6N1?IOiOYkf7n`P0u :,ӑwe3ंA vST 5ë q 1dUb`Ww,#x=UqOR{۶<4d:,Rs$,_J* #ŃOI8 ں5C)FĚ2 ʄfB+ 8Č"L\h5xQUдID-e-S- dv9R5Q]y +w܊/ߜ{ᖙe\U[p*U5,NnJy!_e$߸Lw bt3|xya6@Ed)#j LGG?2w@{Ã9"kU(cMHF&"+!YT Z:K`=i(D{2d,[$@Y;<2D{KUU'p'88g\ވXHTx%yt-my:|Z>?{W:F1J */AR+KǟtMsbwç[Ft K84Y *^&S˞wFhKRTM#A7g8 bWj د^TZhm(uN4Ǻ]21R-2֔8xAb``a#P+< uA+%3pdh:-7w}5s$''[e(n|̎]U ^Ns@T單^Eb5b ΁Y$8ĂjnMâd~UZ`|8%~"W[@z>XuP 1d^⏢uq9ȠV,AƐ m;֦<O-S:ŧͱgإeq3}IrzU`EY7YmA~2A #T}"Q9,uqt;H>b:'\Zael]Ehb׼ mZ'N"j@:ۓNQ1 E)1 {"cj*Sm (xUɖj!fo mu;~xfLwfp/9r 'ÁЬ*~@b6 &0YMIAq1Ȇl:̭-2 ^Db߀4VRQ̄m<#S2x+ a;нؒ"`CPb2P4@F>ܼIUgY*njqZj]#%|IHtB#0 x4[@}3P(l{KIn7LʬnT##H-TyreR 1Y1OA%PVdXG49Yq wMPmMnƂ6TJwI)Vy'ZgɃ!?b%MM g/^u=<]3tkd6T ޟ01{DJ09i$16Aq5⠲`5&;QQq Τe!]W>K+@TgdBtzYb|?aM0S/>k:N"YZkCwOA@sKK^y]^>3kpI\JOP @{6iCa AO @$uLcbj-|PŐ f}BgYs&؊; )5g 0hnuB@"׸p2`7Bk*9p:"Ϋnr{ۤɒ2Q :fImm0NԓUv˘rML݊E۫|UppGm+J}M3k8PjDbJ߀MaPl;h{2_5B5XpFc.Ev&$6iܓw`ߴgaPga89zz۲)R#< ? 'ڿ{Ԝ]F%r(A%n K]2NTE"#jo$xjhgA%վo_Ӈj60BwCUHg.qVU^9׾kk {/:P?c4nR\wBn*7{Ywݲm,QD&%Ar5l;\y~L)~OD -u.C[֦Z%zxM8fEQSp,8Ɨy^?Li }GGVA qYG}=,L2^! >/GTuwn!;p^0r̈́0İEv1Br0PlgP{"@vtAw:;N`bSNp0f41Ϫ$Y8,lI"dorqu P# p!O$DZ@ :Z (Ͻ+di΍x0 >L ;4w@"_ߍn< W8v@KЖ }}&g;y;8 N5Ob%x׵gvٚsE4C{J*<9d#p}+0zCu3G r0[10сzz@ eϩse*{/((bj7#l3:Z`W*6]HyQ7x  V\c{Tg(^a9W٭)o(2^_L {w8u 5;Rb]Uyszz{{۵!.SiG$pZ@aylNjK‰ H8)j/DJJ:/^uo~d ֩4k.D4z=R=F v$DZ8U) H٭txN@Mic32n:LE5ͳep&A062qNu bQkꀋo_ٯ_tTFv ucjp,vՒGB4d%Hd1PM it 1ȢalDZ\,bvý lJLi;4w8&{fm FԹ A}ǂєxe;i!'.>zܬՍ{hH5}Mm_a?svo* \6" !E @1}H%.OU'wځ1V83q jx`p㾖w)PҀKmq2}MmguBB/B)l7 mHFnr1=#JHiBaNh b7`LwvG4-ub`t6na:"q>`//7YUAq?/5xJe*i5egδКT~o 7|ݖ MLt fs Av.E0lմ9#Gp,Fh>z 2lw<+&棗 O|f+ͦm"XGene%hbkP诮A:(KDνo{~َނaM b; =mhbw};xU_{y!К7⚼ |Q>!wSVmrqj'.C}|xK6gbvShr$}?_g#.M8[fm1K|8"?K׽MY Pg65~XP:KEaKC $ ? gG7=7Vg5pm /|ADo$g{R=zR!7 AmyP=[Xb2ui4k.~v$ B$MyE4+xgwP2wBH"vf =L"P1ZoD\SI ڢZ$Fp+|R /"'GS?RB"hT~NӼw,9) %+[XBu8`ԝgO2W|3(щ6x?K,B3t@|\GaGN2PrB BJ}6~Y|e[6i炶3Ot\,umȢGXTcSǴDt%&ah/h U5 ,nՒÃ2'߈wVQ _իSay)F[& O[ p4ߖ wh%ZBZ LH8yBrP2O0=N0W4A/X0Exg'c?JNp+B? Ӵ-dbfpisMnN״8i=:R TjBPQ)NXR\ $7[Ӡ"̼ggy'F< ә,En+;Huf<0뺽8ke#ٵ9U;LB@7ai)4-Kl/ ,n+iN2 ТRa\Ao6)2"(ۙiW@s’F~z+|0Lh㴶)6`/ +;竓/G^[ "6+]Tsb.oı nlzd!XsveuB̧9NsB;Ւ &8h%M VgV>Lv:5BuM&g0>'>EJ\_+V'`M+AQ.J4'7<H }@rr|F&9{kn _|=r bٛ|9Zusr/man/man1/0040755000000000000000000000000013365330317012004 5ustar rootrootusr/man/man1/clamsubmit.1.gz0100644000000000000000000000077013365330317014646 0ustar rootrootϰ[clamsubmit.1Mo0 DNIK]@eŦcrQr&-lAȗ|(J#Pj CNxͥ+cT:XLcq{2@d(p RV\D󘯳 r~#xsJ+wKr&koM8wq:]',Y.^AY m:c,eg]HD r-?oG 3|ܖV#T[/L@ ʉ x%3.g5:Z* (,Wo}nץd{մ#mc\7KMҩ'7/7lXvPَkHj_oU:aa"lBdV i^%iI"?#eRg9bNL{̸qe6eh*ܘ鶫t9]W5lM=:+9kVmʹr?ͭHbn+L`yX'ES3.^WO4FM#ɟLjj=m۴=Ϊr*EtzhT-@ - ;GbMh?a3ph7g6־S M[/ӷTn 8GED`'.iF|KH)PV&Jdk dJqԳz! !CmjH̖`/.vnyDXͭx! n ˘ 'UWx~V$M{C#!"Ңo\|7?qOm@yTC&Ӟy.Rd0RnBx]}p(  䲩~%&Hz-Dk(Iq}fZ7!;<>ral_Dy(ILn૙Zɇ+oRbey>끫" س`>5`_tXx;a\pֶ}w=E+o4D"ur6oqy="Ĉ.;!j" :qL%-˂(SYۖX&"tBMCGυQTn Orx̂fћxw7;hdxB+#FCř~EWIlgZ:g|Ә)xmąSkWiaL(8YX3Osy6K^W(霓e*ꩥg L8!nU4=1Cp.cDԠ#(e;?df9^&N*k>Jj7mh*Ax.\~ }љg03JOBIXS<՞Rep/W( ۥ*QE6OM;6mbÄ Ɖ:| zB!=aPRq<ၜc)1uvi[o3kcfK [UmB%"!550(׬sҳ,e2JTY'?M Imeqf ޓ[<+@u^QFXi+V $R{4@ s'V4r'Dfahc nnF&h: Vg6]B c3(Z 3j2}!~iÀ5K4F A]~+G`.0+h9ee2At )N#+' wB+gE:c<os``cl.z?I;BCBRa vjb=Aܩ.C2R=FLDzӏgޠ pJf:@,6-&\h ?oc[fUo(rty-c&%SR')lŦ<*ڝ*%TɩOgd1 5ַ],Wjt%zp\V@ ~=F\Dxqxm_:Ur`޺iԕ9_ ;ikZAǮ0:}\e QQ  QP .$(e~ Ń6ũ;G"m=D2RՂryH79#.6@tNz'OV:4|q qv ;y@HGitPwo!mliR\52qO?V3q~^tw¥Ti 7;,.a F]+; OVYlҼ0X^+?sV[|/0V)^X (u73hf]oڸ2m~DtxGrx֦&!#Y DH{+*"F-.Nđv ?(ߡS -/)49:*A̫~KմzuWjPMW4qV\pl2Ś>9ؑgUZ'*&XɅy@R [<ۊ$;`bv_f>/GpIT-ڄ[ncusCg){SE:.v#tPif#iqgD]Qg.-0jaR#?2}!< p)[{|b\gTs{=ʖ>Wҥe'WcwzFy)r:|x>ԳA5 vkrGgF/{4[KӒ۾-nу63ڎR%!RӼ4k/'g';5m'iGK3V\3`:8ʴ<=zPL-1ru.2lӮ[oetw0Rkz,A<}[FQ#&)#jt|Vl8Ҋ]NC6LLu5Ǘ'F⹸q\9kot4—;x{l3y+LEڳ8o0Q"<>t/:(Ŀl$?u@G?RO͡*lcqt6P'ez2Kzm@pPg(44usr/man/man1/clamdtop.1.gz0100644000000000000000000000433713365330317014314 0ustar rootrootϰ[clamdtop.1XrF}WK* b{m9bew*W*^>Ui<1mZ\x*MIAmE$FJj'#/Ȇ=daxAGŤu:wCUF {$ f/(,vY1 ʟo{>"Y*_Z:#&߉D3)2q5XfFI'#JkQvܮrB΄ʏQNNAI$I!⛵.ϬagG{S`YS+@j|M߸k2D]"` gąyX3"pIJe*3VV)`|HBgl"BL &Ds3ͶgQ+t8b8 qF?K5pZ5l U{5%o1UOuh&oD]8ܒR6plG ĹS#f 5*y*k_oF3r!}?%Oc~<|j,,$-,*}W0ˎmcF0 䋌+ga+0 jnt7Hg= e5`dZ"k5eķ/NCqjx#;FsQ|ma19AQ`;zM1qs1F}QivloSojv8ع5)=FXD6Fapjo{16ec@dh9nN@:U2^U.2֖ @Xy,.wl Fvj+>FWv5_bێtw;]6Qfc/(YD-uGNr+-ڕԮYh/vxj>`(5f}U F؝[dv3&C]-.i9.N_N/SC2d\MzD]lz]﫰%:cxf4G%O'< ]ſ{;5_`m9(FRusr/man/man1/clamconf.1.gz0100644000000000000000000000077313365330317014273 0ustar rootrootϰ[clamconf.1mo0+NlHCˀ:iZ%gvh_3Sؾ;wc- gZ u=ᄾk|0-7GLG0ߓmV}1l VNiprb- e0ؐCh(#x bkZAd-14˓S7> aE>[%YJڦG npuh,9`Kv#ʞR*'X/~h,W(^y nUxGfBbF;=g vm$TRgTmJ#4F*:{sRmmYNn~RVx.S/o:?MTdZ̓zRPe7= *-V@2mOo,4D$ ZUږZ!C>C*]MWHtA=|ti)t], ^Эꋲ;>̠a 5:iѧr /iW b)tQfd6xew7|r$^imzcrʌ *{ zj?7#%FgjUZ>PfMAhJp_hZJ2[iwVy/5_COQR4NcDpbӢ>E7lzTM m/Q*zA E]'YF_WRbGBie&nԢeb#- XZ6OjJʻ`21EF{֢Ym:F"fEylDOa~E-%tU߶1 \$/]Ws_(ο;l&G0. ${Jab^d5/anDݱ*Q& 4-Z(q,$L܍4BS:N{/'ىL.9$ʗ([l9!-hl%ԒN gg,.1FT7oފ N\EjYQa.\|s?tG{/̱66ݣn&z99Ѱޒ<5-7 XbG ^[gGЬC0u+s=RHgeYG31C|i@1f irWopV+p&$7qJEb"30ݏՎ_eW_bq]Y E2y@= 5=Bίp~'xOBZH}p 0zĩ"Dc?Bxq\{_+KuPVyrr@dw Q8^>Œnj6?x #+eYq{j y_G> pܡ՟҉n'VBa;Ǧ+pj5^Iqvu>6 9ᏸU jj /MG&lD,0#rXϳzuU6n矟)~1-~bkb;z~<_Iǿ^86p ?Ft{?{zWUj{}=phtsIusr/man/man1/clamdscan.1.gz0100644000000000000000000000266613365330317014441 0ustar rootrootϰ[clamdscan.1VMoFW |[hb+P2$%mJ[\vw)EA7$E=`\{3tr"$\:[^Z=]^O'Ql.Fƥ` oi])f:gGL)Ֆo{f,mk5[Ņ)ǻbx㓩6L͋sT,tvLW#(JzeF'*ԞV8% U. ;'$\y9 S ʃ,򠿪=y2Є/.aT4JZ\{)=\1jit FK8I]0TŊrEy,gaDXIH5'|}^QN8``݇jD-msBZalg]ƽzI&Qi$?eIj*G,|L+JH svm%#[7e[HZ97!)'s.D9d82P宽ZQnR=%gGGF'[cFgd& S2q-e@f,$H#ăY`AvF^C\նÜގ-( v+0 ۽>cv.)-&ˁVX-ᇗ}̝_Olԯzꈿm z13 {p6\/=5+?/R+1\ծKU7_lڵNQNOwt=๠tgVL]͸ćp;=r/㲹$@ӂ=L0~3Bcl(&/paU@wF}~lބ7Y+_hTfO&4]WᏧj%hC*!M usr/man/man1/clambc.1.gz0100644000000000000000000000124013365330317013720 0ustar rootrootϰ[clambc.1T[k0}¢&]Bvԣhȟc1Y2,~rs 9ߑt !~=c {˰XP`xbA p0 I_nM/"=<"i+LhT 7@e9rD~>=YE$M%xe+JkC5@y awYDeu# !¥ }.-F]} h7V6i Џ$j[缝gwڹgP<8*BsT4{Tj+٫eT 1c\0K$o^%57_z`Vwy`<v> )j+7֖x[%?[k@pP: qﮒ.Aט֩(VB C76$u%8t`/&y֋R ٯY bmҮU 0V? 1-oxa3rT6d\?AH'4IekisD(>vcmpw+d̒kdCy0bm, N&hP/Fusr/man/man1/sigtool.1.gz0100644000000000000000000000332213365330317014162 0ustar rootrootϰ[sigtool.1WmOF_1KA PIrj %8U{l[w ;3qC<ۢH`+9ӕЯ;;vA88[te:oC| O baL \f2@N䏻d8ْ(*rQ xx?#LBedRa.sp;8h!gSe Q/l )E2RH!)t&lRe,,ɿU*8БVeLHҚ90b^v)}J.]i;ʖzE3],_  1HB]*I&ߕx.$3%pڋ<}u!`LIVHӚ<øͱ"#z|\/WÛp}|+M aV eu˩)srg?zrzK.L%;go  O9a /ω\jIR7eEEFsiB|ҚJ~UgJhl_T6!@dTS ӫȜ^n˙YEdHƅw2 DE"my )SBb0,@_jWrM)g=fCWb/vC:f삾{O3HZ@[H>6Y Z]DcrOG,$- 3>E8&nŋʰ,|+Ȕ`Mtv˞0R~9>>nKR))11j,5߽kv@jضp$tՂ)Y ?:'/w'+'aEal;\**(l2HdV + qAn4 ߓnƵV7,eZ=,D|cg3&@HX% d!rH@ rf`_6=n8e/#osɖ PqLQo kaxn< Af7,J>m֗ Tux~}LF8ղ EA\7'iB$)磛܅K;5"w !6GûKVpbB˦)|J0U*G!ܢ DP֮C΃͘QVH$17v tc01|0>HMY)/_]#/,WZ jU?3`H=LNRq1'*_OJʯTksBa9„n -iجjrXL mP'nEft4 ִ V~ M}9T$ҥī$i1FTngfXHAA'}(nU>L(B?a's銄ЂZl.;H߸cJ2aiL{3?\s%"gmP ͕cKlw\}tM ?oqQ4oV7n%.aNv^PtCEnUq--FM-O%!Za. )lXz4LLo{Wg[K,\BпP׫]V3Crw8@̙/&躐[q#ն*ZZxw1q;?O.‚NѦGdY^x8NhX߾d:[GV휮Jwfgt-sB[J+֕L.7"R,C`}_ ;ÞL*}TVM%օN#2mp2ZLm)c'!|7$_Mgʥg=n8Wc )@Ue2*3j hڬx.gMrNׇ\&_ eSJ( TAj/ފ4F$vQU] x_ ͤ[QDcڣj6f-\ lj5ؙ*UB9a5%}kŭdbe[5YƬQBk.bf+.6ʪ6Ѩʒ*\mʤ7^gcflJUu=9 Nv=w=0Y S^k†ʽQ[UnԀc$^fta/{d îLۻUۭ2O c9:fɧe4_ IhDHǕdȵv:csAf {~y3իQy `EvzѮTqĞ-Ro%$}$|TR#a/f[ʞ(w=\G+~C&^T/9uV9JV*Sd S, Ԛ29ֱ[4gGH)FHǓr> caRSј窦$Y`>}5!'*c^v`G@*UXzu%&(/*jj(> iMdw+:B*/XNKKxqKq|UrWtя%qn7+;Lm5z(VoJ[63}1oLjUԲP`Rꆯ0\`WeS],Kwߴ:,v^H0o1Ȥ^ӁNvME^1M:y{5uH>>E3z.eJQkFhA=@&7{&P%i{-M(`_qgd4Vk=aTb B6̆3RA7"T;UDI򉈮V*2[+}W;SmnzLh]!tCj=  yw3t#, -''XQKͫ4`' ,!m:DoY+HC|<韜P%d?,n.oI>Y}U3e ru|)n[>m nso`6jq?aypl_Ǿ3RW 艮N0CiDv3GFtqF.L-tu[Zz|w2Ԃ#flUZo*>{aDpq&.41Cx:.~FZYx|@o#9>SOTxh\)?ʈ4G;7;!H=|0y8>/9"cQ~xJ]ϮzIxa o~18Y3Og^*4yu_zrba4~Dۏx-3n5CJ-5i~y:ꘐW귭r珤N>%d?kF֜vN*EJ~otp|z8j*Ozusr/man/man8/clamav-milter.8.gz0100644000000000000000000000104013365330317015250 0ustar rootrootϰ[clamav-milter.8mRk0_q䩅DM 4Ki CƼY>bIr;YjK>>!vxhxC3ќ,`v7tK,0e),Giz;JXFJŗ]Z HN BeVp~muw9Wr6*ĕ{WyhhXv[:TEOJ ^WV^ͽ {˛^ K(xÕZ\P񞄜npEZ_=94  [m\MB cE6hmj΋1{R %JYUh,[.jj"ؽGu+%tţqrҔ/EtX@\;N>Ǵq`шw]irɡ-Lc%g􃢆bTq<7AӬ)%>H+ zʨnZɇ#HnЉpr'1G$_{x/>{ZbaLp~=b|O?6rusr/share/0040755000000000000000000000000013365330317011477 5ustar rootrootusr/share/clamav/0040755000000000000000000000000013365330317012742 5ustar rootrootusr/share/clamav/mirrors.dat0100644000000000000000000000000013365330317015114 0ustar rootrootusr/share/clamav/main.cvd0100644000000000000000000000000013365330317014347 0ustar rootrootusr/share/clamav/daily.cvd0100644000000000000000000000000013365330317014525 0ustar rootrootusr/share/clamav/bytecode.cvd0100644000000000000000000000000013365330317015221 0ustar rootrootusr/bin/0040755000000000000000000000000013365330320011137 5ustar rootrootusr/bin/freshclam0100755000000000000000000050652013365330320013036 0ustar rootrootELF>@G@@@8 @@@@@@88@8@@@ ""b"bnbk @}@}b@}bTT@T@ PtdAAQtdRtd""b"bh]h]/lib64/ld-linux-x86-64.so.2GNU i{rI`R;& Gx}6M^zqF\pXE$#+|j:cL5lHQYC9 VO8"oehu!d~ f,%?-()<*  =3.B0_NJSZD7[tUPyAsTbvm'4nWwk1 ]@2/Kag>]6[C$j UyD3t  7_;_x,AtRy)gXpbw{ k$07HS q#+B/GTp6Ab\KR~<b_o+(bCKyd&--wS?olb#JAY<~bihb)2fE .@libclamav.so.7__gmon_start___Jv_RegisterClassescl_loadgzclosecl_initcli_strbcasestrcl_cvdparseEVP_MD_CTX_createcli_gentempcli_cvdunpackcl_engine_newcl_engine_set_clcb_stats_submitcli_rndnumcli_strtok_ITM_deregisterTMCloneTablecli_versig2_ITM_registerTMCloneTablecli_ctimegzdopencl_retdbdircli_chompEVP_MD_CTX_destroycl_cvdheadcl_strerrorcli_regexeccli_hashset_destroycl_set_clcb_msgcl_retflevelcli_isnumbercl_engine_freecl_cvdfreecl_debugcli_regfreecli_filecopycl_cleanup_cryptocl_cvdverifycli_bytecode_prepare2gzgetsEVP_DigestInit_exEVP_DigestFinal_excli_rmdirscli_regcompEVP_DigestUpdatelibxml2.so.2_finigzwriteliblzma.so.5libbz2.so.1libltdl.so.7libdl.so.2libssl.so.1EVP_sha256libcrypto.so.1libjson-c.so.2libpcre.so.1libm.so.6libclammspack.so.0libz.so.1gzopen64libresolv.so.2__res_query__dn_expandlibpthread.so.0sendreadrecv__errno_locationlseek64fcntlsigactionconnectpausewaitpidlibc.so.6setuidsocket__res_initfflushstrcpyexitsprintfgai_strerrorstrncmpoptindstrrchrpipe__strdupclosedirinitgroupsinet_ntopstrncpyforkunlinkselectmkdirreallocmemchrgetpidstrftimelocaltime_rgmtimestrtolisattysyslogfgetsgetpwnamcallocstrlenopenloggetaddrinfomemsetstrstrbindchdirmemcmpgetsockoptdup2__fxstat64vsnprintfstdoutfputcfputsmemcpyfclosestrtoulmallocumaskstrcasecmpgetgidopendir__xstat64__ctype_b_locgetenvsscanfoptarggetservbynamestderralarmsystemoptoptgetuidstrncasecmpfilenogetcwdfwritegettimeofdayrenamegeteuiddifftimestrchrfprintffdopenreaddir64qsortsleepfreeaddrinfosetsidmemmoveendserventfopen64accessopterrsetgidstrcmp__libc_start_mainstpcpycloselog_edata__bss_start_endZLIB_1.2.3.3GLIBC_2.2.5GLIBC_2.14GLIBC_2.3CLAMAV_PUBLICCLAMAV_PRIVATE % 38 ui _ ui @ ii ui Ӈ_ E bbb3bAbbb b(b0b8b@bHbPbXb `b hb pb xb bbbbbbbbbȀbЀb؀bbbbbb b!b#b$ b%(b&0b'8b(@b)Hb*Pb+Xb,`b.hb/pb0xb1b2b4b5b6b7b8b9b:b;ȁb<Ёb=؁b>b?b@bBbCbDbEbFbG bH(bI0bJ8bK@bLHbMPbNXbO`bPhbQpbRxbSbTbUbVbWbXbYbZb[b\Ȃb]Ђb_؂b`babbbcbdbebfbgbh bi(bj0bk8bm@bnHboPbpXbq`brhbspbtxbubvbwbxbzb{b|b}b~bȃbЃb؃bbbbbbbbb b(b0b8b@bHbPbXb`bhbpbxbbbbbbbbbbȄbЄbHHP"Ht ^)H5P"%P"@%P"h%P"h%P"h%P"h%P"h%P"h%P"h%P"hp%P"h`%P"h P%P"h @%P"h 0%P"h %zP"h %rP"h%jP"h%bP"h%ZP"h%RP"h%JP"h%BP"h%:P"h%2P"h%*P"hp%"P"h`%P"hP%P"h@% P"h0%P"h %O"h%O"h%O"h%O"h %O"h!%O"h"%O"h#%O"h$%O"h%%O"h&%O"h'p%O"h(`%O"h)P%O"h*@%O"h+0%O"h, %zO"h-%rO"h.%jO"h/%bO"h0%ZO"h1%RO"h2%JO"h3%BO"h4%:O"h5%2O"h6%*O"h7p%"O"h8`%O"h9P%O"h:@% O"h;0%O"h< %N"h=%N"h>%N"h?%N"h@%N"hA%N"hB%N"hC%N"hD%N"hE%N"hF%N"hGp%N"hH`%N"hIP%N"hJ@%N"hK0%N"hL %zN"hM%rN"hN%jN"hO%bN"hP%ZN"hQ%RN"hR%JN"hS%BN"hT%:N"hU%2N"hV%*N"hWp%"N"hX`%N"hYP%N"hZ@% N"h[0%N"h\ %M"h]%M"h^%M"h_%M"h`%M"ha%M"hb%M"hc%M"hd%M"he%M"hf%M"hgp%M"hh`%M"hiP%M"hj@%M"hk0%M"hl %zM"hm%rM"hn%jM"ho%bM"hp%ZM"hq%RM"hr%JM"hs%BM"ht%:M"hu%2M"hv%*M"hwp%"M"hx`%M"hyP%M"hz@% M"h{0%M"h| %L"h}%L"h~%L"h%L"h%L"h%L"h%L"h%L"h%L"h%L"h%L"hp%L"h`%L"hP%L"h@%L"h0%L"h %zL"h%rL"h%jL"h%bL"h%ZL"h%RL"h%JL"h%BL"h%:L"h%2L"h%*L"hp% G"fAWAVAUATUSHHUK 1At3A(H=CH1HD[]A\A]A^A_Vj1E1AHډ&HI_AXH5tiHQ%x F~oELd*fH5H|t$HL9t;H+H5 HXuH5qL$x f(K"H5iL$L`LiHPAU1E1ɹ1AL%HHZYHH5jHt$x H5yH[$x 1HT$0LLH=tD$H?H=L1A8Hv$`H~J"H=f1BEH=ÒH1H=1H=41H=1H= 1yH=1kH=,1]H=^1OH=1AH=“13H=1%H=.1H=h1 H=1H=1H=ޔ1H=1H=B1H=t1H=1H=ؕ1H=1H=d1}H=1oH=1aH=1SH=d1EH=17H=1)H=21H==1 L"H5rvH"HXhH5nH!x uH5ffH!x tH5iH!x H?H"tfH5DfH!x t HH"fH55fH!x tHG"fH H"fH5"fHS!x t HG"fH5eH2!x t HG"ff;XHG"H5jHf P HG"H5ZjHf H@HiG"HHH5tH x H5G"HH5FjH x tMH5;jHz x HHx$H=%HH3K"fH=5mH5vjH! HxAlH5SjHA2HpH=ʌ1HN 8H=1A(H5jHE1HxECH H@"H5•HA(H81GHoHHI>pHOH=΋1A=HH@HE"H=(H1`H3H=<1A> HO9H5hHP HaE"fH5whH@ HI"H}HH=H1#H5HcHdx H$`H=zHH}HHwH=H1A<HiSA}AuH=1A={H3[H5XrHx IbH5-rHH@ @$Mm0Ls0MLI}H5H{HtI~I~I^0LxIMuH5>aHaH5q@ @$HD@ @$HI"L$&1LL1HljH$z1L kH5`Hx ?1LC1L41L%H5pHHXH=sۉ\$H5oHpx 2A"f[fuBkHA"fH59eHx HE"HD$QL$`Ll$ 4|$D$HUJ"6<H=7H1u HcD$HL$(HL$HD$f=E")LHg~-H5rpHx tHpHtH=TpH$H=u1 LLLL H|$|$HD$HD$( HD$(H9D$ }ELD"ftffuH=1 fD"f1L71L (HsH=LHfHgD"HD$~H5VoHfx SHD$H8HtJHAH=RA7HuH=1 fC"4H=.AK HP:H=1A)w H/(H=Q1A-L HH5]]Hx LhHNC"HD$L(H5LAHHaH5FH1HDNHpH=mHH5dHx tTf'>"H=&1AFj H" 88H=HL1= rf="3f.1I^HHPTI0,AH+AH8@fDH=="H="UH)HHvH>8"Ht ]fD]@f.H=Q="H5J="UH)HHHH?HHtH7"Ht ]f]@f.=="ubUH!H="HATSH!L%|!H)HHH9s@HH<"AH<"H9r[A\]<"H=A!H?u .fDH97"HtUH]AWAVAUATUSHH|$(H$H$L$L$t@)$ )$0)$@)$P)$`)$p)$)$H$HHD$`H$D$XD$\0HD$hIIILl$h1A HL9sO|%uHDMct$0HH"H5L$ H81DD$(H5=MYT$0HH."H5WL$ H81MH$LD$PHL$@Ht$8|$4HD$d=:;HHDD$LEt8;$XHD$@L$LHP81fDH ;Z9uHm"H5H81uMMLD$hHLHLMIH"H5HH81MuMu {HsHtUC0H|$ ED$H‰D$H8H|$ E111LH|$ D$3D$0C7MPHt$X1LHD$#LD$A8"{HT$xHMtKH=?AH HHLD$hE1M^I\$"HHA|$|IHcD$dHH@HH"L rH^"H=o)1HH|$hyHH[]A\A]A^A_ÃLD$hH59LLD$"LD$tA<$1A|$E11HHH@CML 18E1HcLD$hgD$LD9AL=&HcD$LBƄHD$HHDŽ@HDŽPDŽXDŽHVH-"H=n*1HH|$hHL%8LD$h1D$0CH"HSH5&H81TH|$uH\$hdH|$tH|$MuH\$hH?L%"A$9D$4*|$4)ǃHcHHC@A,$9l$4H|$8HcL,׉fI9l$4)HcI}H{HH\$hA$HC@)HcH<uH"H=gH-eHA"MHH"H5oH81%LD$h|$0 MH_"T$ H5LHH81L$0&C{H "HSH5}H81H56LLD$1ɅLD$E1H"HSH5dH81bA<$uCH"HSH5AH81'fLc(1kqmuH=HHgMIH>"H5gHH81\$0H"H5LH81H"H=k3HIoH"H=5H$JH"HSH5=H813~H"IRH5|H81Hf"IH5$IRHH81MIlH3"H5<HH81DL$0EH"L$ H5JHH81DT$0EmH"L$ H5HH81SIH"HSH5H812(ABHv"IRH5H81HU"H=11HH|$hpH$"H=1HyH|$h?CtrH"HSH5H81sIABtNH"IRH5H81FHh1[]A\A]A^A_H "H=.H=Hl$(IqHAA0H\$@L $H߃҃L $t)H "IQH5DLH81Hl$($Ht$1E11HL $蝿H߉LH5FL $AAK 'H\$H5/L $HL $t;1Y{OHD$HT$H|$(HLL $L $KHD$(Hh[]A\A]A^A_L $HHD$L $HHt$81HJ;"L $ HT$8M@,HHD$HDN@u+H|$H2IY(H\$$f.HH|$H|$ 1L $CHD$HL $KH=?HH WH|$H5_.L $萼HD$L $IQH5K"H9 "H5LL $H81HD$L $DkkmuH=HLH51HD$f.fAWAVIAUATAUSH=CIHݿH1һ++ "H="H-"HLcEHcHcLMIOLI1H5"2@u`@HA"I? "Hcɀ< tjDE9}DeH[]A\A]A^A_H2@t9ur W"@:yW]tIcHcIT< uA!"DuDuE9XIcIDH -@+@-Du@HA9H -uztLLD]NHcA9ILDu{LA9~HcITfH2HHru9|HA9uHcMDuDufH[]A\A]A^A_@H"IUH5@H81 HcE "IML4@;fMHcA<2z:8AV "D9U H  " .1:AD:fDA:A4Fը8:BHcȃA:EfDDBA-tlE(LLD "A "DuHH>A "DuI1H7!zuADu zADuKTHJA9ܺDuDH"IUH5?H81N: 9 "Du:?ff.AWAVAAUATH=>USHIHxDL$ HL$LD$莻HDL$ 1D$ ++HI "H= "D;HE9IcH<Ll=H|$ IU -@+@-LEfAHE9H -uztLD$HL$LHDD+E9AIcHt}RAMH~D9~'HcHDfHAHHPA9|HA9ωHcAH|uDzfE_ADE9}$D3DHx[]A\A]A^A_fAHxD[]A\A]A^A_z@-t@ELHDDAfDA$<:D$ A4VՁ<|$ :P3HcʃA< @:@|$ EfDE_H5 "DIEHH "-:5Iu~Ht$XlHt$X~-@@HD|$8HD$0<=D$gHcljHD=tHuT$gL$`HD$HHHD$PWD$`+D$8LD$PD|$HPH@E1DADfDHcЍHAHcA44@:t-Wu@;t"9uHxLH[D]A\A]A^A_HHcA<4:E͉|$8iH."A?E_H5:DIMHUH"H81IEHD$XD$8D$` xH"EA?2HHUH5z:H{"H81DE_E9DSHn"E1|$ : AGd:HHUH5U:T$`H5"HcHT$XH=Ht$ HT5H5"H$D`DCHt$D$`1+D$8Ll$(Dt$@D|$L$ HLfIIH^Ln MMHtUI?H5U?ڬHHwfDH{HtGH t5H[HuH褫L1H8[]A\A]A^A_fHxI7H=01H5>DHHD$H=*kHHD$(H|$(H5> HHD$L1HT$t$ L跦HMtA;,$tpMt A;mHt$LuH|$D$ 豪H|$觪H\$(HH= 0H1HL$ It$HHt$ Ht$ HL^Md$4@IuHHt$ ǦHt$ HL'I}Ht$1|Ht$ )thMmH|$ΩH|$ĩMMI?*I7H|$(蔫xH|$(~H|$rH|$hH\$(HۤH=.H1zH¥H|$.H|$$H\$(H藤H菥IH= .1,XH|$H|$ިH\$(HQHIIH=-1H=E.1H\$(HH H=,1I7H=.1I7H=,mH=,WH|$yH\$(IH=.D$ 1H&HnHfL$ CI7H=-D$ 1H\$(H\$(H=,1HH|$衧HDf.ATUSt51E1 fDA9t+ XHHA u[1]A\H1uLtfJHu9t)‰Ս}$HItHHHA,L[]A\ÐH[]A\1ÐAWAVAAUATIUSHH4$HT$11*HL-!HH=91MfII>HH赥uH[IDHXHtopLHteH豢DHT$H4$LӅuH蒢H[]A\A]A^A_H=,H1HcϐHH=f,H=,HH8H=,1돐AUATUSHH6HHIH1I3A.t&!HHQtDH=8ţHu0L9rL螠tgL1荡H[]A\A]H=i,1LeH[]A\A]H=+1H[]A\A]H=Y,L1ϿLH=+1貿AWAVAUATUSHHH6HdHվ1HAHI1 HvLHD$8D$襠1ҾHHI1 H;LIAmD9l$81ҾHSHHD$1ҾH6HHD$1ҾHHHD$(H|$(H56jHI1ҾHHHD$8H|$H560HIH=cHHD$0eH|$0H5q6HHD$ Z1fLDH袞H9\$H\$H_HHHp\$0D9DLDHIH-ۍCLH蘠uH|$D$՞H|$˞H|$(L9L1H|$ 'H\$0H蚝H蒞H\$H=^,H1,HtL$HH[]A\A]A^A_Ht$ HMt.LD$诡H|$%H|$H|$L$H|$(L$LwH|$ mH\$0HNLKH|$H|$距Ll$LʝHHL,H|$芝E1H=(1$LH|$ ؠM!H|$(E{Ht$(H|$0譢H|$(H|$01H|$(LrH|$ hL|$0LۛLӜH=d*1sIH|$诜H|$襜H|$(蛜LH|$艜LH|$ H\$0HjHbt$8H=)1H='(1L覟H|$H|$H\$0HHL|$H\$(H=)1LH菺HכLϛUH=v'1g=H=.'1O%H='9H='#H|$iH|$_H='H|$?H=^(ٹH|$H|$H|$( L胞H|$LqwH\$H='1H聹H|$ǚH|$轚H|$(賚L+H裚)H=b'=H|$胚H|$yH|$(oLH\$(H=&1HH|$=H|$3H+H\$0H=u'1H軸H|$H|$H|$(LeH|$ۙLSH˙QH\$(H='D$1HWH蟙H\$0H蒘H芙L$L|$(H\$0H='D$1LHLWDAUAT1USIHH4H1Hú HٚHI1ҾHHHtnHHHtL >HtjI|$ HXHhD(tIT$(HBID$(1H[]A\A]ID$ H艘H=:'1+H=&1H=@'HKHCff.AVAU1ATUISIH1Iź H軙LHʼnLHI| 1HIt$Lh(HtD9s8Ht 9rH9HVrHt 1HPHF1[]A\A]A^Hp[ID$1]A\A]A^H=&1H=X&1H=&εLDf.USHHHtL HAHtJHSHhHtHBHC1H[]fDHCHCH1[]H=H&19H=c&&HnAVAUIATUSFHI6IHH1DI:A.t&YHHQt,H=,HuL9r[M&1]A\A]A^H=Q&1rL躕[]A\A]A^H=%H1KL蓕H=%1.AWAV1AUATUSAH(!L|$`D$< LH rDl$E5IHDL0H訓L蠓Ht$`H#H=3*D1/1H(![]A\A]A^A_fHƢ-HIT$<1HA]L^Hމ蝑H=^tkIIXB<#:uJD#HHD$ >H$$oH$B D$11脖HIrHHD$蟐H|$1HE1蝖H$ HD$+fDEdD9d$6Ht$H|$HcE×Ht$ 袐Ld$Ll$@1LLgLߓHt$ H (HT$LH=&211誕HILd$E1D$IAt3L H~AA<$:uԃD$D$ufDH|$HT$8H5R(Mc1BƄ H=B&H5 (薑HHD$Dd$8E11EHD$t|$ t.$ H2H[4H="LHHE1D$ƃ܅Y|$ H=-1t$ 貒t$ {@|$_q|$pHDHq|$'q|$q9v8tH=L2H1AHDHH([]A\A]ÐVH=17u8tH=1H똃 rtH=1H1@u8LtH=1H1蛑fDH=a1耑7EH=1f.Df.SHHH|$Ht$qHtH|1H$H}wH[t8sH=G1H1RERROfC@AWAVIAUATMUSH(%MH$%H|$HT$HL$LD$ L$h%$%oHqHxnpHHaHT$H50H1,rMH$p%LHILuLt$0ALH=i1H=h0L1Ht$H=j01ޏH$x%L$H$x%LLD$(tLD$(H 0MƄ$L$HOHIEHLHEHAVAPPLL$(1LD$0mH HHl$`pLp1HH1fGHD$87$%LHQ$%Q$%Q$%HD$%LD$@$%FH AEQMHt$H=P/1誎HT$Ht$H=1蒎HD$8L H!%tDL$ A DHJHD@LH1L)M{rHyHcA)IE~1IcALD+[DD$lT$H5.LpHH5.LwpHvH5.L_pH6H5.LGpHH$%H5{.LAI]pHuDAHA ; u{ u{ uڀ{ uAL$ HSH)H=H$1@HHHt3{t-wnH01LHH=lHLDN@u߃$%H=H=!1葌H$%pHxHb1zLnHI`p0Lt$0LLm=$%HT$H=1=!H$%pHxHYb1H(%[]A\A]A^A_D$%HLP$%P$%P$%D$%LD$@$%H|$( H ADHjHHoE11H$%H=S,1DH$%1ɋpHxHa1-@E11fD軹L$HH1LLD$(uiLD$(3Ht$H=+H1Ŋ$%HT$H=<1=!蝊$%H=1=!zD2i1t$%H==!H5^+LlHH5S+LlHH5H+LlHH5=+LlHIM) I I LGI}nAHDAtA$t ATfT$%HT$H=tIH1=!gHjf.H8gHHtlH=*12H$%1ɋpHxHy_HH=11H=-L1H3jL+j1$%H==! Hj1A$ATTDITHTAE1҉уI4 9H4 rH5)LkHI\$%HT$H=iH1=!f.AWAVIAUATUSH$MH|$Ht$(HL$LD$$%L$(%$8%AHM.iHxgHIQH5(HL1eiMH$%LLHIMtH='L1ZH$%LD$@H$%LLD$ lLD$ MƄ$Hg(H5c(H [(MHIEMH$HMHL$(PHATVLAPRH6LD$81EeH0LgMtLgH|$HT$H=L1zHD$Ht 8HT$ H!%tDHJHDщHD$ H1H)HjjHaL$E1MAIA1ALSHAvA<$ uA|$ uA|$ uA|$ uAEH5k&LƄMhHhH|$9Ht$H=&L1bH$%tH$%pHxH[:l@H|$h8g$ %H=HL1=!H$%tH$%pHxH-[4H$[]A\A]A^A_@$ %H=I41=!荄E1E1 DE1H$0%HhH=i1KExH$HMH|$(P1ATVAPRHLD$8bH0[@HS%IHfDH$0%HT$H=LL1ʃKDkLD$@H?H1LLD$ (bLD$ gig8"f$ %H$0%H=sIL1=!V]LKdwH$0%Ht$H=sL1!H5#LeHH5#LeHt2H$%H$%1ɋpHxH#YH5#LoeHuH5#LE1XeHD$H#DLiHItkH5#LeHtFH"LuiHD$t%HǺ 1HD$ 4eHL$ D$HccLAWc{H|$(1dD$ Ll$/LcHPHD$4D$0IDE1HT$1A LNHA|$ LcLLHL$8gL9HL$8A͋L$~'ffA**L$Y&^,D$4H!f8vH!L%!f8T$AT$4Ht$H="1}I<$g-H\$(H=1H迀|$ v_H߻9`|$ [_A<E5D$Ht$ H=:"1d1H$%wH$HydHHt$(H=TH1^dH=ډ19*H5!LbHSH5 LbH;H5 LsbH#H5 L[bHHI)޸ M I LGI|$)dAHDAtUt TfT$ %=!H|$ H= HL1HO`H$%H$%:pHxH/UUTTHcD$0Hd Ht$H=] 1zD$0D$0I<$\]eH=H 1Z~H|$$b8`$ %H=>HL1=!~H$%=H$%4pHxHITH5'L`HH:$ %=!H|$H=~ L1}DHTHTAD$E1҉уH4 9Ht r)Ht$(H= 1M}.#a8_$ %H$0%H=e H1=!}H$0%H= IL1|H$0%H= L1|Df.AWAV1AUATIUSIMHXHl$ H|$Ht$H$HH1MfG$t A?#P$HLLP$PSD$$H AE4HLSsA1HLLT$wRH5P!H=hHUAVUM$$LLPS$P$$L$Ht$PH|$HH@DJZLT$sA1HLQH5ȳ!H=HyTHX[]A\A]A^A_P$HLLP$PSD$$H ADAVUM$$LLPj$P$$L$Ht$PH|$HH@DhYHX[]A\A]A^A_AWAV1AUATIUSHHHH=lHHILD$L $D$QzHLHꋄ$LHPj$PAU$$P$P$$$$PLL$`LD$h*H`tBAH=AHHڃ=1!yLZDH[]A\A]A^A_DLIZHHAUI!%tHDIULDII)ZJt+H|^HL_tDHl_=]H=TH1xHDYHAFHL$HH$9AHH}HAHD.AHDc{AH5@LLdBHH lA$OAL$DdHLFH$AL%J!H<$H5A$lP LHD]A$H$FH=H1Y_D$8Ht$H=19_1H 5BHt$xH=D$81 _^H=81^St$tH=k1^H=1^.$HA$P$P$P$$P$PU$$$$PL$L$HL$xH$H$H$YH`BH<$H5 pkp FLt$hHL$Hl 1L<LxCH|$h&>Ht$hH=r1]fDLt$hL.CLLAH|$h=Ht$hH=1^]of|$HH譲ULBH=BfDHCHH8tx.L@H=zLtH=o LtLLLD$ @LD$ t|$LHLD$ uL|$LLH=1j\H5L{@tH5Lh@H=A12\DP.4x %@HXAHHg;L9HL$H* L1C:L[?L<41H=@L1[HL$HT$0H=Ht$x1d[H$H=P H=\1=[LE1<>?8=H=LHHL1 [LR;LJ/#HT$PHHL$/1҃HE$I9H=!AF(HHHHD$h-3H=H1IH5L WDp EtH|$h+HHH\$hHH\0vH|$h*H5H,uH5H,H1+Ht HNjX *H=H1E1I$D$LH$H=xHHD$LfH=Y1AFHVML)f.H=!*HHVH$@E1H$@HD$fDH8HF/HuH-E#H5LU@ u$GH$$H=B1HH5LDUx$H5L*Up HpH=ҪLLpH5L$+uH5L++H !HMH1%H-+H=HH1nCLt$HH1L%L,5Ht$H-HA8'H=H1Blf.H5LTP Hx'HHHD$8HtO0@HfDHu@H= )HuH=BFH|$8'HD$8Hw'`H=H1AF FHD$8D$D$HH=_MHPjD$8Pt$(D$tH=H1A'H=;'HH"H|u!HH8Lt$hH5HH1L-#LLt$h"IHI"ALt$hHL'H|$hj"L5t!H5_LAMNP HH诬AH\$h:H|$!H|$8AK"H53H$aHwRb$8#H=HLH1d@L LA9!H!H\$hHA7~ Hv!H=1AK @HU!H|$8K!IH=1?Ht$8H#f.fAWAVE1AUATAUS1I1HHj0NH_AX H5HHLp IŅH5HLH‹@ H|$ 1Lt$H<$HD$(D$ LHJHyH5qHD$CLHHtfHD$HD$H}HL$LH$\$HUH H=RLHHDH1>Hm0HuH=L}fDLd$ 1 1LHfWI|$fL$ Iul#1ҾƄ$!fnL#!HĘ[]A\A]A^A_L|$M"AW AwAQ!AAWIw tBHZKH|$DH=HL1t=H,Kif;!8HUIHH=OLLHHD1+=DM(MDH|$<Hm0y 8HUH H=LHHDH1<@ 8\1 8@IuH=H1tI4I4M9dD$H@H4HH|$\HHE UH RHHHxHH@,HH)H41AHPELE H@HIELM H H[H@HIHHHXEt$\$ H@HHU H@EHM H@H1҅HHʅۉHEIH} H @HHP EH@HHE HT$@ uEH@HHE DEH(1[]A\A]A^A_t$LHU @tB @uHU BD*8BLHM t$y GֈQH([]A\A]A^A_ËELU H @HIA1@D$ D$ QEH@HHE D 8HB 4HD$H=J1K-HtGuSHH sC[f.HHFHFHFHF u1AVAU1ATUISH1H@uI{DCH{ H@H4HHHC SH RHHH$HHT$HPHT$HPHT$HPHT$ HP HT$(HP(T$0P0C4L 4Ao EuB1H@[]A\A]A^@H=)+H H@[]A\A]A^H=L1+L HpfAWAVIAUATIUSHˉHHL$HۉD$tHA?AG1HH@H L4@ t{H4I9uIMg AEA9$uAT$AG9D$st +D$A|$HD$HtJL H1[]A\A]A^A_fDIMg LI|$OtH4I9hfD1H[]A\A]A^A_A|$tAGt 9D$hAD$t1VHIW JH)H=`T~SHD$BHtI_ H11IMg AT$H)AW+T$HiH9]zw1I_ SH)H=ZHD$H!H:u 1E1E1f:u 1EA1AWAVAAUATE1USHHXGHL$L|$ HL$2.LH=&H1UHE H=t1?HE H=t 1)HE H|$DHD$H=H1HE D<`THEH\$1HH ff.L,ųDDAk<)Ak<)D ЉA1k<)։H=jEPA9tH=3EEA9shEl$H=1D2DH@HHHHu H.L @H=f.HX[]A\A]A^A_ÐUSHHH=3HH5|HE1R'Et;1t;9Ev#uH RH HU HB9EwH[]fH RH HU HzufDAVAUIATUHpSHI1HHBAN1Ƅ$uH[]A\A]A^úAH. HAAV1Iv uyAF9v0H@HL,AEu1= AEAFIv 9wH@HHDI HHtDH1[]A\A]A^1H=YH1%D"H=H1%D fAWAVAAUATL% UH- SIIL)HHHt 1LLDAHH9uH[]A\A]A^A_Ðf.f.@HQ Ht(UHSH? HHHHuH[]HHERROR: %sWARNING: %sLog size = %lld, max = %lld -%Y%m%d_%H%M%S%s -> %s -> %sLOG_AUTHLOG_AUTHPRIVLOG_CRONLOG_DAEMONLOG_FTPLOG_KERNLOG_LPRLOG_MAILLOG_NEWSLOG_SYSLOGLOG_USERLOG_UUCPLOG_LOCAL0LOG_LOCAL1LOG_LOCAL2LOG_LOCAL3LOG_LOCAL4LOG_LOCAL5LOG_LOCAL6LOG_LOCAL7WARNING: Log size limit met but log file rotation turned off. Forcing log file rotation anyways. Need to rotate log file due to size but ran out of memory. Need to rotate log file due to size but could not get local time. ERROR: Can't open %s in append mode (check permissions!). WARNING: File locking not supported (NFS?)ERROR: %s is locked by another process ERROR: optaddarg: Unregistered option %s ERROR: optaddarg: strdup() failed ERROR: optaddarg: malloc() failed ERROR: optparse: Can't register new option (not enough memory) ERROR: optparse: longopts[] is too small ERROR: optparse: shortopts[] is too small ERROR: optparse: (short|long)opts[] is too small ERROR: Please edit the example config file %s ERROR: Missing argument for option at line %d ERROR: Missing closing parenthesis in option %s at line %d ERROR: Empty argument for option %s at line %d ERROR: Incomplete option passed (missing argument) ERROR: optparse: No corresponding long name for option '-%c' ERROR: Parse error at line %d: Unknown option %s WARNING: Ignoring unsupported option %s at line %u WARNING: Ignoring unsupported option --%s (-%c) WARNING: Ignoring unsupported option --%s ERROR: Can't register argument for option %s ERROR: Can't register argument for option --%s WARNING: Ignoring deprecated option %s at line %u WARNING: Ignoring deprecated option --%s (-%c) WARNING: Ignoring deprecated option --%s ERROR: optparse: Can't compile regular expression %s for option %s ERROR: Incorrect argument format for option %s ERROR: Incorrect argument format for option --%s (-%c) ERROR: Incorrect argument format for option --%s ERROR: Option --%s (-%c) requires a non-empty string argument ERROR: Option --%s requires a non-empty string argument ERROR: Can't parse numerical argument for option %s ERROR: Can't parse numerical argument for option --%s (-%c) ERROR: Can't parse numerical argument for option --%s WARNING: Numerical value for option %s too high, resetting to 4G WARNING: Numerical value for option --%s (-%c) too high, resetting to 4G ERROR: optparse: calloc failed ERROR: optparse: strdup failed ERROR: Problem parsing options (name == NULL) Dump authenticode certificate chain.Perform HTML, script, and text normalizationAlways generate MDB entries for PE sectionsMaximum number of mismatched signatures when building a CVD. Zero disables this limit.Feature level to put in the CVDVersion number of the CVD to buildCreate a hybrid (standard and bytecode) database fileForce using the interpreter instead of the JITTrust loaded bytecode (default yes)Load and print bytecode information without executingPrint IR of bytecode signatureInput file to run the bytecode nDon't show source line during tracingName of the analyzer as seen in prewikkaSave all reports to a log file.By default the log file is locked for writing and only a single daemon process can write to it. This option disables the lock.Maximum size of the log file. Value of 0 disables the limit.Log all clean files. Useful in debugging but drastically increases the log size.Use the system logger (can work together with LogFile).Type of syslog messages. Please refer to 'man syslog' for the facility names.Rotate log file. Requires LogFileMaxSize option set prior to this option.Log additional information about the infected file, such as its size and hash, together with the virus name.Save the process ID to a file.This option allows you to change the default temporary directory.This option allows you to change the default database directory. If you enable it, please make sure it points to the same directory in both clamd and freshclam.Only load the official signatures published by the ClamAV project.By default, yara rules will be loaded. This option allows you to exclude yara rules when scanning and also to scan only using yara rules. Valid options are yes|no|onlyPath to a local socket file the daemon will listen on.Sets the group ownership on the unix socket.Sets the permissions on the unix socket to the specified mode.Remove a stale socket after unclean shutdownA TCP port number the daemon will listen on.By default clamd binds to INADDR_ANY. This option allows you to restrict the TCP address and provide some degree of protection from the outside world.Maximum length the queue of pending connections may grow to.Close the STREAM session when the data size limit is exceeded. The value should match your MTA's limit for the maximum attachment size.The STREAM command uses an FTP-like protocol. This option sets the lower boundary for the port range.This option sets the upper boundary for the port range.Maximum number of threads running at the same time.This option specifies the time (in seconds) after which clamd should timeout if a client doesn't provide any data.This option specifies the time (in seconds) after which clamd should timeout if a client doesn't provide any initial command after connecting.This option specifies how long to wait (in milliseconds) if the send buffer is full. Keep this value low to prevent clamd hanging.Waiting for data from clamd will timeout after this time (seconds).Maximum number of queued items (including those being processed by MaxThreads threads). It is recommended to have this value at least twice MaxThreads if possible. WARNING: you shouldn't increase this too much to avoid running out of file descriptors, the following condition should hold: MaxThreads*MaxRecursion + MaxQueue - MaxThreads + 6 < RLIMIT_NOFILE (usual max for RLIMIT_NOFILE is 1024) This option specifies how long (in seconds) the process should wait for a new job.Don't scan files/directories whose names match the provided regular expression. This option can be specified multiple times.Maximum depth the directories are scanned at.Follow symlinks to regular files.Scan files and directories on other filesystems.This option specifies the time intervals (in seconds) in which clamd should perform a database check.This option allows you to disable clamd's caching feature.Execute a command when a virus is found. In the command string %v will be replaced with the virus name. Additionally, two environment variables will be defined: $CLAM_VIRUSEVENT_FILENAME and $CLAM_VIRUSEVENT_VIRUSNAME./usr/bin/mailx -s "ClamAV VIRUS ALERT: %v" alert < /dev/nullStop the daemon when libclamav reports an out of memory condition.Permit use of the ALLMATCHSCAN command.Enable debug messages in libclamav.Don't remove temporary files (for debugging purposes).Run the daemon as a specified user (the process must be started by root).With this option enabled ClamAV will load bytecode from the database. It is highly recommended you keep this option on, otherwise you'll miss detections for many new viruses.Set bytecode security level. Possible values: TrustSigned - trust bytecode loaded from signed .c[lv]d files, insert runtime safety checks for bytecode loaded from other sources Paranoid - don't trust any bytecode, insert runtime checks for all Recommended: TrustSigned, because bytecode in .cvd files already has these checks.Set bytecode timeout in milliseconds.Allow loading bytecode from outside digitally signed .c[lv]d files.^(Auto|ForceJIT|ForceInterpreter|Test)$Set bytecode execution mode. Possible values: Auto - automatically choose JIT if possible, fallback to interpreter ForceJIT - always choose JIT, fail if not possible ForceInterpreter - always choose interpreter Test - run with both JIT and interpreter and compare results. Make all failures fatal.^(none|None|bytecode|Bytecode|pcre|PCRE)$Collect and print execution statistics. Possible values: Bytecode - reports bytecode statistics PCRE - reports PCRE execution statistics None - reports no statisticsDetect Potentially Unwanted Applications.Exclude a specific PUA category. This directive can be used multiple times. See https://www.clamav.net/documents/potentially-unwanted-applications-pua for the complete list of PUA categories.Only include a specific PUA category. This directive can be used multiple times.In some cases (eg. complex malware, exploits in graphic files, and others), ClamAV uses special algorithms to provide accurate detection. This option controls the algorithmic detection.PE stands for Portable Executable - it's an executable file format used in all 32- and 64-bit versions of Windows operating systems. This option allows ClamAV to perform a deeper analysis of executable files and it's also required for decompression of popular executable packers such as UPX or FSG. If you turn off this option, the original files will still be scanned, but without additional processing.Executable and Linking Format is a standard format for UN*X executables. This option allows you to control the scanning of ELF files. If you turn off this option, the original files will still be scanned, but without additional processing.With this option enabled clamav will try to detect broken executables (both PE and ELF) and mark them as Broken.Executable.Enable the built in email scanner. If you turn off this option, the original files will still be scanned, but without parsing individual messages/attachments.Scan RFC1341 messages split over many emails. You will need to periodically clean up $TemporaryDirectory/clamav-partial directory. WARNING: This option may open your system to a DoS attack. Please don't use this feature on highly loaded servers.With this option enabled ClamAV will try to detect phishing attempts by using signatures.Scan URLs found in mails for phishing attempts using heuristics.Always block cloaked URLs, even if they're not in the database. This feature can lead to false positives.PhishingAlwaysBlockSSLMismatchAlways block SSL mismatches in URLs, even if they're not in the database. This feature can lead to false positives.Detect partition intersections in raw disk images using heuristics.Allow heuristic match to take precedence. When enabled, if a heuristic scan (such as phishingScan) detects a possible virus/phish it will stop scan immediately. Recommended, saves CPU scan-time. When disabled, virus/phish detected by heuristic scans will be reported only at the end of a scan. If an archive contains both a heuristically detected virus/phish, and a real malware, the real malware will be reported. Keep this disabled if you intend to handle "*.Heuristics.*" viruses differently from "real" malware. If a non-heuristically-detected virus (signature-based) is found first, the scan is interrupted immediately, regardless of this config option.Enable the Data Loss Prevention module.This option sets the lowest number of Credit Card numbers found in a file to generate a detect.This option sets the lowest number of Social Security Numbers found in a file to generate a detect.With this option enabled the DLP module will search for valid SSNs formatted as xxx-yy-zzzz.With this option enabled the DLP module will search for valid SSNs formatted as xxxyyzzzzPerform HTML/JavaScript/ScriptEncoder normalisation and decryption. If you turn off this option, the original files will still be scanned, but without additional processing.This option enables scanning of OLE2 files, such as Microsoft Office documents and .msi files. If you turn off this option, the original files will still be scanned, but without additional processing.With this option enabled OLE2 files with VBA macros, which were not detected by signatures will be marked as "Heuristics.OLE2.ContainsMacros".This option enables scanning within PDF files. If you turn off this option, the original files will still be scanned, but without decoding and additional processing.This option enables scanning within SWF files. If you turn off this option, the original files will still be scanned, but without decoding and additional processing.This option enables scanning xml-based document files supported by libclamav. If you turn off this option, the original files will still be scanned, but without additional processing.This option enables scanning HWP3 files. If you turn off this option, the original files will still be scanned, but without additional processing.Scan within archives and compressed files. If you turn off this option, the original files will still be scanned, but without unpacking and additional processing.Mark encrypted archives as viruses (Encrypted.Zip, Encrypted.RAR).This option causes memory or nested map scans to dump the content to disk. If you turn on this option, more data is written to disk and is available when the leave-temps option is enabled at the cost of more disk writes.This option sets the maximum amount of data to be scanned for each input file. Archives and other containers are recursively extracted and scanned up to this value. The value of 0 disables the limit. WARNING: disabling this limit or setting it too high may result in severe damage.Files/messages larger than this limit won't be scanned. Affects the input file itself as well as files contained inside it (when the input file is an archive, a document or some other kind of container). The value of 0 disables the limit. WARNING: disabling this limit or setting it too high may result in severe damage to the system.Nested archives are scanned recursively, e.g. if a Zip archive contains a RAR file, all files within it will also be scanned. This option specifies how deeply the process should be continued. The value of 0 disables the limit. WARNING: disabling this limit or setting it too high may result in severe damage to the system.Number of files to be scanned within an archive, a document, or any other container file. The value of 0 disables the limit. WARNING: disabling this limit or setting it too high may result in severe damage to the system.This option sets the maximum size of a file to check for embedded PE. Files larger than this value will skip the additional analysis step. Negative values are not allowed. WARNING: setting this limit too high may result in severe damage or impact performance.This option sets the maximum size of a HTML file to normalize. HTML files larger than this value will not be normalized or scanned. Negative values are not allowed. WARNING: setting this limit too high may result in severe damage or impact performance.This option sets the maximum size of a normalized HTML file to scan. HTML files larger than this value after normalization will not be scanned. Negative values are not allowed. WARNING: setting this limit too high may result in severe damage or impact performance.This option sets the maximum size of a script file to normalize. Script content larger than this value will not be normalized or scanned. Negative values are not allowed. WARNING: setting this limit too high may result in severe damage or impact performance.This option sets the maximum size of a ZIP file to reanalyze type recognition. ZIP files larger than this value will skip the step to potentially reanalyze as PE. Negative values are not allowed. WARNING: setting this limit too high may result in severe damage or impact performance.This option sets the maximum number of partitions of a raw disk image to be scanned. Raw disk images with more partitions than this value will have up to the value number partitions scanned. Negative values are not allowed. WARNING: setting this limit too high may result in severe damage or impact performance.This option sets the maximum number of icons within a PE to be scanned. PE files with more icons than this value will have up to the value number icons scanned. Negative values are not allowed. WARNING: setting this limit too high may result in severe damage or impact performance.This option sets the maximum recursive calls to HWP3 parsing function. HWP3 files using more than this limit will be terminated and alert the user. Scans will be unable to scan any HWP3 attachments if the recursive limit is reached. Negative values are not allowed. WARNING: setting this limit too high may result in severe damage or impact performance.This clamscan option is currently for testing only. It sets the engine parameter CL_ENGINE_TIME_LIMIT. The value is in milliseconds.This option sets the maximum calls to the PCRE match function during an instance of regex matching. Instances using more than this limit will be terminated and alert the user but the scan will continue. For more information on match_limit, see the PCRE documentation. Negative values are not allowed. WARNING: setting this limit too high may severely impact performance.This option sets the maximum recursive calls to the PCRE match function during an instance of regex matching. Instances using more than this limit will be terminated and alert the user but the scan will continue. For more information on match_limit_recursion, see the PCRE documentation. Negative values are not allowed and values > PCREMatchLimit are superfluous. WARNING: setting this limit too high may severely impact performance.This option sets the maximum filesize for which PCRE subsigs will be executed. Files exceeding this limit will not have PCRE subsigs executed unless a subsig is encompassed to a smaller buffer. Negative values are not allowed. Setting this value to zero disables the limit. WARNING: setting this limit too high or disabling it may severely impact performance.This option enables on-access scanning (Linux only)This option specifies a directory or mount point which should be scanned on access. The mount point specified, or the mount point containing the specified directory will be watched, but only notifications will occur. If any directories are specified, this option will preempt the DDD system. It can also be used multiple times.This option specifies a directory (including all files and directories inside it), which should be scanned on access. This option can be used multiple times.This option allows excluding directories from on-access scanning. It can be used multiple times. Only works with DDD system.Use this option to whitelist the root UID (0) and allow any processes run under root to access all watched files without triggering scans.With this option you can whitelist specific UIDs. Processes with these UIDs will be able to access all files. This option can be used multiple times (one per line). Using a value of 0 on any line will disable this option entirely. To whitelist the root UID please enable the OnAccessExcludeRootUID option.Files larger than this value will not be scanned in on access.This option toggles the dynamic directory determination system for on-access scanning (Linux only).This option changes fanotify behavior to prevent access attempts on malicious files instead of simply notifying the user (On Access scan only).Enables extra scanning and notification after catching certain inotify events. Only works with the DDD system enabled.When started by root freshclam will drop privileges and switch to the user defined in this option.This option defined how many times daily freshclam should check for a database update.Use DNS to verify the virus database version. Freshclam uses DNS TXT records to verify the versions of the database and software itself. With this directive you can change the database verification domain. WARNING: Please don't change it unless you're configuring freshclam to use your own database verification domain.DatabaseMirror specifies to which mirror(s) freshclam should connect. You should have at least two entries: db.XY.clamav.net (or db.XY.ipv6.clamav.net for IPv6) and database.clamav.net (in this order). Please replace XY with your country code (see https://www.iana.org/domains/root/db). database.clamav.net is a round-robin record which points to our most reliable mirrors. It's used as a fall back in case db.XY.clamav.net is not working.db.XY.clamav.net database.clamav.netThis option allows you to easily point freshclam to private mirrors. If PrivateMirror is set, freshclam does not attempt to use DNS to determine whether its databases are out-of-date, instead it will use the If-Modified-Since request or directly check the headers of the remote database files. For each database, freshclam first attempts to download the CLD file. If that fails, it tries to download the CVD file. This option overrides DatabaseMirror, DNSDatabaseInfo and Scripted Updates. It can be used multiple times to provide fall-back mirrors.mirror1.mynetwork.com mirror2.mynetwork.comThis option defines how many attempts freshclam should make before giving up.With this option you can control scripted updates. It's highly recommended to keep them enabled.With this option enabled, freshclam will attempt to load new databases into memory to make sure they are properly handled by libclamav before replacing the old ones.By default freshclam will keep the local databases (.cld) uncompressed to make their handling faster. With this option you can enable the compression. The change will take effect with the next database update.Download an additional 3rd party signature database distributed through the ClamAV mirrors. This option can be used multiple times.With this option you can provide custom sources (http:// or file://) for database files. This option can be used multiple times.http://myserver.com/mysigs.ndb file:///mnt/nfs/local.hdbIf you're behind a proxy, please enter its address here.A user name for the HTTP proxy authentication.A password for the HTTP proxy authentication.If your servers are behind a firewall/proxy which does a User-Agent filtering you can use this option to force the use of a different User-Agent header.Send the RELOAD command to clamd after a successful update.Run a command after a successful database update.Run a command when a database update error occurs.Run a command when freshclam reports an outdated version. In the command string %v will be replaced with the new version number.With this option you can provide a client address for the database downloading. Useful for multi-homed systems.Timeout in seconds when connecting to database server.Timeout in seconds when reading from database server.This option enables support for Google Safe Browsing. When activated for the first time, freshclam will download a new database file (safebrowsing.cvd) which will be automatically loaded by clamd and clamscan during the next reload, provided that the heuristic phishing detection is turned on. This database includes information about websites that may be phishing sites or possible sources of malware. When using this option, it's mandatory to run freshclam at least every 30 minutes. Freshclam uses the ClamAV's mirror infrastructure to distribute the database and its updates but all the contents are provided under Google's terms of use. See https://transparencyreport.google.com/safe-browsing/overview and https://www.clamav.net/documents/safebrowsing for more information.This option enables downloading of bytecode.cvd, which includes additional detection mechanisms and improvements to the ClamAV engine.Disable authenticode certificate chain verification in PE files.Initialize a supplementary group access (the process must be started by root).Define the clamd socket to connect to for scanning. This option is mandatory! Syntax: ClamdSocket unix:path ClamdSocket tcp:host:port The first syntax specifies a local unix socket (needs an absolute path) e.g.: ClamdSocket unix:/var/run/clamd/clamd.socket The second syntax specifies a tcp local or remote tcp socket: the host can be a hostname or an ip address; the ":port" field is only required for IPv6 addresses, otherwise it defaults to 3310 ClamdSocket tcp:192.168.0.1 This option can be repeated several times with different sockets or even with the same socket: clamd servers will be selected in a round-robin fashion.Define the interface through which we communicate with sendmail. This option is mandatory! Possible formats are: [[unix|local]:]/path/to/file - to specify a unix domain socket; inet:port@[hostname|ip-address] - to specify an ipv4 socket; inet6:port@[hostname|ip-address] - to specify an ipv6 socket./tmp/clamav-milter.socket inet:7357Define the group ownership for the (unix) milter socket.Sets the permissions on the (unix) milter socket to the specified mode.Messages originating from these hosts/networks will not be scanned This option takes a host(name)/mask pair in CIRD notation and can be repeated several times. If "/mask" is omitted, a host is assumed. To specify a locally originated, non-smtp, email use the keyword "local".local 192.168.0.0/24 1111:2222:3333::/48^(Accept|Reject|Defer|Blackhole|Quarantine)$Action to be performed on clean messages (mostly useful for testing). The following actions are available: Accept: the message is accepted for delivery Reject: immediately refuse delivery (a 5xx error is returned to the peer) Defer: return a temporary failure message (4xx) to the peer Blackhole: like Accept but the message is sent to oblivion Quarantine: like Accept but message is quarantined instead of being deliveredAction to be performed on error conditions (this includes failure to allocate data structures, no scanners available, network timeouts, unknown scanner replies and the like. The following actions are available: Accept: the message is accepted for delivery; Reject: immediately refuse delivery (a 5xx error is returned to the peer); Defer: return a temporary failure message (4xx) to the peer.This option allows you to set a specific rejection reason for infected messages and it's therefore only useful together with "OnInfected Reject" The string "%v", if present, will be replaced with the virus name.If this option is set to "Replace" (or "Yes"), an "X-Virus-Scanned" and an "X-Virus-Status" headers will be attached to each processed message, possibly replacing existing headers. If it is set to Add, the X-Virus headers are added possibly on top of the existing ones. Note that while "Replace" can potentially break DKIM signatures, "Add" may confuse procmail and similar filters.When AddHeader is in use, this option allows you to set the reported hostname. This may be desirable in order to avoid leaking internal names. If unset the real machine name is used.Execute a command when an infected message is processed. The following parameters are passed to the invoked program in this order: virus name, queue id, sender, destination, subject, message id, message date. Note #1: this requires MTA macroes to be available (see LogInfected below) Note #2: the process is invoked in the context of clamav-milter Note #3: clamav-milter will wait for the process to exit. Be quick or fork to avoid unnecessary delays in email delivery/usr/local/bin/my_infected_message_handlerChroot to the specified directory. Chrooting is performed just after reading the config file and before dropping privileges.This option specifies a file which contains a list of basic POSIX regular expressions. Addresses (sent to or from - see below) matching these regexes will not be scanned. Optionally each line can start with the string "From:" or "To:" (note: no whitespace after the colon) indicating if it is, respectively, the sender or recipient that is to be whitelisted. If the field is missing, "To:" is assumed. Lines starting with #, : or ! are ignored.Messages from authenticated SMTP users matching this extended POSIX regular expression (egrep-like) will not be scanned. As an alternative, a file containing a plain (not regex) list of names (one per line) can be specified using the prefix "file:". e.g. SkipAuthenticated file:/etc/good_guys Note: this is the AUTH login name!SkipAuthenticated ^(tom|dick|henry)$This option allows you to tune what is logged when a message is infected. Possible values are Off (the default - nothing is logged), Basic (minimal info logged), Full (verbose info logged) Note: For this to work properly in sendmail, make sure the msg_id, mail_addr, rcpt_addr and i macroes are available in eom. In other words add a line like: Milter.macros.eom={msg_id}, {mail_addr}, {rcpt_addr}, i to your .cf file. Alternatively use the macro: define(`confMILTER_MACROS_EOM', `{msg_id}, {mail_addr}, {rcpt_addr}, i') Postfix should be working fine with the default settings.This option allows you to tune what is logged when no threat is found in a scanned message. See LogInfected for possible values and caveats. Useful in debugging but drastically increases the log size.This option affects the behaviour of LogInfected, LogClean and VirusAction when a message with multiple recipients is scanned: If SupportMultipleRecipients is off (the default) then one single log entry is generated for the message and, in case the message is determined to be malicious, the command indicated by VirusAction is executed just once. In both cases only the last recipient is reported. If SupportMultipleRecipients is on: then one line is logged for each recipient and the command indicated by VirusAction is also executed once for each recipient. Note: although it's probably a good idea to enable this option, the default value is currently set to off for legacy reasons.yesExampleERROR: Unknown option passed footruehelp^(yes|true|1|no|false|0)$config-file/etc/clamd.conf/etc/freshclam.conf/etc/clamav-milter.confdebuggen-jsondumpcertsquietleave-tempsno-warningsshow-progressstdoutdaemonno-dnslist-mirrorsupdate-dbreloadmultiscanfdpassstreamallmatchdatabase/usr/share/clamavrecursivegen-mdbfollow-dir-symlinks^[0-9]+$follow-file-symlinksbellno-summaryfile-listinfectedsuppress-ok-resultscopyremoveexcludeexclude-dirinclude-dirstructured-ssn-formathex-dumpmd5sha1sha256impprint-certshtml-normaliseascii-normaliseutf16-decodebuildmax-bad-sigs3000flevelcvd-versionno-cdiffserverunpackunpack-currentlist-sigsfind-sigsdecode-sigstest-sigsvbavba-hexcomparerun-cdiffverify-cdiffhybriddefaultcolorsconfig-dir/etcnon-defaultgenerate-configforce-interpretertrust-bytecodeprintsrcPrint source code of bytecodeprintbcirinputtracebytecode trace levelno-trace-showsourcearchive-verbosebytecode-trust-allhttp-proxyproxy-userlog-verboseforcedisable-summarydisable-archiveno-archiveno-peno-elfno-ole2no-pdfno-htmlno-mailno-phishing-sigsno-phishing-scan-urlsno-algorithmicno-phishing-restrictedscanmax-ratiomax-space^[0-9]+[KM]?$unzipunrararjunzoolhajartartgzdebblock-maxPreludeEnableprelude-enableEnable preludePreludeAnalyzerNameprelude-analyzer-name/tmp/clamav.logLogFileUnlockLogFileMaxSizeLogTimeLog time with each message.LogCleanLogSyslogLogFacilityLogVerboseEnable verbose logging.LogRotatelog-rotateExtendedDetectionInfoPidFile/var/run/clam.pidTemporaryDirectorytempdir/tmpDatabaseDirectorydatadir/var/lib/clamavOfficialDatabaseOnlyofficial-db-onlynoYaraRulesyara-rulesLocalSocket/tmp/clamd.socketLocalSocketGroupvirusgroupLocalSocketMode660FixStaleSocketTCPSocket3310TCPAddr127.0.0.1MaxConnectionQueueLength30StreamMaxLength25MStreamMinPort1024StreamMaxPort2048MaxThreads120CommandReadTimeoutSendBufTimeout300MaxQueueIdleTimeout^/proc/ ^/sys/MaxDirectoryRecursionmax-dir-recursion15FollowDirectorySymlinksFollow directory symlinks.FollowFileSymlinksCrossFilesystemscross-fsSelfCheck600DisableCachedisable-cacheVirusEventExitOnOOMAllowAllMatchScanForegroundDon't fork into background.DebugLeaveTemporaryFilesUserBytecodeBytecodeSecurity^(TrustSigned|Paranoid)$TrustSignedBytecodeTimeoutbytecode-timeout5000BytecodeUnsignedbytecode-unsignedBytecodeModebytecode-modeAutoStatisticsstatisticsNoneDetectPUAdetect-puaExcludePUAexclude-puaNetTool PWToolIncludePUAinclude-puaSpy Scanner RATAlgorithmicDetectionalgorithmic-detectionScanPEscan-peScanELFscan-elfDetectBrokenExecutablesdetect-brokenScanMailscan-mailScanPartialMessagesPhishingSignaturesPhishingScanURLsPhishingAlwaysBlockCloakphishing-cloakphishing-sslPartitionIntersectionpartition-intersectionHeuristicScanPrecedenceheuristic-scan-precedenceStructuredDataDetectiondetect-structuredStructuredMinCreditCardCountstructured-cc-countStructuredMinSSNCountstructured-ssn-countStructuredSSNFormatNormalStructuredSSNFormatStrippedScanHTMLscan-htmlScanOLE2scan-ole2OLE2BlockMacrosblock-macrosScanPDFscan-pdfScanSWFscan-swfScanXMLDOCSscan-xmldocsScanHWP3scan-hwp3ScanArchivescan-archiveArchiveBlockEncryptedblock-encryptedForceToDiskforce-to-diskmax-scansize100Mmax-recursion16max-files10000MaxEmbeddedPEmax-embeddedpe10MMaxHTMLNormalizemax-htmlnormalizeMaxHTMLNoTagsmax-htmlnotags2MMaxScriptNormalizemax-scriptnormalizeMaxZipTypeRcgmax-ziptypercg1MMaxPartitionsmax-partitions128MaxIconsPEmax-iconspe100MaxRecHWP3max-rechwp3TimeLimittimelimitPCREMatchLimitpcre-match-limit100000PCRERecMatchLimitpcre-recmatch-limitPCREMaxFileSizepcre-max-filesizeOnAccessMountPath/ /home/userOnAccessIncludePathon-access-include/home /studentsOnAccessExcludePath/home/bofh /rootOnAccessExcludeRootUIDOnAccessExcludeUIDOnAccessMaxFileSizeOnAccessDisableDDDdisable-dddOnAccessPreventionOnAccessExtraScanningDevACOnlydev-ac-onlyDevACDepthdev-ac-depthDevPerformancedev-performanceDevLiblogdev-liblogUpdateLogFile/var/log/freshclam.logDatabaseOwnerCheckschecksDNSDatabaseInfocurrent.cvd.clamav.netDatabaseMirrorPrivateMirrorMaxAttemptsScriptedUpdatesTestDatabasesCompressLocalDatabaseExtraDatabasedbname1 dbname2DatabaseCustomURLHTTPProxyServeryour-proxyHTTPProxyPortHTTP proxy's port8080HTTPProxyUsernameusernameHTTPProxyPasswordHTTPUserAgentNotifyClamddaemon-notifyOnUpdateExecuteon-update-executecommandOnErrorExecuteon-error-executeOnOutdatedExecuteon-outdated-executeLocalIPAddresslocal-addressaaa.bbb.ccc.dddConnectTimeoutReceiveTimeoutSafeBrowsingDisableCertChecknocertsMailMaxRecursionArchiveMaxScanSizeArchiveMaxRecursionArchiveMaxFilesArchiveMaxCompressionRatioArchiveBlockMaxArchiveLimitMemoryUsageMailFollowURLsmail-follow-urlsClamukoScanOnAccessClamukoScannerCountClamukoScanOnOpenClamukoScanOnCloseClamukoScanOnExecClamukoIncludePathClamukoExcludePathClamukoExcludeUIDClamukoMaxFileSizeAllowSupplementaryGroupsClamdSockettcp:scanner.mydomain:7357MilterSocketMilterSocketGroupMilterSocketModeLocalNetOnCleanAcceptOnInfectedQuarantineOnFail^(Accept|Reject|Defer)$DeferRejectMsgMTA specificAddHeader^(No|Replace|Yes|Add)$ReplaceReportHostnamemy.mail.server.nameVirusActionChroot/newrootWhitelist/etc/whitelisted_addressesSkipAuthenticatedLogInfectedBasicSupportMultipleRecipientsPOSIXLY_CORRECT%s: illegal option -- %c %s: unrecognized option `%s' %s: option `%s' is ambiguous %s: option requires an argument -- %c %s: option `--%s' doesn't allow an argument %s: option `--%s' requires an argument 0.100.2%s/daily.cvd%s/daily.cldClamAV %s ClamAV %s/%u/%s/dev/nullCan't open /dev/null dup2(%d, %d) failed %s/Unable to allocate memory for db directory... ERROR: This tool requires libclamav with functionality level %u or higher (current f-level: %u) ERROR: --file-list: Can't open file %s !cdiff_cmd_close: No database to close !cdiff_cmd_close: Can't open file %s for reading !cdiff_cmd_close: Can't generate temporary name !cdiff_cmd_close: Can't open file %s for writing !cdiff_cmd_close: Can't apply DEL at line %d of %s !cdiff_cmd_close: Can't apply XCHG at line %d of %s !cdiff_cmd_close: Can't write to %s !cdiff_cmd_close: Not all DEL/XCHG have been executed !cdiff_cmd_close: Can't unlink %s !cdiff_cmd_close: Can't rename %s to %s !cdiff_cmd_close: Can't open file %s for appending !cdiff_apply: Problem parsing line !cdiff_apply: Unknown command %s !cdiff_apply: Not enough arguments for %s !cdiff_apply: Can't execute command %s !cdiff_cmd_unlink: Database %s is still open !cdiff_cmd_unlink: Can't get first argument !cdiff_cmd_unlink: Forbidden characters found in database name !cdiff_cmd_unlink: Can't unlink %s !cdiff_cmd_move: Database %s is still open !cdiff_cmd_move: Can't get third argument !cdiff_cmd_move: Can't get fifth argument !cdiff_cmd_move: end_line < start_line !cdiff_cmd_move: Can't get fourth argument !cdiff_cmd_move: Can't get sixth argument !cdiff_cmd_move: Can't get first argument !cdiff_cmd_move: Can't open %s for reading !cdiff_cmd_move: Can't get second argument !cdiff_cmd_move: Can't open %s for appending !cdiff_cmd_move: Can't generate temporary name !cdiff_cmd_move: Can't open file %s for writing !cdiff_cmd_close: Can't apply MOVE due to conflict at line %d !cdiff_cmd_move: Can't write to %s !cdiff_cmd_move: No data was moved from %s to %s !cdiff_cmd_move: Can't unlink %s !cdiff_cmd_move: Can't rename %s to %s !cdiff_cmd_xchg: Can't get first argument !cdiff_cmd_xchg: Can't get second argument !cdiff_cmd_xchg: Can't allocate memory for cdiff_node !cdiff_cmd_del: Can't get first argument !cdiff_cmd_del: Can't get second argument !cdiff_cmd_del: Can't allocate memory for cdiff_node !cdiff_cmd_add: Can't get first argument !cdiff_cmd_add: Can't allocate memory for cdiff_node !cdiff_cmd_open: Can't get first argument !cdiff_cmd_open: %s not closed before opening %s !cdiff_cmd_open: Forbidden characters found in database name !cdiff_apply: Can't duplicate descriptor %d !cdiff_apply: Can't allocate memory for 'line' !cdiff_apply: Can't allocate memory for 'lbuf' !cdiff_apply: lseek(desc, %d, SEEK_END) failed !cdiff_apply: Can't read %d bytes !cdiff_apply: No digital signature in cdiff file !cdiff_apply: Can't fstat file !cdiff_apply: compressed data end offset < 0 !cdiff_apply: lseek(desc, 0, SEEK_SET) failed 14783905874077467090262228516557917570254599638376203532031989214105552847269687489771975792123442185817287694951949800908791527542017115600501303394778618535864845235700041590056318230102449612217458549016089313306591388590790796515819654102320725712300822356348724011232654837503241736177907784198700834440681124727060540035754699658105895050096576226753008596881698828185652424901921668758326578462003247906470982092298106789657211905488986281078346361469524484829559560886227198091995498440676639639830463593211386055065360288422394053998134458623712540683294034953818412458362198117811990006021989844180721010947!cdiff_apply: Incorrect digital signature !cdiff_apply: Incorrect file format !cdiff_apply: Can't gzdopen descriptor %d !cdiff_apply: Premature EOF at line %d ^cdiff_apply: Ignoring new buffer size request - invalid size %d !cdiff_apply: Can't resize line buffer to %d bytes !cdiff_apply: Error executing command at line %d !cdiff_apply: fdopen() failed for descriptor %d *cdiff_apply: File %s was not properly closed *cdiff_apply: Parsed %d lines and executed %d commands rbwbabOPEN/\100002053ClamAV-Diff:%*u:%u:#LSIZE#LSIZE %uADDDELXCHGCLOSEMOVEUNLINK%o%06o!Can't send to clamd: %s UNKNOWN COMMAND !Communication error !Overlong reply from clamd !Command rejected by clamd (wrong clamd version?) ^[LibClamAV] %s~[LibClamAV] %s*[LibClamAV] %s*Max retries == %d Giving up on %s... Trying again in 5 secs... Update process terminated freshclam [options] --foreground-F^initgroups() failed. ^setgid(%d) failed. ^setuid(%d) failed. freshclam!Can't change dir to %s !getcwd() failed *Current working dir is %s Can't read mirrors.dat!strdup() failed !calloc() failed !daemonize() failed wReceived signal: wake up noneHostID is valid: %s ^You must specify at least one database mirror in %s Update failed. Your network may be down or none of the mirrors listed in %s is working. Check https://www.clamav.net/documents/official-mirror-faq for possible reasons. !Can't initialize libclamav: %s !Can't parse command line options Clam AntiVirus: Database Updater %s By The ClamAV Team: https://www.clamav.net/about.html#credits (C) 2007-2018 Cisco Systems, Inc. --help -h Show this help --version -V Print version number and exit --verbose -v Be verbose --debug Enable debug messages --quiet Only output error messages --no-warnings Don't print and log warnings --stdout Write to stdout instead of stderr --show-progress Show download progress percentage --config-file=FILE Read configuration from FILE. --log=FILE -l FILE Log into FILE --daemon -d Run in daemon mode --pid=FILE -p FILE Save daemon's pid in FILE --user=USER -u USER Run as USER --no-dns Force old non-DNS verification method --checks=#n -c #n Number of checks per day, 1 <= n <= 50 --datadir=DIRECTORY Download new databases into DIRECTORY --daemon-notify[=/path/clamd.conf] Send RELOAD command to clamd --local-address=IP -a IP Bind to IP for HTTP downloads --on-update-execute=COMMAND Execute COMMAND after successful update --on-error-execute=COMMAND Execute COMMAND if errors occurred --on-outdated-execute=COMMAND Execute COMMAND when software is outdated --list-mirrors Print mirrors from mirrors.dat --update-db=DBNAME Only update database DBNAME ERROR: Can't open/parse the config file %s ^Can't stat %s (critical error) ^Insecure permissions (for HTTPProxyPassword): %s must have no more than 0700 permissions. ^Can't get information about user %s. #-------------------------------------- !Problem with internal logger (UpdateLogFile = %s). !LogFacility: %s: No such facility. !PrivateMirror: *.clamav.net is not allowed in this mode ^Number of checks must be a positive integer. ^Number of checks must be between 1 and 50. !Can't save PID to file %s: %s #freshclam daemon %s (OS: linux-gnu, ARCH: x86_64, CPU: x86_64) Received signal: re-opening log file !proxyauth: Can't allocate memory for 'userpass' !proxyauth: Can't allocate memory for 'buf' !proxyauth: Can't allocate memory for 'authorization' Proxy-Authorization: Basic %s %cCan't get information about %s: %s *Ignoring mirror %s (due to previous errors) *Ignoring mirror %s (has connected too many times with an outdated version) !Could not resolve local ip address '%s': %s ^Using standard local ip address and port for fetching. !Could not bind to local ip address '%s': %s Can't connect to port %d of host %s (IP: %s) !Failed to load new database: %s !Failed to compile/load bytecode: %s *Properly loaded %u signatures from new %s !During database load : %s%s%s ^Database load exited with status %d ^Database successfully loaded, but there is stderr output !Database load killed by signal %d ^Unknown status from wait: %d !remote_cvdhead: Can't allocate memory for 'remotename' !remote_cvdhead: Can't parse file %s *Assuming modification time in the past ClamAV/%s (OS: linux-gnu, ARCH: x86_64, CPU: x86_64)GET %s/%s HTTP/1.0 Host: %s %sUser-Agent: %s Connection: close Range: bytes=0-511 If-Modified-Since: %s *Trying to retrieve CVD header of http://%s/%s %cremote_cvdhead: write failed %cremote_cvdhead: Error while reading CVD header from %s %c%s not found on remote server %cremote_cvdhead: Unknown response from %s (IP: %s): %s %cremote_cvdhead: Unknown response from %s (IP: %s) %cremote_cvdhead: Malformed CVD header (too short) %cremote_cvdhead: Malformed CVD header (bad chars) %cremote_cvdhead: Malformed CVD header (can't parse) !getfile: Can't allocate memory for 'remotename' *Trying to download http://%s/%s *Trying to download http://%s/%s (IP: %s) %cgetfile: Can't write to socket %cgetfile: Error while reading database from %s: %s %cgetfile: Error while reading database from %s (IP: %s): %s ^getfile: %s not found on %s (IP: %s) %cgetfile: Unknown response from %s: %s %cgetfile: Unknown response from %s (IP: %s): %s %cgetfile: Unknown response from %s %cgetfile: Unknown response from %s (IP: %s) !getfile: Can't create new file %s in %s !getfile: Can't create new file %s in the current directory Hint: The database directory must be writable for UID %d or GID %d getfile: Can't write %d bytes to %s %cgetfile: Download interrupted: %s (Host: %s) %cgetfile: Download interrupted: %s (IP: %s) GET %s/%s HTTP/1.0 Host: %s %sUser-Agent: %s Connection: close %s%s%s !Can't allocate memory for filename! !Can't read CVD header of new %s database. ^Mirror %s is not synchronized. ^Mirror is more than 1 version out of date. Recording mirror failure. !updatedb: Unknown database name (%s) passed. ^Broken database version in TXT record. ^Invalid DNS reply. Falling back to HTTP mode. ^DNS record is older than 3 hours. ^No timestamp in TXT record for %s ^Broken database version in TXT record for %s HTTPProxyUsername requires HTTPProxyPassword %s is up to date (version: %d, sigs: %d, f-level: %d, builder: %s) %s.%u.%u.%u.%u.%s.ping.clamav.net^Can't read %s header from %s ^Can't read %s header from %s (IP: %s) ^Current functionality level = %d, recommended = %d Please check if ClamAV tools are linked against the proper version of libclamav DON'T PANIC! Read https://www.clamav.net/documents/installing-clamav !getpatch: Can't get path of current working directory !chdir_tmp: dbname parameter value too long to create cvd file name: %s !chdir_tmp: dbname parameter value too long to create cld file name: %s !chdir_tmp: Can't access local %s database !chdir_tmp: Can't create directory %s !chdir_tmp: Can't unpack %s into %s !chdir_tmp: Can't change directory to %s Empty script %s, need to download entire database %cgetpatch: Can't download %s from %s !getpatch: Can't open %s for reading ^Incremental update failed, trying to download %s !buildcld: Can't get path of current working directory !buildcld: Can't access directory %s !buildcld: Can't open %s for writing !buildcld: Can't open directory %s !buildcld: gzopen() failed for %s !buildcld: COPYING file not found !buildcld: Can't add COPYING to new %s.cld - please check if there is enough disk space available Updates to main.cvd or safebrowsing.cvd may require 200MB of disk space or more !buildcld: Can't add %s to new %s.cld - please check if there is enough disk space available !buildcld: Can't add daily.cfg to new %s.cld - please check if there is enough disk space available !buildcld: gzclose() failed for %s !buildcld: close() failed for %s !buildcld: Can't return to previous directory %s ^Can't unlink the old database file %s. Please remove it manually. %s updated (version: %d, sigs: %d, f-level: %d, builder: %s) ^Your ClamAV installation is OUTDATED! !Can't create temporary directory %s ClamAV update process started at %s*Software version from DNS: %s ^Local version: %s Recommended version: %s DON'T PANIC! Read https://www.clamav.net/documents/upgrading-clamav !DatabaseCustomURL: URL must be shorter than %llu !DatabaseCustomURL: Incorrect URL DatabaseCustomURL: Incorrect URL %s is up to date (version: custom database) DatabaseCustomURL: file %s missing DatabaseCustomURL: Can't copy file %s into database directory !DatabaseCustomURL: Not supported protocol %s updated (version: custom database, sigs: %u) !--update-db=custom requires DatabaseCustomURL ^SafeBrowsing is disabled but can't remove old %s ^Bytecode is disabled but can't remove old %s !checkdbdir: Can't open directory %s !Corrupted database file %s: %s !Can't remove broken database file %s, please delete it manually and restart freshclam Corrupted database file renamed to %s Database updated (%d signatures) from %s Database updated (%d signatures) from %s (IP: %s) !downloadmanager: OnOutdatedExecute: Incorrect version number string !downloadmanager: Can't allocate memory for buffer %s:%sTCPwebcache%cinet_ntop() failed Trying host %s (%s)... !Can't create new socket: %s ^Using default client ip. *Using ip '%s' for fetching. *Loading signatures from %s [...] ^pipe() failed: %s ^dup2() failed: %s ^fork() failed: %s LibClamAV Warning:*%s^waitpid() failed: %s gmtime: %s %a, %d %b %Y %X GMThttp://%s*If-Modified-Since: %s Reading CVD header (%s): *Connected to %s. *Connected to %s (IP: %s). HTTP/1.1 404HTTP/1.0 404HTTP/1.1 304HTTP/1.0 304OK (IMS) HTTP/1.1 200HTTP/1.0 200HTTP/1.1 206HTTP/1.0 206HTTP/1.0 HTTP/1.1 OK If-Modified-Since: ^getfile: %s not found on %s Content-Length:Downloading %s [%3i%%] |/-\Downloading %s [%c] Downloading %s [100%%] Downloading %s [*] *Retrieving http://%s/%s %cCan't download %s from %s !Can't rename %s to %s: %s !Verification: %s %s.cvd%s.cldmaindailysafebrowsing*%s version from DNS: %d %s.cvd.clamav.nethttp://Connecting via %s !Can't chdir to %s %s-%d.cdiff!getpatch: Can't apply patch !getpatch: Can't chdir to %s %s.info!buildcld: Can't open %s !buildcld: Can't read %s !buildcld: Bad format of %s !buildcld: Can't write to %s ab9fCOPYINGdaily.cfg!Can't parse new database %s !Failed to load new database !Can't create local database safebrowsing.cldsafebrowsing.cvdbytecode.cldbytecode.cvd*Using IPv6 aware code *TTL: %d develbetafile://%s%s.cbccustom*%s removed %s/%s%s.broken0123456789.%v0123456789ABCDEFBlocalhostRELOADRELOADING!%s: Can't find or parse configuration file %s ^Clamd was NOT notified: Can't create socket endpoint for %s: %s ^Clamd was NOT notified: Can't connect to clamd through %s: %s !%s: Can't resolve hostname %s (%s) !%s: Can't create TCP socket to connect to %s: %s !%s: Can't connect to clamd on %s:%s: %s !%s: No communication socket specified in %s !NotifyClamd: Could not write to clamd socket: %s !NotifyClamd: Unknown answer from clamd: '%s' Clamd successfully notified about the update. ^res_init failed *Querying %s %cCan't query %s ^dn_expand failed ^Bad (too short) DNS reply ^Broken DNS reply. ^second dn_expand failed ^DNS rr overflow ^Not a TXT record ^Broken TXT record (txtlen = %d, size = %d) EXIT_%d*%s: EXIT_%d %s: system(%s) failed ^%s: couldn't execute "%s". ^%s::fork() failed, %s. ^%s: already %d processes active. connect_error: getsockopt(SO_ERROR): fd=%d error=%d: %s nonblock_fcntl: saving: fcntl(%d, F_GETFL): errno=%d: %s nonblock_fcntl: fcntl(%d, F_SETFL, O_NONBLOCK): errno=%d: %s restore_fcntl: restoring: fcntl(%d, F_SETFL): errno=%d: %s nonblock_connect: connect(): fd=%d errno=%d: %s nonblock_connect: connect timing out (%d secs) nonblock_connect: select() failure %d: errno=%d: %s nonblock_connect: giving up due to excessive bogus loops nonblock_recv: recv timing out (%d secs) nonblock_recv: select() failure %d: errno=%d: %s nonblock_recv: giving up due to excessive bogus loops !Can't allocate memory for new element in mdat->mirtab !Can't allocate memory for mdat->mirtab Ignore: Yes, %d hours %d minutes %d seconds remaining. -------------------------------------*Whitelisting %s blacklisted mirrors ^Removing broken %s file. Mirror #%u IP: %s Successes: %u Failures: %u Last access: %sIgnore: Noshort-term!Can't open %s for writing !Can't write to %s ;R,1:LIJ \O\O|lS|\\T\],_`4,al bq,wl{t ,\,<|,܉D <  T l T l 4 \l L ܨ \ $<ܯ4|L,t<ܳd,<\T,$L<| d,, d",&4\&T')$)< *T+,-4<.|zRx F*zRx $@. FJ w?;*3$"LDGBBB B(A0A8Jb 8A0A(B BBBH K7Hb F LLBBB B(A0A8G 8A0A(B BBBE LO BBB B(A0A8G  8D0A(B BBBG 4TXXbBDH A ABF AFB4XeFAJ } CAF DDA<XBBD A(J0h (A ABBG dXZBBE B(D0A8RP 8A0A(B BBBH L 8C0A(B BBBA 4l[eFAJ } CAF DDA,[KAD AB\h\BBE B(D0A8J,,D,X,C, 8D0A(B BBBA 4kBBE B(D0A8IGUBW 8C0A(B BBBA n 8C0A(B BBBA U 8A0A(B BBBA dp4BBE B(D0A8N@ 8A0A(B BBBI D 8F0A(B BBBE |,ptBBE B(H0A8J^ 8A0A(B BBBJ J 8D0A(B BBBI v 8G0D(B BBBE zxz pzlhz0BBB B(A0A8D@IHKPYHA@| 8A0A(B BBBF  8D0A(B BBBO Td(|BBB A(D0D@ 0D(A BBBM k 0A(A BBBE }@D{<}HAA h ABK  HBK 8L,0BBH A(H@/ (F ABBA B (C ABBA D|BAF MX  CABD X  EABH  <~BAH GM  CABK G CABPAL<BBB B(A0A8Dp 8C0A(B BBBJ L`OAA q CBA S ABB DABL/BBE B(D0A8DP 8C0A(B BBBA \, BBA A(D0 (C ABBA _ (C ABBI W (C ABBA L`BBB B(A0A8D 8C0A(B BBBH <BBC A(O0 (A ABBD L !BBD A(D0 (A BBBD E (H BBBA 4l AAQ | AAG L CAA L BBE A(F0s (F BBBA \ (A BBBA L BBD B(F0A8LB 8C0A(B BBBJ LD țBBD B(D0A8RE2 8D0A(B BBBA \ JBD A(L0S (F ABBE D (C ABBA I ؝L BBE B(D0A8L@ 8D0A(B BBBJ \ >\t BBE B(H0A8G@ 8D0A(B BBBC U8F0A(B BBB$ xDH D P H P H l ,vBBB B(A0A8L@ 8D0A(B BBBA ABaBBaAl $ (Ay F U K C 4 BAD Gp?  AABA L BBB B(A0A8G ) 8A0A(B BBBA LL pWBBG B(A0A8GPN 8D0A(B BBBG l @BBE A(H0Q@ 0C(A BBBD d 0C(A BBBJ E0C(A BBB< PBBD A(M (C ABBB $LlAG o AA tHBBE B(D0A8GJ\JBJBJAKUJJJHJHJGK`J 8A0A(B BBBF NJHJHJGKbJA BBE B(A0A8GJJIJEJAJEJAJ\J 8C0A(B BBBE |JIJDJAJGJAJUJP)BBD B(D0A8O@QHAXQAJNAHGG[A 8A0A(B BBBI AQHAXOAJNBHGG[N8C0A(B BBBtd BBD B(D0A8TP`XT`BhHpBxGHHGGGHSPv 8A0A(B BBBF DPBBE B(D0A8M 8A0A(B BBBI DBHBGHHGGGHnHHHGHHEGGGHypMBE[KHHGHHEGGGHnVKHHGHHIGGGHnMBDf?KHHGHHIGGGHvcFBEcoHHHGHHEGGGHvKBG\KBE]NHHGHHAGGGHv|KBG\4$BBE B(G0A8G  8D0A(B BBBI k B K B E B H H G G G H a  A E D E B ]  B E D E D [ i B E D E D [  E E D B B ] ] B E D E D [  B E D E D [ \\BBE B(G0A8SEIB 8A0A(B BBBH 4AAP@ CAK h CAA Lx>BBB B(D0A8L 8A0A(B BBBE TDh7BAD Q0]  AABG H  AABD d  AABH $PoAP j CB kCDBAC s ABD j ABC jAB< [GAP MAAI VCALLgBBE B(D0A8L{ 8C0A(B BBBE L0?BBE B(D0A8S 8D0A(B BBBK | OBBE B(A0A8J` 8A0A(B BBBI t 8C0A(B BBBH L 8A0A(B BBBA l &QTd grBD A(D0Ip 0A(A BBBE _ 0F(A BBBA d BBE B(D0A8IP 8C0A(B BBBG v 8A0A(B BBBA \tLBBH B(D0A8G8A0A(B BBB,@AAW [ AAJ \ 7BBE A(H0Ta 0A(A BBBA  0C(A BBBA DleBBE B(H0H8M@r8A0A(B BBB,A ,AP,AH-A-AX-A!-A0)-A2-A8,A ;-A(F-AO-A@X-Ac-An-Ay-A-A-A-A-AˢAhТAAAAcAAAAAAAAcAAAAVТAAA2AТA+AA8AТA)AAnAvТA:AAAAТA6AAKAТA:AAQAТAAA]AТAAAiAТAAAwAТA:AA~AdТAAAAТAAAAТAAAAAAAТAAAAmТAAAAТAAAAТAAA£AzТAAA;AТA6AAˣAdԣAAAArТAAAAТA 7AAA AAAA AAA*AТAAA/AТAAA:AfAADAiТAAAMAoТAAAhAAAaAAAfAТAAAmAAAuAAAAAAAAAA AAAAТA AAAТA AAAТA AAAТA AAAТA AAAТA AAA AA̤A AAۤA AAA AAAb AAA A P7A AA A] 7AAA A 7AA2AТA AA#AТA AA,A AA3Au AA:A AAAi AAIAlԣA AASAfԣA AA]AТA AAiA AAsA AAwA AAAd AAAc AAAr AAA AAAТA 7AAAdТAAAAcA@AAåAnТA@AAϥAg@AAߥAfТA(8AAAtТAX8AAAiТA8AAApТA AA'AcТA8AA1Ar8AA7AT A=AARAsТA9AAfAaТAAAvAtТAAAAAAAAAAAAAТAAAAТAAAAТAAAѦAТAAAܦAТAAAAТAAAAТAAAAТAAAAТAAAAТAAAAТAAAAТAAA/AТAAA>AТAAAYA AAAcAmAAA{A¢AAAA¢AAAA¢AAAA¢AAAA¢AAAA¢AAAA¢AAAA¢AAAA¢AAAAAТA AAAAТA̧AۧAA(9AAAlX9AAAТAx9AA#AmA9AA2AТA:AAVAТA8:AA_AТA:AAiA-A:A)-AuAТAAAAAТA;AAAТAh;AAèA٨Ap;A˨AݨAA-;AAAAԣA#@AAA@>AAAТA>AA©A A>A̩AѩA>A٩AA Ax?AAAmA?AAA A@@A!A&A A@A4A9A A @AEAOA AxAADAHA AAAA[A A BAAOA AxBAjAnA AdBAAwA ADAAsADAAAA A XEAAAТAժAMAAТAEAMAAAТA EAAA AXEA'A+A8AТA PFAMAFAFApGAQAТAGAA[AТAGAAmA4AFТAxAMAAТA HAMAAТAHHAMAAHA AAAТA HAAAͫAAIAAAA A JAAA)AТA JAMA;AHA@KAVA hKAVA[AfALALAqAvAAТA pMAAAA MAAAA `NAȬAجAAТA NAAA AТA xOAAAAТA QAA#A;AТA RAAIARAТA RAA\AТA SAMApA AТA TAAAAТA xTAAAAТA TAMA0UAAТA PUAAɭA߭AТA UAAAAТA VAA(A@AТA XAMARAoA A XAAAA A 0YAAAТAYAAȮAТAYAMAAAТA XZAAAAТA [AA AAТA [AMA'A/AТA h\AA8A@AТA ]AAIAUAТA ]AAbAkAТA p^AAuAAТA _AAAAТA _AMAAAТA _AMAgAίAmA@ `AۯAdAuAmA aAAzAA A HcAAAA A' dAAAAmA peAA"A3AmA xfAAEASAmA xgAbAeAxAmAP hAAAAmA iAAAA A2 jAɰAͰAذA Ad kAAAA A mAAA A ApnA8AA"A A nA3A:ALA A ppAA`ApAmA (rAAAТAsAMAAsAAAAuADZAױAuAAAТA0vAMAA AvA8A&AmAPwAA:AMAТA8xAMAYAТAxAAlAТA0yAAAAТA AAAA A AAAAТA AAϲAٲAТAAAAAlX9AA AAu AyA AAAc A zA#A%A5AhzA5ALA{A`}A[A}AAiA AAAuAТA0AAAТAAAAТA@AAAAAdzAA(AٳAhAAA AAAAA+A4A؃AAFAAǥATA`AAAAnA~AAAAA AAAʴAXAA޴AAaAA A APAAA AAA)AТAAAAТAЉAA6AGAТA XAMAOAAA`AAAsAAAAAAAAAAТAAAµAТAAAڵAAТA AAAТAAAA AAA"AТAAA4AТAAAGAТAAAYAAAlAAAA AAAAmAPAAAТAAMAAAɶAApAAAȎAAAAAAPAhAAA$AȐA$A+AA6AȐA6AAAHA`ApA`AfAApA}AAMAؔAAAXAAɷAAAշAAܷAAAA AXAAAМA(AVAA(A.AТAAAAТAAAAAAAТAAA#AТAAAAТAAAeAAAڵAТAAAgAmAAAA AAAzA AAApAТAAAuAТAAAAТAAAIAТAAAAТAAAAТAAAAmAAAѩAAA©A AAAݨAAAAP@A@A@A`@A@A@A@z%8_ .@ x,Ax@@0@  b@ @( @ oX@oo@@}b6/@F/@V/@f/@v/@/@/@/@/@/@/@/@/@0@0@&0@60@F0@V0@f0@v0@0@0@0@0@0@0@0@0@1@1@&1@61@F1@V1@f1@v1@1@1@1@1@1@1@1@1@2@2@&2@62@F2@V2@f2@v2@2@2@2@2@2@2@2@2@3@3@&3@63@F3@V3@f3@v3@3@3@3@3@3@3@3@3@4@4@&4@64@F4@V4@f4@v4@4@4@4@4@4@4@4@4@5@5@&5@65@F5@V5@f5@v5@5@5@5@5@5@5@5@5@6@6@&6@66@F6@V6@f6@v6@6@6@6@6@6@6@6@6@7@7@&7@67@F7@V7@f7@v7@7@7@7@7@7@7@7@7@8@8@&8@68@F8@V8@f8@v8@8@8@8@d $bGCC: (GNU) 5.3.0GCC: (GNU) 5.5.0.shstrtab.interp.note.ABI-tag.hash.dynsym.dynstr.gnu.version.gnu.version_r.rela.dyn.rela.plt.init.plt.got.text.fini.rodata.eh_frame_hdr.eh_frame.ctors.dtors.jcr.data.rel.ro.dynamic.got.plt.data.bss.comment 8@8T@T !x@x' 0@0/@7o@PDoX@XS( @( ]B @ @g.@.$b /@ / m8@8v8@8|x,Ax,,A,bAB"b""b""b""b"Z @}b@}qb0b؄b؄. b 0"(usr/bin/clamsubmit0100755000000000000000000031545013365330320013232 0ustar rootrootELF> 8@@@8 @@@@@@88@8@@@&& 33a3a_@d aaTT@T@ Ptd\\A\A44QtdRtd33a3a\\/lib64/ld-linux-x86-64.so.2GNU ad+G7]E#"U\Z`TS82LQ@Xb*CMa>_49^WRIP)V $ J1H&cA5[6?0YN  /' !(%:.F= 3;K<DO,B-Ux3  D7(@~QN0a?V hr  I`!YԒa3pc9ؒaXa(q/GyE\ؒaw VВai@(aP @=libclamav.so.7__gmon_start___Jv_RegisterClassescli_gentempjson_object_get_string_ITM_deregisterTMCloneTable_ITM_registerTMCloneTablecli_ctimecl_retdbdircli_chompcl_cvdheadcli_regexeccl_retflevelcl_cvdfreecli_regfreecli_filecopycli_regcompjson_object_object_get_exjson_object_putlibxml2.so.2_finiliblzma.so.5libbz2.so.1libltdl.so.7libpcre.so.1libm.so.6libclammspack.so.0libcurl.so.4curl_easy_getinfocurl_easy_setoptcurl_global_cleanupcurl_formaddcurl_easy_initcurl_slist_appendcurl_slist_free_allcurl_formfreecurl_easy_performcurl_easy_cleanupcurl_global_initcurl_easy_strerrorlibssh2.so.1libldap-2.4.so.2libsasl2.so.3libdl.so.2libssl.so.1libcrypto.so.1liblber-2.4.so.2libresolv.so.2libz.so.1libpthread.so.0send__errno_locationfcntllibjson-c.so.2json_tokener_parselibc.so.6fflushexitsprintfstrncmpoptindstrrchr__strdupstrncpyforkputcharselectreallocstdinstrftimelocaltime_rstrtolfeofsyslogfgetscallocstrlenstrstrdup2vsnprintfstdoutfputsmemcpyfclosestrtoulmallocumaskstrcasecmpremove__xstat64getenvoptargstderroptoptfilenofwritefreadrenamestrchrfprintfsetsidfopen64accessopterrstrcmp__libc_start_mainstpcpycloselog_edata__bss_start_endGLIBC_2.2.5GLIBC_2.14CLAMAV_PUBLICCLAMAV_PRIVATE ui 30ui Ӈ_ EaȏaЏa؏a&a+aLa`a a(a0a8a@aHaPaXa `a ha pa xa aaaaaaaaaȐaАaؐaaa a!a"a#a$a%a' a((a)0a*8a,@a-Ha.Pa/Xa0`a1ha2pa3xa4a5a7a8a9a:a;a<a=a>ȑa@БaAؑaBaCaDaEaGaHaIaJaK aM(aN0aO8aP@aQHaRPaTXaU`aVhaWpaXxaYaZa[a]a^aaacHHq!HtSn aH5r!%r!@%r!h% r!h%r!h%q!h%q!h%q!h%q!h%q!hp%q!h`%q!h P%q!h @%q!h 0%q!h %q!h %q!h%q!h%q!h%q!h%q!h%zq!h%rq!h%jq!h%bq!h%Zq!hp%Rq!h`%Jq!hP%Bq!h@%:q!h0%2q!h %*q!h%"q!h%q!h%q!h % q!h!%q!h"%p!h#%p!h$%p!h%%p!h&%p!h'p%p!h(`%p!h)P%p!h*@%p!h+0%p!h, %p!h-%p!h.%p!h/%p!h0%p!h1%p!h2%zp!h3%rp!h4%jp!h5%bp!h6%Zp!h7p%Rp!h8`%Jp!h9P%Bp!h:@%:p!h;0%2p!h< %*p!h=%"p!h>%p!h?%p!h@% p!hA%p!hB%o!hC%o!hD%o!hE%o!hF%o!hGp%o!hH`%o!hIP%o!hJ@%o!hK0%o!hL %o!hM%o!hN%o!hO%o!hP%o!hQ%o!hR%l!fAWAVAAUATUSIHHD$`HD$hDŽ$HDŽ$DŽ$HDŽ$HDŽ$DŽ$HDŽ$HDŽ$pHHgL-HD$E11HD$HD$HLDAN(IcDLXfHn!H(@Hn!AH(fDHn!HHD$Hn!HHD$l@Hyn!HHD$T@I>8WCH|$H|$%HEu H|$HHD$$!ApHaHD$pH¾'H1jPH1VH$'H1?HU+NH1)H$-'H1HkToNH1HXL$M=H5LHH5HHH"HHD$(HH+D$(HxI HI?Ht$(LHoCD5LHDŽ$ADŽ$HD$pnH`'H11PHH$HL$MIHHT$81LLLD$0HLHщ)HcD$@HHt$(-HIHt$(LD$0HT$8HHH19D$@`L&'H1RLz1LLHэALcD$(LHI?HqHL1L9D$(H/h!H=`1H~LE1E1jHg!H=AHNI>SI>SE1E1HHg!HT$pH5E1H81$H|$`AHt?HtHrMtLepH$HtNHDŽ$DŽ$H$Ht%H$HtH$HtH$HtMtLMtLHtDL$$EtHHHD[]A\A]A^A_À}-BTHHD$$Hf!H==E1E1E1HD$$HHD$pHH5f!3H=HHf!H=FhE1E1H^UH'H1E1QHe!H=PE1E1E1H He!H=b%E1E11E1HD$$Hae!H= "E1E1HL1kLIHD$0L''H1H$-'H1HO1oNHAH{ 'H1HE1E1HHd!H5AH81H|$0HtH|$`HH]d!H=$E1E1E1HH 'H1WHd!H=$E1H`WHc!H=%&E1E1E1H2)H|$0#H$HHD$@H|$@H5PHHD$0H|$0/H#H-HHD$(kHH+D$(HxIHIHt$(LHK7HT$(HIHT$(HD$hH|$`H 5AHD$(H|$8HRjLL$@1HH|$PH5#OHIY^;APjH Ht$8H|$HA1H|$PH5OHIAZA[QjH Ht$8H|$HA1H|$PH5:OHI^_hPjH Ht$8H|$HA1vH|$PH5yNIMXZAPjH [Ht$8H|$HA10H|$PH5DNHIAZA[QjH %Ht$8H|$HA1H|$PH5 hNHI^_'ASjH Ht$8H|$HA1H|$PH5"NIMXZuAPjH Ht$8H|$HA1]Ht$8H|$HH uIA 1$0H5t1''HD$@HL1KH'L15HT$p('L1!L9AYAZA0HH.`!H5H81H`!H=)E1H]TH_!H$H5J$E1E1H81K"H_!H=FE1E1HH|$0H|$`7LHD$`HD$h]H|$@cH$FH51HDŽ$DŽ$aH$IHD$0L$1LHHT$XLLD$PHLHH)HcD$@HHt$H-HIHt$HLD$PHT$XHHHH19D$@H^!H=~1AHLE1cH_^!H=;HH:^!H=3HH^!H=`E1HaXL&'H1LQjL Lt$HHt$8H A1L2Ht$8H MAL1$Ht$8H L1MA$E^_ VjL Ld$8Lt$HH A1LLLL$H ALL1$sLL$ H ALL1$HLL$(H ALL1$_AXARjL Ld$8Lt$HH A1LLL 7H LAL1$L H `ALL1$HT$@''H1H'H1HT$p('H11ҾoNH1}HA[A\ZE1AHH[!H5H81Hj[!H=;E1E1HH?[!H=FE1E1HH[!H=BHcZHZ!H=GH>5HZ!H=;HHHZ!H=THHZ!H=GHH[Z!H=4>HPjL 'Lt$HHt$8H A1LLL$Ht$8H AL1$hLL$ Ht$8H 1AL$;AZYAVjL |Ht$8H|$HH A1XZHkY!H=,#AHHT$x1 HHT$xHHcHT$pH1H|$pHH5SHIH5EHLH5TL5uNHX!H=KAHE1HX!H5AH81HlX!H5LAH81HIX!H=E1HHX!H='AHeeHW!H=:"E1AH7Df1I^HHPTI~@Hp~@H@#@fDH=Z!HZ!UH)HHvH^W!Ht ]fD]@f.H=AZ!H5:Z!UH)HHHH?HHtHW!Ht ]f]@f.=Y!ubUH7 HY!HATSH+ L% H)HHH9s@HHY!AHY!H9r[A\]Y!H= H?u .fDHYV!HtUH]AWAVAUATUSHH|$(H$H$L$L$t@)$ )$0)$@)$P)$`)$p)$)$H$HHD$`H$D$XD$\0HD$hIIILl$h1A HL9sO|%uHDI|$4I\$8L'HtIDH[0[]A\ff.AWAVIAUATEUSEHL$@t$4HT$8L$0HD$hHD$pMtLT$hHD$pL=A!A1D\$ Ƅ$:HD$ HD$h1I7AHD$(3E4Du EtAtMMI7HHۉH,HUHuH}uMD\$LLc\$ cH5xL\HHD$HD$xD$HD$ Dd$(HD$XH$HD$ HD$dHD$PH$@HD$@MH$@HT$H5HHl$xHH!%tDHVHD@HH1H)fHH t X9|HcHHD$ Hl$xHGE<#;H5PH t- Hu  HuD\$0EtHMct$0HH9!H5.L$ H81*DD$(HMYT$0HHV9!H5/L$ H81MH$LD$PHL$@Ht$8|$4HD$d=:;HHDD$LEt8;$XHD$@L$LHP81fDH ;Z9uH8!H5,H81 uMMLD$hHLHLMIH08!H5-HH81MuMu {HsHtUC0H|$ ED$H‰D$H8H|$ E111LqH|$ D$#D$0C7MPHt$X1LHD$LD$A8"{HT$xHMtKH=?AH HHLD$hE1M^I\$"H.HA|$|IHcD$dHH@HH9!L rH6!H=7))1HH|$hyHH[]A\A]A^A_ÃLD$hH5LLD$RLD$tA<$1A|$E11HHH@CML 1E1HcLD$hgD$LD9AL=&HcD$LBƄHD$HHDŽ@HDŽPDŽXDŽHVHU5!H=6(*1HH|$hHL%|LD$h1D$0CH4!HSH5*H81dH|$uH\$hdH|$tH|$MuH\$hH?L%7!A$9D$4*|$4)ǃHc-HHC@A,$9l$4H|$8HcL,׉fI9l$4)HcI}HHH\$hA$HC@)HcH<uH3!H=/-HMeHA"MHH3!H57,H815LD$h|$0 MH3!T$ H5(HH81L$0&C{HH3!HSH5E(H81H5LLD$B1ɅLD$E1H2!HSH5,)H81rA<$uCH2!HSH5 *H817fLc(1kqmuH=HHgMIHf2!H5/*HH81\$0H:2!H5%LH81H2!H=3&3HioH1!H=RHDJH1!HSH5'H81C~H1!IRH5D'H81"H1!IH5'IRHH81MIlH[1!H5(HH81DL$0EH-1!L$ H5%HH81DT$0EmH0!L$ H5$HH81cIH0!HSH5T(H81B(ABH0!IRH5(H81H}0!H=#11HH|$hpHL0!H=])1HH|$h?CtrH0!HSH5(H81IABtNH/!IRH5&H81VHh1[]A\A]A^A_H-!H=_&.H]Hl$(IqHAA0H\$@L $H߃ֺ҃L $t)H,!IQH5 #LH81Hl$($Ht$1E11HL $-H߉LH5#L $AAK 'H\$H5{L $H?L $t;1Y{OHD$HT$H|$(HLL $L $KHD$(Hh[]A\A]A^A_L $HHD$L $HHt$81H*;"L $ HT$8M@,HHD$HDN@u+H|$H2IY(H\$$f.HH|$H|$ 1L $賻HD$HL $KH=?HH WH|$H5'L $HD$L $IQH5 "Ha*!H5"LL $H81ѼHD$L $DkkmuH=HLH5!1HD$f.fAWAVIAUATAUSH=IH H1һ++ ,!H=,!H-,!HLcEHcHcLMIOLI1H5,!2@u`@H9,!I? ,!Hcɀ< tjDE9}DeH[]A\A]A^A_H2@t9ur 7,!@:yW]tIcHcIT< uA,!DuDuE9XIcIDH -@+@-Du@HA9H -uztLLD]NHcA9ILDu{LA9~HcITfH2HHru9|HA9uHcMDuDufH[]A\A]A^A_@H'!IUH5ȢH81HcE *!IML4@;fMHcA<2z:8AV*!D9U H *! .1:AD:fDA:A4Fը8:BHcȃA:EfDDBA-tlE(LLD)!A)!DuHH>A)!DuI1H7!zuADu zADuKTHJA9ܺDuDH%!IUH5hH81^: )!Du:?ff.AWAVAAUATH=USHIHxDL$ HL$LD$辶HDL$ 1D$ ++HA(!H=(!D;HE9IcH<Ll=H|$ IU -@+@-LEfAHE9H -uztLD$HL$LHDD+E9AIcHt}RAMH~D9~'HcHDfHAHHPA9|HA9ωHcAH|uDzfE_ADE9}$D3DHx[]A\A]A^A_fAHxD[]A\A]A^A_z@-t@ELHDDAfDA$<:D$ A4VՁ<|$ :P3HcʃA< @:@|$ EfDE_H5&!DIEHH&!-:5Iu~Ht$XlHt$X~-@@HD|$8HD$0<=D$gHcljHD=tHuT$gL$`HD$HHHD$PWD$`+D$8LD$PD|$HPH@E1DADfDHcЍHAHcA44@:t-Wu@;t"9uHxLH[D]A\A]A^A_HHcA<4:E͉|$8iH&$!A?E_H5iDIMHUH!!H81菳IEHD$XD$8D$` xH#!EA?2HHUH5ZH !H81!DE_E9DSHf#!E1|$ : AGd:HHUH55T$`H5#!HcHT$XH=Ht$ HT5H5a#!H$D`DCHt$D$`1+D$8Ll$(Dt$@D|$ PCREMatchLimit are superfluous. WARNING: setting this limit too high may severely impact performance.This option sets the maximum filesize for which PCRE subsigs will be executed. Files exceeding this limit will not have PCRE subsigs executed unless a subsig is encompassed to a smaller buffer. Negative values are not allowed. Setting this value to zero disables the limit. WARNING: setting this limit too high or disabling it may severely impact performance.This option enables on-access scanning (Linux only)This option specifies a directory or mount point which should be scanned on access. The mount point specified, or the mount point containing the specified directory will be watched, but only notifications will occur. If any directories are specified, this option will preempt the DDD system. It can also be used multiple times.This option specifies a directory (including all files and directories inside it), which should be scanned on access. This option can be used multiple times.This option allows excluding directories from on-access scanning. It can be used multiple times. Only works with DDD system.Use this option to whitelist the root UID (0) and allow any processes run under root to access all watched files without triggering scans.With this option you can whitelist specific UIDs. Processes with these UIDs will be able to access all files. This option can be used multiple times (one per line). Using a value of 0 on any line will disable this option entirely. To whitelist the root UID please enable the OnAccessExcludeRootUID option.Files larger than this value will not be scanned in on access.This option toggles the dynamic directory determination system for on-access scanning (Linux only).This option changes fanotify behavior to prevent access attempts on malicious files instead of simply notifying the user (On Access scan only).Enables extra scanning and notification after catching certain inotify events. Only works with the DDD system enabled.When started by root freshclam will drop privileges and switch to the user defined in this option.This option defined how many times daily freshclam should check for a database update.Use DNS to verify the virus database version. Freshclam uses DNS TXT records to verify the versions of the database and software itself. With this directive you can change the database verification domain. WARNING: Please don't change it unless you're configuring freshclam to use your own database verification domain.DatabaseMirror specifies to which mirror(s) freshclam should connect. You should have at least two entries: db.XY.clamav.net (or db.XY.ipv6.clamav.net for IPv6) and database.clamav.net (in this order). Please replace XY with your country code (see https://www.iana.org/domains/root/db). database.clamav.net is a round-robin record which points to our most reliable mirrors. It's used as a fall back in case db.XY.clamav.net is not working.db.XY.clamav.net database.clamav.netThis option allows you to easily point freshclam to private mirrors. If PrivateMirror is set, freshclam does not attempt to use DNS to determine whether its databases are out-of-date, instead it will use the If-Modified-Since request or directly check the headers of the remote database files. For each database, freshclam first attempts to download the CLD file. If that fails, it tries to download the CVD file. This option overrides DatabaseMirror, DNSDatabaseInfo and Scripted Updates. It can be used multiple times to provide fall-back mirrors.mirror1.mynetwork.com mirror2.mynetwork.comThis option defines how many attempts freshclam should make before giving up.With this option you can control scripted updates. It's highly recommended to keep them enabled.With this option enabled, freshclam will attempt to load new databases into memory to make sure they are properly handled by libclamav before replacing the old ones.By default freshclam will keep the local databases (.cld) uncompressed to make their handling faster. With this option you can enable the compression. The change will take effect with the next database update.Download an additional 3rd party signature database distributed through the ClamAV mirrors. This option can be used multiple times.With this option you can provide custom sources (http:// or file://) for database files. This option can be used multiple times.http://myserver.com/mysigs.ndb file:///mnt/nfs/local.hdbIf you're behind a proxy, please enter its address here.A user name for the HTTP proxy authentication.A password for the HTTP proxy authentication.If your servers are behind a firewall/proxy which does a User-Agent filtering you can use this option to force the use of a different User-Agent header.Send the RELOAD command to clamd after a successful update.Run a command after a successful database update.Run a command when a database update error occurs.Run a command when freshclam reports an outdated version. In the command string %v will be replaced with the new version number.With this option you can provide a client address for the database downloading. Useful for multi-homed systems.Timeout in seconds when connecting to database server.Timeout in seconds when reading from database server.This option enables support for Google Safe Browsing. When activated for the first time, freshclam will download a new database file (safebrowsing.cvd) which will be automatically loaded by clamd and clamscan during the next reload, provided that the heuristic phishing detection is turned on. This database includes information about websites that may be phishing sites or possible sources of malware. When using this option, it's mandatory to run freshclam at least every 30 minutes. Freshclam uses the ClamAV's mirror infrastructure to distribute the database and its updates but all the contents are provided under Google's terms of use. See https://transparencyreport.google.com/safe-browsing/overview and https://www.clamav.net/documents/safebrowsing for more information.This option enables downloading of bytecode.cvd, which includes additional detection mechanisms and improvements to the ClamAV engine.Disable authenticode certificate chain verification in PE files.Initialize a supplementary group access (the process must be started by root).Define the clamd socket to connect to for scanning. This option is mandatory! Syntax: ClamdSocket unix:path ClamdSocket tcp:host:port The first syntax specifies a local unix socket (needs an absolute path) e.g.: ClamdSocket unix:/var/run/clamd/clamd.socket The second syntax specifies a tcp local or remote tcp socket: the host can be a hostname or an ip address; the ":port" field is only required for IPv6 addresses, otherwise it defaults to 3310 ClamdSocket tcp:192.168.0.1 This option can be repeated several times with different sockets or even with the same socket: clamd servers will be selected in a round-robin fashion.Define the interface through which we communicate with sendmail. This option is mandatory! Possible formats are: [[unix|local]:]/path/to/file - to specify a unix domain socket; inet:port@[hostname|ip-address] - to specify an ipv4 socket; inet6:port@[hostname|ip-address] - to specify an ipv6 socket./tmp/clamav-milter.socket inet:7357Define the group ownership for the (unix) milter socket.Sets the permissions on the (unix) milter socket to the specified mode.Messages originating from these hosts/networks will not be scanned This option takes a host(name)/mask pair in CIRD notation and can be repeated several times. If "/mask" is omitted, a host is assumed. To specify a locally originated, non-smtp, email use the keyword "local".local 192.168.0.0/24 1111:2222:3333::/48^(Accept|Reject|Defer|Blackhole|Quarantine)$Action to be performed on clean messages (mostly useful for testing). The following actions are available: Accept: the message is accepted for delivery Reject: immediately refuse delivery (a 5xx error is returned to the peer) Defer: return a temporary failure message (4xx) to the peer Blackhole: like Accept but the message is sent to oblivion Quarantine: like Accept but message is quarantined instead of being deliveredAction to be performed on error conditions (this includes failure to allocate data structures, no scanners available, network timeouts, unknown scanner replies and the like. The following actions are available: Accept: the message is accepted for delivery; Reject: immediately refuse delivery (a 5xx error is returned to the peer); Defer: return a temporary failure message (4xx) to the peer.This option allows you to set a specific rejection reason for infected messages and it's therefore only useful together with "OnInfected Reject" The string "%v", if present, will be replaced with the virus name.If this option is set to "Replace" (or "Yes"), an "X-Virus-Scanned" and an "X-Virus-Status" headers will be attached to each processed message, possibly replacing existing headers. If it is set to Add, the X-Virus headers are added possibly on top of the existing ones. Note that while "Replace" can potentially break DKIM signatures, "Add" may confuse procmail and similar filters.When AddHeader is in use, this option allows you to set the reported hostname. This may be desirable in order to avoid leaking internal names. If unset the real machine name is used.Execute a command when an infected message is processed. The following parameters are passed to the invoked program in this order: virus name, queue id, sender, destination, subject, message id, message date. Note #1: this requires MTA macroes to be available (see LogInfected below) Note #2: the process is invoked in the context of clamav-milter Note #3: clamav-milter will wait for the process to exit. Be quick or fork to avoid unnecessary delays in email delivery/usr/local/bin/my_infected_message_handlerChroot to the specified directory. Chrooting is performed just after reading the config file and before dropping privileges.This option specifies a file which contains a list of basic POSIX regular expressions. Addresses (sent to or from - see below) matching these regexes will not be scanned. Optionally each line can start with the string "From:" or "To:" (note: no whitespace after the colon) indicating if it is, respectively, the sender or recipient that is to be whitelisted. If the field is missing, "To:" is assumed. Lines starting with #, : or ! are ignored.Messages from authenticated SMTP users matching this extended POSIX regular expression (egrep-like) will not be scanned. As an alternative, a file containing a plain (not regex) list of names (one per line) can be specified using the prefix "file:". e.g. SkipAuthenticated file:/etc/good_guys Note: this is the AUTH login name!SkipAuthenticated ^(tom|dick|henry)$This option allows you to tune what is logged when a message is infected. Possible values are Off (the default - nothing is logged), Basic (minimal info logged), Full (verbose info logged) Note: For this to work properly in sendmail, make sure the msg_id, mail_addr, rcpt_addr and i macroes are available in eom. In other words add a line like: Milter.macros.eom={msg_id}, {mail_addr}, {rcpt_addr}, i to your .cf file. Alternatively use the macro: define(`confMILTER_MACROS_EOM', `{msg_id}, {mail_addr}, {rcpt_addr}, i') Postfix should be working fine with the default settings.This option allows you to tune what is logged when no threat is found in a scanned message. See LogInfected for possible values and caveats. Useful in debugging but drastically increases the log size.This option affects the behaviour of LogInfected, LogClean and VirusAction when a message with multiple recipients is scanned: If SupportMultipleRecipients is off (the default) then one single log entry is generated for the message and, in case the message is determined to be malicious, the command indicated by VirusAction is executed just once. In both cases only the last recipient is reported. If SupportMultipleRecipients is on: then one line is logged for each recipient and the command indicated by VirusAction is also executed once for each recipient. Note: although it's probably a good idea to enable this option, the default value is currently set to off for legacy reasons.yesExampleERROR: Unknown option passed footruehelp^(yes|true|1|no|false|0)$config-file/etc/clamd.conf/etc/freshclam.conf/etc/clamav-milter.confdebuggen-jsondumpcertsquietleave-tempsno-warningsshow-progressstdoutdaemonno-dnslist-mirrorsupdate-dbreloadmultiscanfdpassstreamallmatchdatabase/usr/share/clamavrecursivegen-mdbfollow-dir-symlinks^[0-9]+$follow-file-symlinksbellno-summaryfile-listinfectedsuppress-ok-resultscopyremoveexcludeexclude-dirinclude-dirstructured-ssn-formathex-dumpmd5sha1sha256impprint-certshtml-normaliseascii-normaliseutf16-decodebuildmax-bad-sigs3000flevelcvd-versionno-cdiffserverunpackunpack-currentinfolist-sigsfind-sigsdecode-sigstest-sigsvbavba-hexcomparerun-cdiffverify-cdiffhybriddefaultcolorsconfig-dir/etcnon-defaultgenerate-configforce-interpretertrust-bytecodeprintsrcPrint source code of bytecodeprintbcirinputtracebytecode trace levelno-trace-showsourcearchive-verbosebytecode-trust-allhttp-proxyproxy-userlog-verboseforcedisable-summarydisable-archiveno-archiveno-peno-elfno-ole2no-pdfno-htmlno-mailno-phishing-sigsno-phishing-scan-urlsno-algorithmicno-phishing-restrictedscanmax-ratiomax-space^[0-9]+[KM]?$unzipunrararjunzoolhajartartgzdebblock-maxPreludeEnableprelude-enableEnable preludePreludeAnalyzerNameprelude-analyzer-name/tmp/clamav.logLogFileUnlockLogFileMaxSizeLogTimeLog time with each message.LogCleanLogSyslogLogFacilityLogVerboseEnable verbose logging.LogRotatelog-rotateExtendedDetectionInfoPidFile/var/run/clam.pidTemporaryDirectorytempdir/tmpDatabaseDirectorydatadir/var/lib/clamavOfficialDatabaseOnlyofficial-db-onlynoYaraRulesyara-rulesLocalSocket/tmp/clamd.socketLocalSocketGroupvirusgroupLocalSocketMode660FixStaleSocketTCPSocket3310TCPAddr127.0.0.1MaxConnectionQueueLength30StreamMaxLength25MStreamMinPort1024StreamMaxPort2048MaxThreads120CommandReadTimeoutSendBufTimeout200300MaxQueueIdleTimeout^/proc/ ^/sys/MaxDirectoryRecursionmax-dir-recursion15FollowDirectorySymlinksFollow directory symlinks.FollowFileSymlinksCrossFilesystemscross-fsSelfCheck600DisableCachedisable-cacheVirusEventExitOnOOMAllowAllMatchScanForegroundforegroundDon't fork into background.DebugLeaveTemporaryFilesUserBytecodeBytecodeSecurity^(TrustSigned|Paranoid)$TrustSignedBytecodeTimeoutbytecode-timeout5000BytecodeUnsignedbytecode-unsignedBytecodeModebytecode-modeAutoStatisticsstatisticsNoneDetectPUAdetect-puaExcludePUAexclude-puaNetTool PWToolIncludePUAinclude-puaSpy Scanner RATAlgorithmicDetectionalgorithmic-detectionScanPEscan-peScanELFscan-elfDetectBrokenExecutablesdetect-brokenScanMailscan-mailScanPartialMessagesPhishingSignaturesPhishingScanURLsPhishingAlwaysBlockCloakphishing-cloakphishing-sslPartitionIntersectionpartition-intersectionHeuristicScanPrecedenceheuristic-scan-precedenceStructuredDataDetectiondetect-structuredStructuredMinCreditCardCountstructured-cc-countStructuredMinSSNCountstructured-ssn-countStructuredSSNFormatNormalStructuredSSNFormatStrippedScanHTMLscan-htmlScanOLE2scan-ole2OLE2BlockMacrosblock-macrosScanPDFscan-pdfScanSWFscan-swfScanXMLDOCSscan-xmldocsScanHWP3scan-hwp3ScanArchivescan-archiveArchiveBlockEncryptedblock-encryptedForceToDiskforce-to-diskmax-scansize100Mmax-recursion16max-files10000MaxEmbeddedPEmax-embeddedpe10MMaxHTMLNormalizemax-htmlnormalizeMaxHTMLNoTagsmax-htmlnotags2MMaxScriptNormalizemax-scriptnormalizeMaxZipTypeRcgmax-ziptypercg1MMaxPartitionsmax-partitions128MaxIconsPEmax-iconspe100MaxRecHWP3max-rechwp3TimeLimittimelimitPCREMatchLimitpcre-match-limit100000PCRERecMatchLimitpcre-recmatch-limitPCREMaxFileSizepcre-max-filesizeOnAccessMountPath/ /home/userOnAccessIncludePathon-access-include/home /studentsOnAccessExcludePath/home/bofh /rootOnAccessExcludeRootUIDOnAccessExcludeUIDOnAccessMaxFileSizeOnAccessDisableDDDdisable-dddOnAccessPreventionOnAccessExtraScanningDevACOnlydev-ac-onlyDevACDepthdev-ac-depthDevPerformancedev-performanceDevLiblogdev-liblogUpdateLogFile/var/log/freshclam.logDatabaseOwnerCheckschecksDNSDatabaseInfocurrent.cvd.clamav.netDatabaseMirrorPrivateMirrorMaxAttemptsScriptedUpdatesTestDatabasesCompressLocalDatabaseExtraDatabasedbname1 dbname2DatabaseCustomURLHTTPProxyServeryour-proxyHTTPProxyPortHTTP proxy's port8080HTTPProxyUsernameusernameHTTPProxyPasswordHTTPUserAgentNotifyClamddaemon-notifyOnUpdateExecuteon-update-executecommandOnErrorExecuteon-error-executeOnOutdatedExecuteon-outdated-executeLocalIPAddresslocal-addressaaa.bbb.ccc.dddConnectTimeoutReceiveTimeoutSafeBrowsingDisableCertChecknocertsMailMaxRecursionArchiveMaxScanSizeArchiveMaxRecursionArchiveMaxFilesArchiveMaxCompressionRatioArchiveBlockMaxArchiveLimitMemoryUsageMailFollowURLsmail-follow-urlsClamukoScanOnAccessClamukoScannerCountClamukoScanOnOpenClamukoScanOnCloseClamukoScanOnExecClamukoIncludePathClamukoExcludePathClamukoExcludeUIDClamukoMaxFileSizeAllowSupplementaryGroupsClamdSockettcp:scanner.mydomain:7357MilterSocketMilterSocketGroupMilterSocketModeLocalNetOnCleanAcceptOnInfectedQuarantineOnFail^(Accept|Reject|Defer)$DeferRejectMsgMTA specificAddHeader^(No|Replace|Yes|Add)$ReplaceReportHostnamemy.mail.server.nameVirusActionChroot/newrootWhitelist/etc/whitelisted_addressesSkipAuthenticatedLogInfectedBasicSupportMultipleRecipientsPOSIXLY_CORRECT%s: illegal option -- %c %s: unrecognized option `%s' %s: option `%s' is ambiguous %s: option requires an argument -- %c %s: option `--%s' doesn't allow an argument %s: option `--%s' requires an argument 0.100.2%s/daily.cvd%s/daily.cldClamAV %s ClamAV %s/%u/%s/dev/nullCan't open /dev/null dup2(%d, %d) failed %s/Unable to allocate memory for db directory... ERROR: This tool requires libclamav with functionality level %u or higher (current f-level: %u) ERROR: --file-list: Can't open file %s Set-Cookie:header_cb(): malloc failed __cfduid_clamav-net_sessionwrite_cb() realloc failure %s -hHinpVv? we:p:n:N:V:H:h?vERROR: Unable to read stream Error in GET %s: %s name="authenticity_token"value=%s; %s;X-CSRF-Token: %sError in GET presigned: %s keyError: malloc submissionID. aclpolicyx-amz-meta-original-filenamex-amz-credentialx-amz-algorithmx-amz-datex-amz-signatureExpect:Error in POST AWS: %s 'utf8authenticity_tokensubmissionIDshareSampleclamsubmitdescriptionprivacyError in POST submit: %s /reports//reports/successSubmission success! /reports/failureSubmission failed Unknown submission status %s fptypesendernameemailvirusnamemalwareheader_cb(): malformed cookie header_cb(): unrecognized cookie Clam AntiVirus: Monitoring Tool %s By The ClamAV Team: https://www.clamav.net/about.html#credits (C) 2008-2018 Cisco Systems, Inc. -h or -? Show this help -v Show version -e [EMAIL] Your email address (required) -n [FILE/-] Submit a false negative (FN) -N [NAME] Your name contained in quotation marks (required) -p [FILE/-] Submit a false positive (FP) -V [VIRUS] Detected virus name (required with -p)You must specify -n or -p. Both are mutually exclusive. Pass in - as the filename for stdin. Error: json_object_get_string() for %s. Error: json_object_object_get_ex() for %s. https://www.clamav.net/reports/malwarehttps://www.clamav.net/reports/fpERROR: Could not initialize libcurl. Detected virus name(-V) required for false positive submissions. Authenticity token element not found. Authenticity token value not found. Authenticity token malformed. no memory for authenticity token. https://www.clamav.net/presigned?type=malwarehttps://www.clamav.net/presigned?type=fpinvalid cfduid and/or session id values provided by clamav.net/presigned. Unable to continue submission.No memory for GET presigned cookies snprintf() failed formatting GET presigned cookies No memory for GET presigned X-CSRF-Token snprintf() failed for GET presigned X-CSRF-Token Error in json_tokener_parse of %.*s Error in presigned_get_string parsing key from json object Error: malformed 'key' string in GET presigned response (missing '/'. Error: malformed 'key' string in GET presigned response (missing '-'. ERROR: Could not initialize libcurl POST presigned Error in presigned_get_string parsing acl from json object Error in presigned_get_string parsing policy from json object Error in presigned_get_string parsing x-amz-meta-original-filename from json object Error in presigned_get_string parsing x-amz-credential from json object Error in presigned_get_string parsing x-amz-algorithm from json object Error in presigned_get_string parsing x-amz-date from json object Error in presigned_get_string parsing x-amz-signature from json object https://clamav-site.s3.amazonaws.com/No memory for POST submit cookies. snprintf() failed formatting POST submit cookies https://www.clamav.net/reports/submitPOST submit Location URL is NULL. POST submit Location URL is malformed. Unexpected POST submit response code: %li                                    ;0%| L$"#&d/d00$2d44454EJ$NtU U$U<UTWYY4[t[T]$^$4^<^|_` a$ a< 4bt c c4 zRx p*zRx $@FJ w?;*3$"LDxBBB B(A0A8Jb 8A0A(B BBBH  7Hb F L BBB B(A0A8G 8A0A(B BBBE Lx$ BBB B(A0A8G  8D0A(B BBBG 4T8-bBDH A ABF AFB4p-eFAJ } CAF DDA<-BBD A(J0h (A ABBG d8/BBE B(D0A8RP 8A0A(B BBBH L 8C0A(B BBBA 4l`0eFAJ } CAF DDA,0KAD AB\H1BBE B(D0A8J,,D,X,C, 8D0A(B BBBA 4x@BBE B(D0A8IGUBW 8C0A(B BBBA n 8C0A(B BBBA U 8A0A(B BBBA dxE4BBE B(D0A8N@ 8A0A(B BBBI D 8F0A(B BBBE |,PIBBE B(H0A8J^ 8A0A(B BBBJ J 8D0A(B BBBI v 8G0D(B BBBE `OXO POlHO0BBB B(A0A8D@IHKPYHA@| 8A0A(B BBBF  8D0A(B BBBO TdQBBB A(D0D@ 0D(A BBBM k 0A(A BBBE R@D{<RHAA h ABK  HBK TL,TBBH A(H@/ (F ABBA B (C ABBA D|pUBAF MX  CABD X  EABH U <U~BAH GM  CABK G CAB<0V7BBA A(I0 (A ABBC L\0WBBE A(A0J (D BBBA N (A BBBK WAXXF4`XAAG0m DAE a DAJ LXBBD B(A0A8G 8A0A(B BBBA $dBBE B(F0A8J 8D0A(B BBBA BiAHB|BGB{AGB{AHB|BGB{AHB{AHBBrBAGBBBBBkBAHBkAD XeBBE B(H0H8M@r8A0A(B BBB HX@ @P@H@@X@@0@@8@ @(@@@@ @@!@,@7@B@M@s@hx@vAvA@c@vAvA@@vAvA@c@vAvA@Vx@vAvA@x@+vAvA@x@)vAvA@vx@:vAvA@x@p@vA@x@:vAvA@x@vAvA@x@vAvA@x@vAvA@x@:vAvA&@dx@vAvA-@x@vAvA4@x@vAvAA@vAvAK@x@vAvAR@mx@vAvA\@x@vAvAc@x@vAvAj@zx@vAvAAx@@vAs@d|@vAvA@rx@vAvA@x@ȉ@vA@@vAvA@@vAvA@x@vAvA@x@vAvA@fvAvA@ix@vAvA@ox@vAvA@vAvA @vAvA@x@vAvA@vAvA@vAvA{AvAvA)@vAvA5@@vAvAK@x@ vAvAT@x@ vAvAX@x@ vAvA]@x@ vAvA@x@ vAvAd@x@ vAvAh@ vAvAt@ vAvA@ vAvA@ vAvA@b vAvA@@ @@@@] P@vA@@ p@vA@x@ vAvA@x@ vAvA@ vAvA@u vAvA@ vAvA@i vAvA@l|@ vAvA@f|@ vAvA @x@ vAvA@ vAvA @ vAvA$@ vAvA9@d vAvA,@c vAvA4@r vAvA>@ vAvAK@x@ @vAR@dx@vAvA`@ck@@vAvAp@nx@@vAvA|@g@vAvA@fx@Њ@vA@tx@@vA@ix@(@vA@px@@vA@cx@`@vA@r@vA@T@@vA@sx@@vA@ax@vAvA#@tx@vAvA6@vAvAA@vAvAL@vAvAX@x@vAvA^@x@vAvAn@x@vAvA~@x@vAvA@x@vAvA@x@vAvA@x@vAvA@x@vAvA@x@vAvA@x@vAvA@x@vAvA@x@vAvA@x@vAvA@x@vAvA@@vAvA@@vAvA(@j@vAvA.@j@vAvA4@j@vAvA8@j@vAvA>@j@vAvAB@j@vAvAF@j@vAvAJ@j@vAvAN@j@vAvAuAR@x@ vAvA\@j@x@y@@@Ћ@AAl@@@x@ @@@@@@@@x@@@@@x@@@@ @x@8@@@@B@p@@"@x@-@@@E@O@x@@@@Z@x@@@@p@@p@x@@@-@@@@|@#@@@@x@ @@@@؏@@@@@@0@@A@L@@\@`@x@(@@@o@@X@y@~@@@@@ @@@@`@@@@@@@@P@@@@ @@@@x@@@@8@l@@@Ȕ@@@@xP@@@@d@@(@@(@]@/ A@4@C@Y@@ @k@n@x@@@@x@0@@@@x@ X@@@@@X@@@@x@ @@@8@@@x@X@@@ @x@@@@@)@Fx@4@@P@x@Ț@@V@x@@@j@(@@o@@x@ x@@@x@@@(@@@@@ x@@@@x@ @@@@@@ @@@"@@@p@-@2@<@x@ @@@G@R@ H@^@m@x@ @@@@x@ `@@@@@x@ @@@@@x@ @@@@@x@ @@@AAx@ (@@@Ax@ȥ@@,A@x@ @@@?A@x@ @@@PAiAx@ h@@ا@xAx@ @vAAAx@ p@@@AAx@ @@@AAx@ P@@A+A@ x@l@?AUA@ ث@l@jAx@@@@@Ax@@@AAx@ @@@AAx@ @@@AAx@ @@AAx@ @@@AAx@ @@@AAx@ `@@@A'Ax@ @@@1A=Ax@ @@@JA`Ax@ X@@pA|Ax@ @@#AA@@ @A A1A@ @@6AA@ @AJAA@' 8@AAA@ @AAA@ @AAA@ @A!A4A@P 0@@HAVA@ 8@eAhAvA@2 X@AAA@d @AAA@ @AAA@@AAA@ @AAA@ @@A,A@ @@Ax@8@@>Ap@PA]AqA@AAX@AAx@@@A@h@AA@P@@A Ax@@@Ax@H@@@(Ax@@@@>AHAx@ vAvATA_A@ vAvAlA{Ax@ vAvAAAx@vAvAAAl@AAG@u@P@@AAc@ @@AA@AAP@@A0@X@%A@@l@1Ax@@@@AAx@@@@@OAx@@vAeA@sAAH@@A@AA@AAAP@AA@^@A@t@AA@P@@@*A:A@LATAcA@LAtAA@LAAAa@AA@@@A@0@@Ax@h@@@o@x@x@@@AAx@ @@ AvAvAAvAvA/AvAvACAvAvASAvAvAnAx@vAvA~Ax@vAvAAAx@ vAvAAx@vAvAA@vAvAAx@vAvAAx@vAvA Ax@vAvA AvAvA( AvAvA; A@vAvAM A@PvAvA` Ax@H@@y A@ A A@H@ Ap@A@ A@\@ A@@ A@@ Ap@ A A@@ Ap@ A A A A@ A" A@, A9 AC A@@Z Ab A@q A A@@ A@ A A@@ A A@P@ Ax@ A@@ A Ax@@@@JAx@vAvA@vAvAP@x@vAvA@x@vAvAV@x@vAvA@vAvAAx@vAvA#A@vAvAJA@vAvA6A@vAvA,Ax@vAvA1Ax@vAvAAx@vAvAAx@vAvAAx@vAvA@x@vAvA@@vAvA~@vAvAo@@vAvA@vAvA*=JVcpziv3 @ (@x@@@  a@X@ o@oo @a@@&@6@F@V@f@v@@@@@@@@@@@&@6@F@V@f@v@@@@@@@@@ @ @& @6 @F @V @f @v @ @ @ @ @ @ @ @ @!@!@&!@6!@F!@V!@f!@v!@!@!@!@!@!@!@!@!@"@"@&"@6"@F"@V"@f"@v"@"@"@"@"@"@"@"@"@#@#@&#@d4aGCC: (GNU) 5.3.0GCC: (GNU) 5.5.0.shstrtab.interp.note.ABI-tag.hash.dynsym.dynstr.gnu.version.gnu.version_r.rela.dyn.rela.plt.init.plt.got.text.fini.rodata.eh_frame_hdr.eh_frame.ctors.dtors.jcr.data.rel.ro.dynamic.got.plt.data.bss.comment 8@8T@T !x@x' @` /@7o @ Do@SX@X]B@g@$b@@m0#@0#v@#@@#[|(@(8@8$\A\4A 3a3(3a(383a83@3a@3Y aqa8aa(aؒx 0ؒ"usr/bin/clamscan0100755000000000000000000035576013365330320012663 0ustar rootrootELF>1@@@8 @@@@@@88@8@@@jj xsxsaxsa*`Xe PPaPappTT@T@ Ptdh]h]Ah]AQtdRtdxsxsaxsa\\/lib64/ld-linux-x86-64.so.2GNU a}7[*(&lkTtrm#xuiF`eR gp{6Xa5z;OwBGvsfS\?hn + ]yo-|"Uc dWPM>.qb  $,:)</04'%K@D3I=ZNQ1HJCA^2LE9Y8jV_!9tRzcsD`l+ : .ؤ@h  aK BaKa "'Ucw=aN5Jy(jsxBa`n?Za1~hv! aQ(OaQ;aY: $@libclamav.so.7cl_always_gen_section_hash__gmon_start___Jv_RegisterClassescli_sigperf_printcl_loadcl_engine_set_clcb_pre_cachecl_engine_get_numcl_initcli_gentempcl_engine_set_clcb_virus_foundcl_engine_newcl_scanfile_callback_ITM_deregisterTMCloneTablecl_engine_compile_ITM_registerTMCloneTablecli_ctimecl_retdbdircli_chompcl_cvdheadcl_strerrorcl_initialize_cryptocli_regexeccl_retflevelcl_engine_set_clcb_metacl_engine_freecli_pcre_perf_printcl_cvdfreecl_debugcl_engine_set_clcb_post_scancl_scandesc_callbackcli_regfreecli_sigperf_events_destroycli_filecopycl_engine_set_strcl_cleanup_cryptocli_gettmpdircli_pcre_perf_events_destroycl_engine_set_numcli_regcomplibxml2.so.2_finiliblzma.so.5libbz2.so.1libltdl.so.7libdl.so.2libssl.so.1libcrypto.so.1libz.so.1libjson-c.so.2libpcre.so.1libm.so.6libclammspack.so.0libpthread.so.0sendwait__errno_locationfcntllibc.so.6setuid__xpg_basenamefflushexitsprintfstrncmpoptindstrrchr__strdupperrorclosedirstrncpyforksigprocmaskunlinkselectreallocstdinstrftimelocaltime_rstrtolsyslogfgetsgetpwnamcallocstrlensigemptysetdup2vsnprintfsigaddsetstdoutfputcfputsmemcpyfclosestrtoulmallocumaskstrcasecmp__lxstat64opendir__xstat64getenvoptargstderrsetrlimit64optoptfilenogetcwdfwritefreadgettimeofdayrenamegeteuidstrchrfprintfreaddir64setsidgetrlimit64fopen64accessopterrsetgidstrcmp__libc_start_mainstpcpycloselog_edata__bss_start_endGLIBC_2.2.5GLIBC_2.14CLAMAV_PUBLICCLAMAV_PRIVATE^ ui 0ui Ӈ_ Eaaa"a-a7a`axa a(a0a8a@aHaPaXa `a ha pa xa aaaaaaaaaaaaaaa a!a#a$a%a& a'(a(0a)8a*@a+Ha,Pa.Xa/`a0ha1pa2xa3a4a5a6a8a9a:a;a<a=a>a?a@aAaBaCaEaFaGaHaI aJ(aK0aL8aM@aNHaOPaQXaR`aShaTpaUxaVaWaXaYa[a\a]a^a_aaabacadaeafagahajakalam an(ao0ap8aq@arHasPauXav`ayhazpa|HH!Ht聀H5ҫ!%ԫ!@%ҫ!h%ʫ!h%«!h%!h%!h%!h%!h%!hp%!h`%!h P%!h @%z!h 0%r!h %j!h %b!h%Z!h%R!h%J!h%B!h%:!h%2!h%*!h%"!h%!hp%!h`% !hP%!h@%!h0%!h %!h%!h%ڪ!h%Ҫ!h %ʪ!h!%ª!h"%!h#%!h$%!h%%!h&%!h'p%!h(`%!h)P%!h*@%z!h+0%r!h, %j!h-%b!h.%Z!h/%R!h0%J!h1%B!h2%:!h3%2!h4%*!h5%"!h6%!h7p%!h8`% !h9P%!h:@%!h;0%!h< %!h=%!h>%ک!h?%ҩ!h@%ʩ!hA%©!hB%!hC%!hD%!hE%!hF%!hGp%!hH`%!hIP%!hJ@%z!hK0%r!hL %j!hM%b!hN%Z!hO%R!hP%J!hQ%B!hR%:!hS%2!hT%*!hU%"!hV%!hWp%!hX`% !hYP%!hZ@%!h[0%!h\ %!h]%!h^%ڨ!h_%Ҩ!h`%ʨ!ha%¨!hb%!hc%!hd%!he%!hf%!hgp%!hh`%!hiP%!hj@%z!hk0%!fAWAVAUATIUSAH4GH\$ HmH߾`1H޿QHE11jALD+)HHAYAZ#H5H'D@ EtH$!fH8!fH5H'x t H!fH5Hj'p rH5jHP'H H5H6'P H5H'@ 5H5H'x H5H&x t Hԫ!fH5H&x t H!fH5H&x t Hڦ!fH5H&x t Ho!fH5fHe&x HԦ!HH?L%6! 1LHBH*]H5"H߉ &Dx EHd&1HZ!f}H5H%HxBH,&HĨ[]A\A]A^A_H=)$1 N^Ht$HD$HD$ HPH˥!H=#H1 H=3$1 H%VH1x%IBH|$1Ll$D+l$H= $Lt$D+4$DA)E@BDH1| A4$H=31Eg ?H=0H1Q At$H=.1> At$H=41+ At$ H=41 At$ H!0GH!D8EID$HHJfH*Y#H= IT$ HHfH*HYa#ft-ID$HfH*HfH*^H="E D<H="DAЙD1 VH=H=#1 H5hH#x H5HxH=DHE1 H=1 fHH*XfHH*XHfHH H*XHfHH H*XH"c1I^HHPTI@H @H+@fDH=q!Hq!UH)HHvH~!Ht ]fD]@f.H=1!H5*!UH)HHHH?HHtH9!Ht ]f]@f.=!ubUHA!H!HATSHA!L%A!H)HHH9s@HH!AH!H9r[A\]!H=aA!H?u .fDHy!HtUH]AWAVAUATUSHH|$(H$H$L$L$t@)$ )$0)$@)$P)$`)$p)$)$H$HHD$`H$D$XD$\0HD$hIIILl$h1A HL9sO|%uHDkfLHPHHD$8L|$0H\$8H$HL$XHD$XHD$`H$D$\0LHHD$h{HڅD$,BD:x HT$/H|$8D$,AE18HC!Sf8u"Hۜ!H;Ht H[D fAWAVAUATUSHH$8H$@H$HL$PL$Xt@)$`)$p)$)$)$)$)$)$H!f8tH[]A\A]A^A_@H!HD$D$0L0H$ HD$ H$0HD$(tIIIoHD$(1AHD$ HL9sO|%uHDA!DuI1H7!zuADu zADuKTHJA9ܺDuDHK!IUH5P_H81^: Y!Du:?ff.AWAVAAUATH=^USHIHxDL$ HL$LD$^HDL$ 1D$ ++Ha!H=Ί!D;HE9IcH<Ll=H|$ IU -@+@-LEfAHE9H -uztLD$HL$LHDD+E9AIcHt}RAMH~D9~'HcHDfHAHHPA9|HA9ωHcAH|uDzfE_ADE9}$D3DHx[]A\A]A^A_fAHxD[]A\A]A^A_z@-t@ELHDDAfDA$<:D$ A4VՁ<|$ :P3HcʃA< @:@|$ EfDE_H5݈!DIEHHʈ!-:5Iu~Ht$XlHt$X~-@@HD|$8HD$0<=D$gHcljHD=tHuT$gL$`HD$HHHD$PWD$`+D$8LD$PD|$HPH@E1DADfDHcЍHAHcA44@:t-Wu@;t"9uHxLH[D]A\A]A^A_HHcA<4:E͉|$8iHF!A?E_H5UZDIMHUHq!H81IEHD$XD$8D$` xHӅ!EA?2HHUH5BZH!H81!DE_E9DSH!E1|$ : AGd:HHUH5ZT$`H5Ņ!HcHT$XH=Ht$ HT5H5!H$D`DCHt$D$`1+D$8Ll$(Dt$@D|$Mct$0HHu!H5HQL$ H81DD$(HMYT$0HHu!H5QL$ H81MH$LD$PHL$@Ht$8|$4HD$d=:;HOHDD$LEt8;$XHD$@L$LHP81fDH ;Z9uHt!H5OH81uMMLD$hHLHLMIH`t!H5aPHH81tMuMu {HsHtUC0H|$ ED$H‰D$H]8H|$ E111L1H|$ D$SD$0C7VMPHt$X1LHD$LD$A8"{HT$xHMtKH=?AH HHLD$hE1M^I\$"H^HA|$|IHcD$dHH@HHv!L rHr!H=K)1HH|$hyHH[]A\A]A^A_ÃLD$hH5WLLD$LD$tA<$1A|$E11HHH@CML 1E1HcLD$hgD$LD9AL=&HcD$LBƄHD$HHDŽ@HDŽPDŽXDŽHVHq!H=J*1HRH|$hHL%DLD$h1D$0CH!q!HSH5MH814H|$uH\$hdH|$tH|$;MuH\$hH?L%ut!A$9D$4*|$4)ǃHcHHC@A,$9l$4H|$8HcL,׉fI9l$4)HcI}HHH\$hA$HC@)HcH<uH.p!H=OHeHA"MHHo!H5NH81LD$h|$0 MHo!T$ H5JHH81L$0&C{Hxo!HSH5 KH81H5uLLD$1ɅLD$E1H/o!HSH5KH81BA<$uCHn!HSH5LH81fLc(1kqmuH=HHgMIHn!H5LHH81\$0Hjn!H5KHLH81~HJn!H=H3HoH%n!H=HJHn!HSH5IH81~Hm!IRH5 JH81Hm!IH5JIRHH81MIlHm!H5JHH81DL$0EH]m!L$ H5GHH81mDT$0EmH#m!L$ H5`GHH813IHl!HSH5KH81(ABHl!IRH5cKH81Hl!H=VF11HzH|$hpH|l!H=%L1HIH|$h?CtrH@l!HSH5KH81SIABtNHl!IRH5IH81&Hh1[]A\A]A^A_H>i!H='I.H Hl$(IqHAA0H\$@L $H߃҃FL $t)Hh!IQH5ELH81Hl$($Ht$1E11HL $H߉LH5EL $AAK 'H\$H5CL $HϽL $t;1Y{OHD$HT$H|$(HLL $L $KHD$(Hh[]A\A]A^A_L $HHD$L $HHt$81H;"L $ HT$8M@,HHD$HDN@u+H|$H2IY(H\$$f.HH|$H|$ 1L $HD$HL $KH=?HH WH|$H5L $PHD$L $IQH5B"Hf!H5ELL $H81HD$L $DkkmuH=HLH5D1HD$f.fAUATUSHH~HHIڼHI蟼Hc j!H|讻HHEH j!H5oHL1;C8u^Hi!H}H5>A1L輼t4H}1xLD$ D$ H[]A\A]LػH}ϻHEH[]A\A]L读USHHHt$xiHt$H߉* H=1HHh!H|$Hu膹H|$Ht7H[]{fH=K1HHh!H|$HtF@HT$H=Hlf.USHHHt$xIHt$H߉ھufHT$H=H1 ɸH|$HtzH[]H=1HHg!H|$Ht薹@Ht$Ht7H=1HHg!H|$HvQl@H@B8ܺH=HH1X3SHHu[H=L11H=#1"Hg![fDATUH5SHH6D` H5sEHHXHHHf!uD$%=@t)H=H1HĐ[]A\DHIHEHHDHaf!Hٸ[f!HĐ[]A\DH5Hq@ H5=H5HPh rHe!H 1HZf.H,AWAVAUATUSH蝺HH=ح1j1E11AH)HZY^H5HHIċ@ u*H誷HHHH[]A\A]A^A_DMl$HLعtL謷HI衷I|跶HIDH5_HL1LZLEL%HIt}H5HL1蹷L LL׷HItL׶AGA9EvIl$LLL訶HH[]A\A]A^A_Zf.IT$H5lL1 DLXIl$두H5AHL1ܶ3H_!H=.HW1DAVAUATUHSHHHx HHIE1H5LH1dH跸E1H5LH18H苸HEt}H|$+HH=lHHD1LHH[]A\A]A^8HIH=H1 H[]A\A]A^@H=H1HȵH H0HDhHL$ fDH蘵HPA9s H0AHL$H贴Lp1HLHHHx 聳HHt MiL8*H跶1҃\w)諶Hj]!H5]H81|HËe!ATUSHt/HS@Hbe!HH‰ e![]A\f.HH5qIċ@ tHHe!HH=0a!HH=a!e!IH2H!ကtDHBHDЉHH)HHt;AT t u+H `!LH9tPH t t[H~`!]A\f.I|$H5ߵHHHZd!H[!IT$H5H81Ht E61H=d! 1fD[f.AUATH=UUS11H6H=?ÉD$1H=&ʼnD$1D$ E1AHl$DD譯t#IIFlDD芯uHZ!H5ǽDDLd$H81t覯HL9t]]uHZ!H=lHl$Ld$HftZHL9t]uHL9uH[]A\A]ÃLd$HL9t]~H L9uгtuҮH1[]A\A]1n@f.ATUSIHH0H"tH0[]A\HH]|/H\$ tQLHƄ$ 1E11HH1赯HװH0ډ[]A\H>LH1Ƅ$ f.1?/ATUH5SHɲHtTH1If.1<$#HLծHuHH[]A\f.H1[]A\fHHi\!H=`f1ϿH= H1蹿H=2蝭H=v葭H=!1蓿H=1腿H=1wH=1iH=ҽ1[H=1MH=.1?H=x11H=1#H=1H=61H=x1H=1H=1ݾH=]1ϾH=1H=Z1賾H=1襾H=1藾H=X1艾H=1{H=1mH=.1_H=p1QH=1CH=15H=n1'H=1H=1 H=<1H=~1H=1H=1ӽH=D1ŽH=1跽H=71詽H=1蛽H=1荽H=61H=1qH=1cH= 1UH=F1GH=19H=1+H=1H=V1H=1H=1H= 1H=F1׼H=1ɼH=1軼H=L1譼H=1蟼H=1葼H=R1胼H=|1uH=1gH=1YH=1KH=D1=H=v1/H=1!H=1H=,1H=n1H=1H=1ۻH=l1ͻH=1迻H=?1豻H=1裻H=l1蕻H=1臻H=01yH=1kH=1]H=1OH=`1AH=13H=1%H=61H=1 H=1H=41H=~1ߺH=1ѺH="1úH=C1赺H=v1觺H='1虺H=1苺H=t1}H=1Hkf.Ht HHtH@1Ðf.HHt(HrHH=HHDH1D@f.ATUISHH諨ugL?HIuaA|$臬A|$uuwH׫蕧DH趫H[]A\DH|$ T$ 1u1fDH[]A\AT$H5 HQ!H81ͫD1AT$H5ff.AWAVAUATIUSIHH>tqHI1H81@H,L<HUHwFILH4HH豫IEHH9sTIJ|8跧1HtH}A,!11A<AD$IEHH9H[]A\A]A^A_fDHʐf.AWAVAUATIUSH5YHHHHxAp Iƅt$f.IvHttAMv0MuH5rHH IƅtEDIvH<t/Mv0MuH{X!f8Hx[]A\A]A^A_H$H޿SVHX!HHt+H;$u!HX!f8uH=(H1Ӻ딐H$HtsL5W!HHHHH IF 葥t}1HtiHW!f8AF1fDH=H1WfH}W!f8H=H1.fH5HHD$0HD$8HD$@HD$HHD$P$P t:sHIHD$0t#HH|$0IH?HD$PH=#H1蒹11HAHD$0Ht$LL$ IVLEDHD$HD$ H\$(AEHhV!f8AFH|$P11HT$0HHPH|$M H|$4H|$H=H1^H|$脔H=$H_L|$IH`E!LHLHD$D$$訕H=3H1LOLavH=H\H|$L迖D$$!Ll$PH5}LHE9tH$u HD$PHEH{@H5(Hx uHC@H8-u xlH{@t#H5HԸx tH=1耠$L|$$D D$LHHH蕋HHkLHI1HHHHA~*HHT:/u1H H</u H9uD$h%===@H=H1貟D$$H,LP9H=HLIl$.ADH= 1NL|$H5-LH5L薉H5L軌H=̻H襌H=H|$HHӳx$hL|$HPLD$$FH=HH=;HHӄHHH5H踉HIL$E1H/! LHHIt[LLLEL$sL$I9vH=GH1詚HL蹈HpL蚈H=H1iHT$DHL$ Ht$(LL$@EHHD$@HB BHHRHD$H3AtbEHE7!u,f8uH=1+H賄H[Df8uD腇H=H1ęHD$@HD$@ H6!f8tHd.!H0߄H=H1|HH=;1\pEAnEA_H5{Hex t,H{@?HD$x[D$$NH$H螆HtpLH LL$PHt$ADHHOH=H[1d(H=HH=ҹ]D$$rH=5!H H!%tDHJHD@H1H)H$t@Hw$H11ɀ8-HH9u1uЀ-uʀ -uĀ-u1-f.SH(5!H=H SIIL)HHHt 1LLDAHH9uH[]A\A]A^A_Ðf.f.@H Ht(UHSH HHHHuH[]HߌHERROR: %sWARNING: %sLog size = %lld, max = %lld -%Y%m%d_%H%M%S%s -> %s -> %sLOG_AUTHLOG_AUTHPRIVLOG_CRONLOG_DAEMONLOG_FTPLOG_KERNLOG_LPRLOG_MAILLOG_NEWSLOG_SYSLOGLOG_USERLOG_UUCPLOG_LOCAL0LOG_LOCAL1LOG_LOCAL2LOG_LOCAL3LOG_LOCAL4LOG_LOCAL5LOG_LOCAL6LOG_LOCAL7WARNING: Log size limit met but log file rotation turned off. Forcing log file rotation anyways. Need to rotate log file due to size but ran out of memory. Need to rotate log file due to size but could not get local time. ERROR: Can't open %s in append mode (check permissions!). WARNING: File locking not supported (NFS?)ERROR: %s is locked by another process POSIXLY_CORRECT%s: illegal option -- %c %s: unrecognized option `%s' %s: option `%s' is ambiguous %s: option requires an argument -- %c %s: option `--%s' doesn't allow an argument %s: option `--%s' requires an argument ERROR: optaddarg: Unregistered option %s ERROR: optaddarg: strdup() failed ERROR: optaddarg: malloc() failed ERROR: optparse: Can't register new option (not enough memory) ERROR: optparse: longopts[] is too small ERROR: optparse: shortopts[] is too small ERROR: optparse: (short|long)opts[] is too small ERROR: Please edit the example config file %s ERROR: Missing argument for option at line %d ERROR: Missing closing parenthesis in option %s at line %d ERROR: Empty argument for option %s at line %d ERROR: Incomplete option passed (missing argument) ERROR: optparse: No corresponding long name for option '-%c' ERROR: Parse error at line %d: Unknown option %s WARNING: Ignoring unsupported option %s at line %u WARNING: Ignoring unsupported option --%s (-%c) WARNING: Ignoring unsupported option --%s ERROR: Can't register argument for option %s ERROR: Can't register argument for option --%s WARNING: Ignoring deprecated option %s at line %u WARNING: Ignoring deprecated option --%s (-%c) WARNING: Ignoring deprecated option --%s ERROR: optparse: Can't compile regular expression %s for option %s ERROR: Incorrect argument format for option %s ERROR: Incorrect argument format for option --%s (-%c) ERROR: Incorrect argument format for option --%s ERROR: Option --%s (-%c) requires a non-empty string argument ERROR: Option --%s requires a non-empty string argument ERROR: Can't parse numerical argument for option %s ERROR: Can't parse numerical argument for option --%s (-%c) ERROR: Can't parse numerical argument for option --%s WARNING: Numerical value for option %s too high, resetting to 4G WARNING: Numerical value for option --%s (-%c) too high, resetting to 4G ERROR: optparse: calloc failed ERROR: optparse: strdup failed ERROR: Problem parsing options (name == NULL) Dump authenticode certificate chain.Perform HTML, script, and text normalizationAlways generate MDB entries for PE sectionsMaximum number of mismatched signatures when building a CVD. Zero disables this limit.Feature level to put in the CVDVersion number of the CVD to buildCreate a hybrid (standard and bytecode) database fileForce using the interpreter instead of the JITTrust loaded bytecode (default yes)Load and print bytecode information without executingPrint IR of bytecode signatureInput file to run the bytecode nDon't show source line during tracingName of the analyzer as seen in prewikkaSave all reports to a log file.By default the log file is locked for writing and only a single daemon process can write to it. This option disables the lock.Maximum size of the log file. Value of 0 disables the limit.Log all clean files. Useful in debugging but drastically increases the log size.Use the system logger (can work together with LogFile).Type of syslog messages. Please refer to 'man syslog' for the facility names.Rotate log file. Requires LogFileMaxSize option set prior to this option.Log additional information about the infected file, such as its size and hash, together with the virus name.Save the process ID to a file.This option allows you to change the default temporary directory.This option allows you to change the default database directory. If you enable it, please make sure it points to the same directory in both clamd and freshclam.Only load the official signatures published by the ClamAV project.By default, yara rules will be loaded. This option allows you to exclude yara rules when scanning and also to scan only using yara rules. Valid options are yes|no|onlyPath to a local socket file the daemon will listen on.Sets the group ownership on the unix socket.Sets the permissions on the unix socket to the specified mode.Remove a stale socket after unclean shutdownA TCP port number the daemon will listen on.By default clamd binds to INADDR_ANY. This option allows you to restrict the TCP address and provide some degree of protection from the outside world.Maximum length the queue of pending connections may grow to.Close the STREAM session when the data size limit is exceeded. The value should match your MTA's limit for the maximum attachment size.The STREAM command uses an FTP-like protocol. This option sets the lower boundary for the port range.This option sets the upper boundary for the port range.Maximum number of threads running at the same time.This option specifies the time (in seconds) after which clamd should timeout if a client doesn't provide any data.This option specifies the time (in seconds) after which clamd should timeout if a client doesn't provide any initial command after connecting.This option specifies how long to wait (in milliseconds) if the send buffer is full. Keep this value low to prevent clamd hanging.Waiting for data from clamd will timeout after this time (seconds).Maximum number of queued items (including those being processed by MaxThreads threads). It is recommended to have this value at least twice MaxThreads if possible. WARNING: you shouldn't increase this too much to avoid running out of file descriptors, the following condition should hold: MaxThreads*MaxRecursion + MaxQueue - MaxThreads + 6 < RLIMIT_NOFILE (usual max for RLIMIT_NOFILE is 1024) This option specifies how long (in seconds) the process should wait for a new job.Don't scan files/directories whose names match the provided regular expression. This option can be specified multiple times.Maximum depth the directories are scanned at.Follow symlinks to regular files.Scan files and directories on other filesystems.This option specifies the time intervals (in seconds) in which clamd should perform a database check.This option allows you to disable clamd's caching feature.Execute a command when a virus is found. In the command string %v will be replaced with the virus name. Additionally, two environment variables will be defined: $CLAM_VIRUSEVENT_FILENAME and $CLAM_VIRUSEVENT_VIRUSNAME./usr/bin/mailx -s "ClamAV VIRUS ALERT: %v" alert < /dev/nullStop the daemon when libclamav reports an out of memory condition.Permit use of the ALLMATCHSCAN command.Enable debug messages in libclamav.Don't remove temporary files (for debugging purposes).Run the daemon as a specified user (the process must be started by root).With this option enabled ClamAV will load bytecode from the database. It is highly recommended you keep this option on, otherwise you'll miss detections for many new viruses.Set bytecode security level. Possible values: TrustSigned - trust bytecode loaded from signed .c[lv]d files, insert runtime safety checks for bytecode loaded from other sources Paranoid - don't trust any bytecode, insert runtime checks for all Recommended: TrustSigned, because bytecode in .cvd files already has these checks.Set bytecode timeout in milliseconds.Allow loading bytecode from outside digitally signed .c[lv]d files.^(Auto|ForceJIT|ForceInterpreter|Test)$Set bytecode execution mode. Possible values: Auto - automatically choose JIT if possible, fallback to interpreter ForceJIT - always choose JIT, fail if not possible ForceInterpreter - always choose interpreter Test - run with both JIT and interpreter and compare results. Make all failures fatal.^(none|None|bytecode|Bytecode|pcre|PCRE)$Collect and print execution statistics. Possible values: Bytecode - reports bytecode statistics PCRE - reports PCRE execution statistics None - reports no statisticsDetect Potentially Unwanted Applications.Exclude a specific PUA category. This directive can be used multiple times. See https://www.clamav.net/documents/potentially-unwanted-applications-pua for the complete list of PUA categories.Only include a specific PUA category. This directive can be used multiple times.In some cases (eg. complex malware, exploits in graphic files, and others), ClamAV uses special algorithms to provide accurate detection. This option controls the algorithmic detection.PE stands for Portable Executable - it's an executable file format used in all 32- and 64-bit versions of Windows operating systems. This option allows ClamAV to perform a deeper analysis of executable files and it's also required for decompression of popular executable packers such as UPX or FSG. If you turn off this option, the original files will still be scanned, but without additional processing.Executable and Linking Format is a standard format for UN*X executables. This option allows you to control the scanning of ELF files. If you turn off this option, the original files will still be scanned, but without additional processing.With this option enabled clamav will try to detect broken executables (both PE and ELF) and mark them as Broken.Executable.Enable the built in email scanner. If you turn off this option, the original files will still be scanned, but without parsing individual messages/attachments.Scan RFC1341 messages split over many emails. You will need to periodically clean up $TemporaryDirectory/clamav-partial directory. WARNING: This option may open your system to a DoS attack. Please don't use this feature on highly loaded servers.With this option enabled ClamAV will try to detect phishing attempts by using signatures.Scan URLs found in mails for phishing attempts using heuristics.Always block cloaked URLs, even if they're not in the database. This feature can lead to false positives.PhishingAlwaysBlockSSLMismatchAlways block SSL mismatches in URLs, even if they're not in the database. This feature can lead to false positives.Detect partition intersections in raw disk images using heuristics.Allow heuristic match to take precedence. When enabled, if a heuristic scan (such as phishingScan) detects a possible virus/phish it will stop scan immediately. Recommended, saves CPU scan-time. When disabled, virus/phish detected by heuristic scans will be reported only at the end of a scan. If an archive contains both a heuristically detected virus/phish, and a real malware, the real malware will be reported. Keep this disabled if you intend to handle "*.Heuristics.*" viruses differently from "real" malware. If a non-heuristically-detected virus (signature-based) is found first, the scan is interrupted immediately, regardless of this config option.Enable the Data Loss Prevention module.This option sets the lowest number of Credit Card numbers found in a file to generate a detect.This option sets the lowest number of Social Security Numbers found in a file to generate a detect.With this option enabled the DLP module will search for valid SSNs formatted as xxx-yy-zzzz.With this option enabled the DLP module will search for valid SSNs formatted as xxxyyzzzzPerform HTML/JavaScript/ScriptEncoder normalisation and decryption. If you turn off this option, the original files will still be scanned, but without additional processing.This option enables scanning of OLE2 files, such as Microsoft Office documents and .msi files. If you turn off this option, the original files will still be scanned, but without additional processing.With this option enabled OLE2 files with VBA macros, which were not detected by signatures will be marked as "Heuristics.OLE2.ContainsMacros".This option enables scanning within PDF files. If you turn off this option, the original files will still be scanned, but without decoding and additional processing.This option enables scanning within SWF files. If you turn off this option, the original files will still be scanned, but without decoding and additional processing.This option enables scanning xml-based document files supported by libclamav. If you turn off this option, the original files will still be scanned, but without additional processing.This option enables scanning HWP3 files. If you turn off this option, the original files will still be scanned, but without additional processing.Scan within archives and compressed files. If you turn off this option, the original files will still be scanned, but without unpacking and additional processing.Mark encrypted archives as viruses (Encrypted.Zip, Encrypted.RAR).This option causes memory or nested map scans to dump the content to disk. If you turn on this option, more data is written to disk and is available when the leave-temps option is enabled at the cost of more disk writes.This option sets the maximum amount of data to be scanned for each input file. Archives and other containers are recursively extracted and scanned up to this value. The value of 0 disables the limit. WARNING: disabling this limit or setting it too high may result in severe damage.Files/messages larger than this limit won't be scanned. Affects the input file itself as well as files contained inside it (when the input file is an archive, a document or some other kind of container). The value of 0 disables the limit. WARNING: disabling this limit or setting it too high may result in severe damage to the system.Nested archives are scanned recursively, e.g. if a Zip archive contains a RAR file, all files within it will also be scanned. This option specifies how deeply the process should be continued. The value of 0 disables the limit. WARNING: disabling this limit or setting it too high may result in severe damage to the system.Number of files to be scanned within an archive, a document, or any other container file. The value of 0 disables the limit. WARNING: disabling this limit or setting it too high may result in severe damage to the system.This option sets the maximum size of a file to check for embedded PE. Files larger than this value will skip the additional analysis step. Negative values are not allowed. WARNING: setting this limit too high may result in severe damage or impact performance.This option sets the maximum size of a HTML file to normalize. HTML files larger than this value will not be normalized or scanned. Negative values are not allowed. WARNING: setting this limit too high may result in severe damage or impact performance.This option sets the maximum size of a normalized HTML file to scan. HTML files larger than this value after normalization will not be scanned. Negative values are not allowed. WARNING: setting this limit too high may result in severe damage or impact performance.This option sets the maximum size of a script file to normalize. Script content larger than this value will not be normalized or scanned. Negative values are not allowed. WARNING: setting this limit too high may result in severe damage or impact performance.This option sets the maximum size of a ZIP file to reanalyze type recognition. ZIP files larger than this value will skip the step to potentially reanalyze as PE. Negative values are not allowed. WARNING: setting this limit too high may result in severe damage or impact performance.This option sets the maximum number of partitions of a raw disk image to be scanned. Raw disk images with more partitions than this value will have up to the value number partitions scanned. Negative values are not allowed. WARNING: setting this limit too high may result in severe damage or impact performance.This option sets the maximum number of icons within a PE to be scanned. PE files with more icons than this value will have up to the value number icons scanned. Negative values are not allowed. WARNING: setting this limit too high may result in severe damage or impact performance.This option sets the maximum recursive calls to HWP3 parsing function. HWP3 files using more than this limit will be terminated and alert the user. Scans will be unable to scan any HWP3 attachments if the recursive limit is reached. Negative values are not allowed. WARNING: setting this limit too high may result in severe damage or impact performance.This clamscan option is currently for testing only. It sets the engine parameter CL_ENGINE_TIME_LIMIT. The value is in milliseconds.This option sets the maximum calls to the PCRE match function during an instance of regex matching. Instances using more than this limit will be terminated and alert the user but the scan will continue. For more information on match_limit, see the PCRE documentation. Negative values are not allowed. WARNING: setting this limit too high may severely impact performance.This option sets the maximum recursive calls to the PCRE match function during an instance of regex matching. Instances using more than this limit will be terminated and alert the user but the scan will continue. For more information on match_limit_recursion, see the PCRE documentation. Negative values are not allowed and values > PCREMatchLimit are superfluous. WARNING: setting this limit too high may severely impact performance.This option sets the maximum filesize for which PCRE subsigs will be executed. Files exceeding this limit will not have PCRE subsigs executed unless a subsig is encompassed to a smaller buffer. Negative values are not allowed. Setting this value to zero disables the limit. WARNING: setting this limit too high or disabling it may severely impact performance.This option enables on-access scanning (Linux only)This option specifies a directory or mount point which should be scanned on access. The mount point specified, or the mount point containing the specified directory will be watched, but only notifications will occur. If any directories are specified, this option will preempt the DDD system. It can also be used multiple times.This option specifies a directory (including all files and directories inside it), which should be scanned on access. This option can be used multiple times.This option allows excluding directories from on-access scanning. It can be used multiple times. Only works with DDD system.Use this option to whitelist the root UID (0) and allow any processes run under root to access all watched files without triggering scans.With this option you can whitelist specific UIDs. Processes with these UIDs will be able to access all files. This option can be used multiple times (one per line). Using a value of 0 on any line will disable this option entirely. To whitelist the root UID please enable the OnAccessExcludeRootUID option.Files larger than this value will not be scanned in on access.This option toggles the dynamic directory determination system for on-access scanning (Linux only).This option changes fanotify behavior to prevent access attempts on malicious files instead of simply notifying the user (On Access scan only).Enables extra scanning and notification after catching certain inotify events. Only works with the DDD system enabled.When started by root freshclam will drop privileges and switch to the user defined in this option.This option defined how many times daily freshclam should check for a database update.Use DNS to verify the virus database version. Freshclam uses DNS TXT records to verify the versions of the database and software itself. With this directive you can change the database verification domain. WARNING: Please don't change it unless you're configuring freshclam to use your own database verification domain.DatabaseMirror specifies to which mirror(s) freshclam should connect. You should have at least two entries: db.XY.clamav.net (or db.XY.ipv6.clamav.net for IPv6) and database.clamav.net (in this order). Please replace XY with your country code (see https://www.iana.org/domains/root/db). database.clamav.net is a round-robin record which points to our most reliable mirrors. It's used as a fall back in case db.XY.clamav.net is not working.db.XY.clamav.net database.clamav.netThis option allows you to easily point freshclam to private mirrors. If PrivateMirror is set, freshclam does not attempt to use DNS to determine whether its databases are out-of-date, instead it will use the If-Modified-Since request or directly check the headers of the remote database files. For each database, freshclam first attempts to download the CLD file. If that fails, it tries to download the CVD file. This option overrides DatabaseMirror, DNSDatabaseInfo and Scripted Updates. It can be used multiple times to provide fall-back mirrors.mirror1.mynetwork.com mirror2.mynetwork.comThis option defines how many attempts freshclam should make before giving up.With this option you can control scripted updates. It's highly recommended to keep them enabled.With this option enabled, freshclam will attempt to load new databases into memory to make sure they are properly handled by libclamav before replacing the old ones.By default freshclam will keep the local databases (.cld) uncompressed to make their handling faster. With this option you can enable the compression. The change will take effect with the next database update.Download an additional 3rd party signature database distributed through the ClamAV mirrors. This option can be used multiple times.With this option you can provide custom sources (http:// or file://) for database files. This option can be used multiple times.http://myserver.com/mysigs.ndb file:///mnt/nfs/local.hdbIf you're behind a proxy, please enter its address here.A user name for the HTTP proxy authentication.A password for the HTTP proxy authentication.If your servers are behind a firewall/proxy which does a User-Agent filtering you can use this option to force the use of a different User-Agent header.Send the RELOAD command to clamd after a successful update.Run a command after a successful database update.Run a command when a database update error occurs.Run a command when freshclam reports an outdated version. In the command string %v will be replaced with the new version number.With this option you can provide a client address for the database downloading. Useful for multi-homed systems.Timeout in seconds when connecting to database server.Timeout in seconds when reading from database server.This option enables support for Google Safe Browsing. When activated for the first time, freshclam will download a new database file (safebrowsing.cvd) which will be automatically loaded by clamd and clamscan during the next reload, provided that the heuristic phishing detection is turned on. This database includes information about websites that may be phishing sites or possible sources of malware. When using this option, it's mandatory to run freshclam at least every 30 minutes. Freshclam uses the ClamAV's mirror infrastructure to distribute the database and its updates but all the contents are provided under Google's terms of use. See https://transparencyreport.google.com/safe-browsing/overview and https://www.clamav.net/documents/safebrowsing for more information.This option enables downloading of bytecode.cvd, which includes additional detection mechanisms and improvements to the ClamAV engine.Disable authenticode certificate chain verification in PE files.Initialize a supplementary group access (the process must be started by root).Define the clamd socket to connect to for scanning. This option is mandatory! Syntax: ClamdSocket unix:path ClamdSocket tcp:host:port The first syntax specifies a local unix socket (needs an absolute path) e.g.: ClamdSocket unix:/var/run/clamd/clamd.socket The second syntax specifies a tcp local or remote tcp socket: the host can be a hostname or an ip address; the ":port" field is only required for IPv6 addresses, otherwise it defaults to 3310 ClamdSocket tcp:192.168.0.1 This option can be repeated several times with different sockets or even with the same socket: clamd servers will be selected in a round-robin fashion.Define the interface through which we communicate with sendmail. This option is mandatory! Possible formats are: [[unix|local]:]/path/to/file - to specify a unix domain socket; inet:port@[hostname|ip-address] - to specify an ipv4 socket; inet6:port@[hostname|ip-address] - to specify an ipv6 socket./tmp/clamav-milter.socket inet:7357Define the group ownership for the (unix) milter socket.Sets the permissions on the (unix) milter socket to the specified mode.Messages originating from these hosts/networks will not be scanned This option takes a host(name)/mask pair in CIRD notation and can be repeated several times. If "/mask" is omitted, a host is assumed. To specify a locally originated, non-smtp, email use the keyword "local".local 192.168.0.0/24 1111:2222:3333::/48^(Accept|Reject|Defer|Blackhole|Quarantine)$Action to be performed on clean messages (mostly useful for testing). The following actions are available: Accept: the message is accepted for delivery Reject: immediately refuse delivery (a 5xx error is returned to the peer) Defer: return a temporary failure message (4xx) to the peer Blackhole: like Accept but the message is sent to oblivion Quarantine: like Accept but message is quarantined instead of being deliveredAction to be performed on error conditions (this includes failure to allocate data structures, no scanners available, network timeouts, unknown scanner replies and the like. The following actions are available: Accept: the message is accepted for delivery; Reject: immediately refuse delivery (a 5xx error is returned to the peer); Defer: return a temporary failure message (4xx) to the peer.This option allows you to set a specific rejection reason for infected messages and it's therefore only useful together with "OnInfected Reject" The string "%v", if present, will be replaced with the virus name.If this option is set to "Replace" (or "Yes"), an "X-Virus-Scanned" and an "X-Virus-Status" headers will be attached to each processed message, possibly replacing existing headers. If it is set to Add, the X-Virus headers are added possibly on top of the existing ones. Note that while "Replace" can potentially break DKIM signatures, "Add" may confuse procmail and similar filters.When AddHeader is in use, this option allows you to set the reported hostname. This may be desirable in order to avoid leaking internal names. If unset the real machine name is used.Execute a command when an infected message is processed. The following parameters are passed to the invoked program in this order: virus name, queue id, sender, destination, subject, message id, message date. Note #1: this requires MTA macroes to be available (see LogInfected below) Note #2: the process is invoked in the context of clamav-milter Note #3: clamav-milter will wait for the process to exit. Be quick or fork to avoid unnecessary delays in email delivery/usr/local/bin/my_infected_message_handlerChroot to the specified directory. Chrooting is performed just after reading the config file and before dropping privileges.This option specifies a file which contains a list of basic POSIX regular expressions. Addresses (sent to or from - see below) matching these regexes will not be scanned. Optionally each line can start with the string "From:" or "To:" (note: no whitespace after the colon) indicating if it is, respectively, the sender or recipient that is to be whitelisted. If the field is missing, "To:" is assumed. Lines starting with #, : or ! are ignored.Messages from authenticated SMTP users matching this extended POSIX regular expression (egrep-like) will not be scanned. As an alternative, a file containing a plain (not regex) list of names (one per line) can be specified using the prefix "file:". e.g. SkipAuthenticated file:/etc/good_guys Note: this is the AUTH login name!SkipAuthenticated ^(tom|dick|henry)$This option allows you to tune what is logged when a message is infected. Possible values are Off (the default - nothing is logged), Basic (minimal info logged), Full (verbose info logged) Note: For this to work properly in sendmail, make sure the msg_id, mail_addr, rcpt_addr and i macroes are available in eom. In other words add a line like: Milter.macros.eom={msg_id}, {mail_addr}, {rcpt_addr}, i to your .cf file. Alternatively use the macro: define(`confMILTER_MACROS_EOM', `{msg_id}, {mail_addr}, {rcpt_addr}, i') Postfix should be working fine with the default settings.This option allows you to tune what is logged when no threat is found in a scanned message. See LogInfected for possible values and caveats. Useful in debugging but drastically increases the log size.This option affects the behaviour of LogInfected, LogClean and VirusAction when a message with multiple recipients is scanned: If SupportMultipleRecipients is off (the default) then one single log entry is generated for the message and, in case the message is determined to be malicious, the command indicated by VirusAction is executed just once. In both cases only the last recipient is reported. If SupportMultipleRecipients is on: then one line is logged for each recipient and the command indicated by VirusAction is also executed once for each recipient. Note: although it's probably a good idea to enable this option, the default value is currently set to off for legacy reasons.yesExampleERROR: Unknown option passed footruehelp^(yes|true|1|no|false|0)$config-file/etc/clamd.conf/etc/freshclam.conf/etc/clamav-milter.confdebuggen-jsondumpcertsquietleave-tempsno-warningsshow-progressstdoutdaemonno-dnslist-mirrorsupdate-dbreloadmultiscanfdpassstreamallmatchdatabase/usr/share/clamavrecursivegen-mdbfollow-dir-symlinks^[0-9]+$follow-file-symlinksbellno-summaryfile-listinfectedsuppress-ok-resultscopyremoveexcludeexclude-dirinclude-dirstructured-ssn-formathex-dumpmd5sha1sha256impprint-certshtml-normaliseascii-normaliseutf16-decodebuildmax-bad-sigs3000flevelcvd-versionno-cdiffserverunpackunpack-currentinfolist-sigsfind-sigsdecode-sigstest-sigsvbavba-hexcomparerun-cdiffverify-cdiffhybriddefaultcolorsconfig-dir/etcnon-defaultgenerate-configforce-interpretertrust-bytecodeprintsrcPrint source code of bytecodeprintbcirinputtracebytecode trace levelno-trace-showsourcearchive-verbosebytecode-trust-allhttp-proxyproxy-userlog-verboseforcedisable-summarydisable-archiveno-archiveno-peno-elfno-ole2no-pdfno-htmlno-mailno-phishing-sigsno-phishing-scan-urlsno-algorithmicno-phishing-restrictedscanmax-ratiomax-space^[0-9]+[KM]?$unzipunrararjunzoolhajartartgzdebblock-maxPreludeEnableprelude-enableEnable preludePreludeAnalyzerNameprelude-analyzer-name/tmp/clamav.logLogFileUnlockLogFileMaxSizeLogTimeLog time with each message.LogCleanLogSyslogLogFacilityLogVerboseEnable verbose logging.LogRotatelog-rotateExtendedDetectionInfoPidFile/var/run/clam.pidTemporaryDirectorytempdir/tmpDatabaseDirectorydatadir/var/lib/clamavOfficialDatabaseOnlyofficial-db-onlynoYaraRulesyara-rulesLocalSocket/tmp/clamd.socketLocalSocketGroupvirusgroupLocalSocketMode660FixStaleSocketTCPSocket3310TCPAddr127.0.0.1MaxConnectionQueueLength30StreamMaxLength25MStreamMinPort1024StreamMaxPort2048MaxThreads120CommandReadTimeoutSendBufTimeout200300MaxQueueIdleTimeout^/proc/ ^/sys/MaxDirectoryRecursionmax-dir-recursion15FollowDirectorySymlinksFollow directory symlinks.FollowFileSymlinksCrossFilesystemscross-fsSelfCheck600DisableCachedisable-cacheVirusEventExitOnOOMAllowAllMatchScanForegroundforegroundDon't fork into background.DebugLeaveTemporaryFilesUserBytecodeBytecodeSecurity^(TrustSigned|Paranoid)$TrustSignedBytecodeTimeoutbytecode-timeout5000BytecodeUnsignedbytecode-unsignedBytecodeModebytecode-modeAutoStatisticsstatisticsNoneDetectPUAdetect-puaExcludePUAexclude-puaNetTool PWToolIncludePUAinclude-puaSpy Scanner RATAlgorithmicDetectionalgorithmic-detectionScanPEscan-peScanELFscan-elfDetectBrokenExecutablesdetect-brokenScanMailscan-mailScanPartialMessagesPhishingSignaturesPhishingScanURLsPhishingAlwaysBlockCloakphishing-cloakphishing-sslPartitionIntersectionpartition-intersectionHeuristicScanPrecedenceheuristic-scan-precedenceStructuredDataDetectiondetect-structuredStructuredMinCreditCardCountstructured-cc-countStructuredMinSSNCountstructured-ssn-countStructuredSSNFormatNormalStructuredSSNFormatStrippedScanHTMLscan-htmlScanOLE2scan-ole2OLE2BlockMacrosblock-macrosScanPDFscan-pdfScanSWFscan-swfScanXMLDOCSscan-xmldocsScanHWP3scan-hwp3ScanArchivescan-archiveArchiveBlockEncryptedblock-encryptedForceToDiskforce-to-diskmax-scansize100Mmax-recursion16max-files10000MaxEmbeddedPEmax-embeddedpe10MMaxHTMLNormalizemax-htmlnormalizeMaxHTMLNoTagsmax-htmlnotags2MMaxScriptNormalizemax-scriptnormalizeMaxZipTypeRcgmax-ziptypercg1MMaxPartitionsmax-partitions128MaxIconsPEmax-iconspe100MaxRecHWP3max-rechwp3TimeLimittimelimitPCREMatchLimitpcre-match-limit100000PCRERecMatchLimitpcre-recmatch-limitPCREMaxFileSizepcre-max-filesizeOnAccessMountPath/ /home/userOnAccessIncludePathon-access-include/home /studentsOnAccessExcludePath/home/bofh /rootOnAccessExcludeRootUIDOnAccessExcludeUIDOnAccessMaxFileSizeOnAccessDisableDDDdisable-dddOnAccessPreventionOnAccessExtraScanningDevACOnlydev-ac-onlyDevACDepthdev-ac-depthDevPerformancedev-performanceDevLiblogdev-liblogUpdateLogFile/var/log/freshclam.logDatabaseOwnerCheckschecksDNSDatabaseInfocurrent.cvd.clamav.netDatabaseMirrorPrivateMirrorMaxAttemptsScriptedUpdatesTestDatabasesCompressLocalDatabaseExtraDatabasedbname1 dbname2DatabaseCustomURLHTTPProxyServeryour-proxyHTTPProxyPortHTTP proxy's port8080HTTPProxyUsernameusernameHTTPProxyPasswordHTTPUserAgentNotifyClamddaemon-notifyOnUpdateExecuteon-update-executecommandOnErrorExecuteon-error-executeOnOutdatedExecuteon-outdated-executeLocalIPAddresslocal-addressaaa.bbb.ccc.dddConnectTimeoutReceiveTimeoutSafeBrowsingDisableCertChecknocertsMailMaxRecursionArchiveMaxScanSizeArchiveMaxRecursionArchiveMaxFilesArchiveMaxCompressionRatioArchiveBlockMaxArchiveLimitMemoryUsageMailFollowURLsmail-follow-urlsClamukoScanOnAccessClamukoScannerCountClamukoScanOnOpenClamukoScanOnCloseClamukoScanOnExecClamukoIncludePathClamukoExcludePathClamukoExcludeUIDClamukoMaxFileSizeAllowSupplementaryGroupsClamdSockettcp:scanner.mydomain:7357MilterSocketMilterSocketGroupMilterSocketModeLocalNetOnCleanAcceptOnInfectedQuarantineOnFail^(Accept|Reject|Defer)$DeferRejectMsgMTA specificAddHeader^(No|Replace|Yes|Add)$ReplaceReportHostnamemy.mail.server.nameVirusActionChroot/newrootWhitelist/etc/whitelisted_addressesSkipAuthenticatedLogInfectedBasicSupportMultipleRecipients%s/%s%s/%s.%03u~%s: copied to '%s' !Can't copy file '%s' !Can't unlink '%s': %s ~%s: moved to '%s' !Can't move file %s !Can't remove file '%s'. ~%s: Removed. !'%s' doesn't exist or is not a directory 0.100.2%s/daily.cvd%s/daily.cldClamAV %s ClamAV %s/%u/%s/dev/nullCan't open /dev/null dup2(%d, %d) failed %s/Unable to allocate memory for db directory... ERROR: This tool requires libclamav with functionality level %u or higher (current f-level: %u) ERROR: --file-list: Can't open file %s (*) Default scan settings movedcopiedsetrlimitKnown viruses: %u Engine version: %s Scanned directories: %u Scanned files: %u Infected files: %u Total errors: %u Not removed: %u Not %s: %u Data scanned: %2.2lf MB Clam AntiVirus: Scanner %s By The ClamAV Team: https://www.clamav.net/about.html#credits (C) 2007-2018 Cisco Systems, Inc. clamscan [options] [file/directory/-] --help -h Show this help --version -V Print version number --verbose -v Be verbose --archive-verbose -a Show filenames inside scanned archives --debug Enable libclamav's debug messages --quiet Only output error messages --stdout Write to stdout instead of stderr --no-summary Disable summary at end of scanning --infected -i Only print infected files --suppress-ok-results -o Skip printing OK files --bell Sound bell on virus detection --tempdir=DIRECTORY Create temporary files in DIRECTORY --leave-temps[=yes/no(*)] Do not remove temporary files --gen-json[=yes/no(*)] Generate JSON description of scanned file(s). JSON will be printed and also- dropped to the temp directory if --leave-temps is enabled. --database=FILE/DIR -d FILE/DIR Load virus database from FILE or load all supported db files from DIR --official-db-only[=yes/no(*)] Only load official signatures --log=FILE -l FILE Save scan report to FILE --recursive[=yes/no(*)] -r Scan subdirectories recursively --allmatch[=yes/no(*)] -z Continue scanning within file after finding a match --cross-fs[=yes(*)/no] Scan files and directories on other filesystems --follow-dir-symlinks[=0/1(*)/2] Follow directory symlinks (0 = never, 1 = direct, 2 = always) --follow-file-symlinks[=0/1(*)/2] Follow file symlinks (0 = never, 1 = direct, 2 = always) --file-list=FILE -f FILE Scan files from FILE --remove[=yes/no(*)] Remove infected files. Be careful! --move=DIRECTORY Move infected files into DIRECTORY --copy=DIRECTORY Copy infected files into DIRECTORY --exclude=REGEX Don't scan file names matching REGEX --exclude-dir=REGEX Don't scan directories matching REGEX --include=REGEX Only scan file names matching REGEX --include-dir=REGEX Only scan directories matching REGEX --bytecode[=yes(*)/no] Load bytecode from the database --bytecode-unsigned[=yes/no(*)] Load unsigned bytecode --bytecode-timeout=N Set bytecode timeout (in milliseconds) --statistics[=none(*)/bytecode/pcre] Collect and print execution statistics --detect-pua[=yes/no(*)] Detect Possibly Unwanted Applications --exclude-pua=CAT Skip PUA sigs of category CAT --include-pua=CAT Load PUA sigs of category CAT --detect-structured[=yes/no(*)] Detect structured data (SSN, Credit Card) --structured-ssn-format=X SSN format (0=normal,1=stripped,2=both) --structured-ssn-count=N Min SSN count to generate a detect --structured-cc-count=N Min CC count to generate a detect --scan-mail[=yes(*)/no] Scan mail files --phishing-sigs[=yes(*)/no] Signature-based phishing detection --phishing-scan-urls[=yes(*)/no] URL-based phishing detection --heuristic-scan-precedence[=yes/no(*)] Stop scanning as soon as a heuristic match is found --phishing-ssl[=yes/no(*)] Always block (flag) SSL mismatches in URLs (phishing module) --phishing-cloak[=yes/no(*)] Always block (flag) cloaked URLs (phishing module) --partition-intersection[=yes/no(*)] Detect partition intersections in raw disk images using heuristics --algorithmic-detection[=yes(*)/no] Algorithmic detection --normalize[=yes(*)/no] Normalize html, script, and text files. Use normalize=no for yara compatibility --scan-pe[=yes(*)/no] Scan PE files --scan-elf[=yes(*)/no] Scan ELF files --scan-ole2[=yes(*)/no] Scan OLE2 containers --scan-pdf[=yes(*)/no] Scan PDF files --scan-swf[=yes(*)/no] Scan SWF files --scan-html[=yes(*)/no] Scan HTML files --scan-xmldocs[=yes(*)/no] Scan xml-based document files --scan-hwp3[=yes(*)/no] Scan HWP3 files --scan-archive[=yes(*)/no] Scan archive files (supported by libclamav) --detect-broken[=yes/no(*)] Try to detect broken executable files --block-encrypted[=yes/no(*)] Block (flag) encrypted archives --block-macros[=yes/no(*)] Block (flag) OLE2 files with VBA macros --block-max[=yes/no(*)] Block (flag) files that exceed max file size, max scan size, or max recursion limit --nocerts Disable authenticode certificate chain verification in PE files --dumpcerts Dump authenticode certificate chain in PE files --max-filesize=#n Files larger than this will be skipped and assumed clean --max-scansize=#n The maximum amount of data to scan for each container file (**) --max-files=#n The maximum number of files to scan for each container file (**) --max-recursion=#n Maximum archive recursion level for container file (**) --max-dir-recursion=#n Maximum directory recursion level --max-embeddedpe=#n Maximum size file to check for embedded PE --max-htmlnormalize=#n Maximum size of HTML file to normalize --max-htmlnotags=#n Maximum size of normalized HTML file to scan --max-scriptnormalize=#n Maximum size of script file to normalize --max-ziptypercg=#n Maximum size zip to type reanalyze --max-partitions=#n Maximum number of partitions in disk image to be scanned --max-iconspe=#n Maximum number of icons in PE file to be scanned --max-rechwp3=#n Maximum recursive calls to HWP3 parsing function --pcre-match-limit=#n Maximum calls to the PCRE match function. --pcre-recmatch-limit=#n Maximum recursive calls to the PCRE match function. --pcre-max-filesize=#n Maximum size file to perform PCRE subsig matching. --disable-cache Disable caching and cache checks for hash sums of scanned files. Pass in - as the filename for stdin. (**) Certain files (e.g. documents, archives, etc.) may in turn contain other files inside. The above options ensure safe processing of this kind of data. !Can't parse command line options # ------------------------------------------------------------------------------- !Problem with internal logger. ----------- SCAN SUMMARY ----------- Data read: %2.2lf MB (ratio %.2f:1) Time: %u.%3.3u sec (%u m %u s) P?(filename not set)~%s: %s FOUND ERROR: setgid(%d) failed. ERROR: setuid(%d) failed. ...~%s: Excluded ~%s: Excluded (/proc) ~%s: Empty file ~%s: Access denied *Scanning %s ^Can't open file %s: %s ~%s%s!(%llu)%s: %s FOUND ~%s!(%llu): %s FOUND ~%s: OK ~%s: %s ERROR %s: Symbolic link ~%s: Can't open directory. CL_TYPE_%s:%s*Scanning %s%s!%s .%sForceJITForceInterpreterTestpcre/procwb!Can't open %s for writing !Can't write to %s *Checking %s stdinstdin: OK stdin: %s ERROR ^%s: Can't access file ^%s: Not supported file type noneHostID is valid: %s Unable to allocate memory in scanfile() !scandirs: Memory allocation failed for fname !--follow-dir-symlinks: Invalid argument !--follow-file-symlinks: Invalid argument !Can't initialize libclamav: %s !Can't initialize antivirus engine !Can't allocate memory for pua_cats !--exclude-pua and --include-pua cannot be used at the same time !cli_engine_set_str(CL_ENGINE_PUA_CATEGORIES) failed: %s !cli_engine_set_str(CL_ENGINE_TMPDIR) failed: %s !cli_engine_set_num(CL_ENGINE_PCRE_MATCH_LIMIT) failed: %s !cli_engine_set_num(CL_ENGINE_PCRE_RECMATCH_LIMIT) failed: %s !Database initialization error: %s !cli_engine_set_num(CL_ENGINE_MAX_SCANSIZE) failed: %s !cli_engine_set_num(CL_ENGINE_MAX_FILESIZE) failed: %s ^System limit for file size is lower than engine->maxfilesize ^System limit for file size is lower than engine->maxscansize ^Cannot obtain resource limits for file size !cli_engine_set_num(CL_ENGINE_MAX_FILES) failed: %s !cli_engine_set_num(CL_ENGINE_MAX_RECURSION) failed: %s !cli_engine_set_num(CL_ENGINE_MAX_EMBEDDEDPE) failed: %s !cli_engine_set_num(CL_ENGINE_MAX_HTMLNORMALIZE) failed: %s !cli_engine_set_num(CL_ENGINE_MAX_HTMLNOTAGS) failed: %s !cli_engine_set_num(CL_ENGINE_MAX_SCRIPTNORMALIZE) failed: %s !cli_engine_set_num(CL_ENGINE_MAX_ZIPTYPERCG) failed: %s !cli_engine_set_num(CL_ENGINE_MAX_PARTITIONS) failed: %s !cli_engine_set_num(CL_ENGINE_MAX_ICONSPE) failed: %s !cli_engine_set_num(CL_ENGINE_MAX_RECHWP3) failed: %s !cli_engine_set_num(CL_ENGINE_TIME_LIMIT) failed: %s !cli_engine_set_num(CL_ENGINE_PCRE_MAX_FILESIZE) failed: %s !Invalid argument for --structured-ssn-format !cli_engine_set_num(CL_ENGINE_MIN_SSN_COUNT) failed: %s !cli_engine_set_num(CL_ENGINE_MIN_CC_COUNT) failed: %s !Can't get absolute pathname of current working directory !Can't write to temporary directory !Can't generate tempfile name ^Only scanning files from --file-list (files passed at cmdline are ignored) ;0 Pp8Hx0H(`h@hxHh  XhHh88 P h x  p   ! !8 & * h,8 -p hE F F (GH zRx *zRx $FJ w?;*3$"LDBBB B(A0A8Jb 8A0A(B BBBH P7Hb F LpBBB B(A0A8G 8A0A(B BBBE L BBB B(A0A8G  8D0A(B BBBG 4TbBDH A ABF AFBd4BBE B(D0A8N@ 8A0A(B BBBI D 8F0A(B BBBE |BBE B(H0A8J^ 8A0A(B BBBJ J 8D0A(B BBBI v 8G0D(B BBBE t 4eFAJ } CAF DDA<BBD A(J0h (A ABBG dBBE B(D0A8RP 8A0A(B BBBH L 8C0A(B BBBA 4eFAJ } CAF DDA,KAD AB\BBE B(D0A8J,,D,X,C, 8D0A(B BBBA LBBE B(D0A8IGUBW 8C0A(B BBBA n 8C0A(B BBBA U 8A0A(B BBBA LBBA A(G@ (A ABBA b (A ABBA ,,AAG0d AAA ,\8 AAG0Q AAD :AP O YD8#BAH Jo  CABF t  CABF  l  0BBB B(A0A8D@IHKPYHA@| 8A0A(B BBBF  8D0A(B BBBO T| BBB A(D0D@ 0D(A BBBM k 0A(A BBBE ` @D{< HAA h ABK  HBK , LD BBH A(H@/ (F ABBA B (C ABBA D@BAF MX  CABD X  EABH  <~BAH GM  CABK G CAB4D|\TBBB B(D0A8JAG^B 8C0A(B BBBA 2D@BAD I0  AABF l  FABA L, BBB B(D0A8G@ 8A0D(B BBBG L| BBB B(D0A8W 8A0A(B BBBD L HBBE B(D0A8S 8A0A(B BBBJ \ BBB A(A0D  0C(A BBBJ X 0C(A BBBF 4| ( JAGb CAH XL `BBI B(A0A8JBp 8A0A(B BBBK  8$ (9Ay F U K CDD 9eBBE B(H0H8M@r8A0A(B BBB 9>@ G@PT@H]@h@Xp@y@0@@8>@ @(@@@@@ƥ@ѥ@ܥ@@@@ AhA1A1A*Ac6A1A1A*AFA1A1A*AcZA1A1A[AVA1A1ArAA+1A1AxAA)1A1AAvA:1A1AAA@1AAA:1A1AAA1A1AAA1A1AAA1A1AAA:1A1AAdA1A1AAA1A1AAA1A1AA1A1AAA1A1AAmA1A1AAA1A1AAA1A1AAzA1A1A)AA0@1A AdA1A1A&ArA1A1A0AA`@1A8ALA1A1AUALA1A1AjAA1A1AoAA1A1AzAf1A1AAiA1A1AAoA1A1AA1A1AA1A1AAA1A1AA1A1AA1A1A+A1A1AA1A1AALA1A1AAA 1A1AAA 1A1AAA 1A1AAA 1A1A4AA 1A1AAA 1A1AA 1A1A A 1A1AA 1A1A+A 1A1A8Ab 1A1A>ALA @KAPALA] @1AWALA @1A%AA 1A1AcAA 1A1AlA 1A1AsAu 1A1AzA 1A1AAi 1A1AAlA 1A1AAfA 1A1AAA 1A1AA 1A1AA 1A1AA 1A1AAd 1A1AAc 1A1AAr 1A1AA 1A1AAA 0@1AAdA1A1AAcA@1A1AAnA@1A1AAg@1A1A$AfAh@1A6AtA@1AAiA@1AEApANA1AlAcA@1AvAr@1A|ATLAA1AAsA@@1AAaA1A1AAtA1A1AA1A1AA1A1AA1A1AAA1A1AAA1A1A AA1A1A AA1A1A! AA1A1A' AA1A1A. AA1A1A6 AA1A1A= AA1A1AE AA1A1AM AA1A1A^ AA1A1At AA1A1A AA1A1A ALA1A1A A A1A1A AA1A1A AA1A1A AA1A1A AA1A1A AA1A1A AA1A1A AA1A1A AA1A1A AA1A1A /A AA 1A1A A!AA!A !A4!Ah@>,AY,Al@J!AZ!AA@Ah!A A8@U#Aw!AA!AA!AAx@A!AAг@A!A@@@!AA!AA!A!AAX@A!AA@A"A"Ap@"A""A5"A-8@="AB"AT"AA#@\"Al"A"AA (@"A"A"Ap@A"A@"A"AP@"A"A@"A"AA@A#ALA@#A#A @#A(#ALA@A#AD#A A@T#AX#ALA@f#Ak#ALA@y#A~#ALA  @#A#ALAxX@#A#ALAк@$A#ALA`@#A#ALAx@#A#ALAd0@#A#ALA@"A/A@#A#A#ALA @$A$AA$A"A9$AAȾ@"AL$A]$AA @Af$ALAX(@p$At$A$AA @"A$Aп@@$AA@A$AA8@A$A$AFA$A"A$AA`@"A$AA@"A%A@e"A%AcAA @A%A!%A:%A@:%AF%AV%ALA @g%Al%A}%AA 8@"A%A%A@%A @%A%A%A@@%A%A%AA @A%A%A @%A&A&A @&A,&AA&AA @AW&A^&AA @Af&An&AA P@Aw&A&AA @@A&A&AA @A&AA`@"A&AP AA X@A&Aa AA @A&A'AA @"Ap@'AA @1A'A3'AA @AJ'Ab'AA P@A|'A'AA @"A'A'ALA @$A'A'ALA p@$A(AA@A(AA8@"A8(AA(AA @AK(AT(AA H@A^(An(AA @"A{(A(AA @A(A(AA P@A(A(AA @A(A(AA @A(A(AA H@A(A(AA @"A)A)AA 8@"A.A")A A@ @/)A*A*A A 8@T#A.A4)ALA @B)A.AE)ALA' @O)AU)Ac)A A @r)Av)A)A A @r)A)A)A A @)A)A)A AP @U#A)A)A A @)A*A*ALA2 @*A!*A,*ALAd (@8*A<*AG*ALA H@B)AS*A]*ALA@*Ag*Av*ALA 8@*A*A*ALA @g%A*A*A A h@T#AU/AA@"A*A@*A*A +AP@+A++A@?+AP+AAp@"Ag+ALA@*Az+A AP8@U#A+A+AAx@"A+AA@A+AAp@A+A+AA 1A1A+A+ALA 1A1A,A,AA 1A1A#,A-,AA1A1A8,AY,Al@F,A],AAue"A@e"Ak,Ar,AcLA P@h#Ay,A,A@,A,A@@,A@@,ALA @$A,AAp@A,AA@A,AA@1A,AX@ -A-A@h@--A@=-AH-ALAV-Ah-Am-A@-A-A@A-AH@ A-A-A6A@A-A-A(@-A-A-A`@-A .A.A@-A2.AA.Aa @O.A_.ALA@A#An.ALA@A#A}.AAAA%AAAA.A.AA A"A.A1A1A.A1A1A.A1A1A.A1A1A.A1A1A/AA1A1A/AA1A1A./A=/AA 1A1AN/AA1A1Ab/ALA1A1Av/AA1A1A/AA1A1A/AA1A1A/A1A1A/A1A1A/ALA1A1A/A AP1A1A/AAA"A0A0A0A70AAAD0AA"AV0AHA"Ag0AA Ap0A Ax0A Ax0A0A A0A A0A0A0A0A A0A0A@ A0A0A0A"AA0A0AA 1A1APA(A)1AXA01A91AAC1A^1AAAp1AA|1A!AXA|1A1AA(AA(AA1A1AB"A1A1A$AA1A1Aw&AA1A1A$AA1A1A"A1A1A./AA1A1A.A A1A1A.ALA1A1A.ALA1A1A&AA1A1A(AA1A1A8(AA1A1A&AA1A1AK(AA1A1AW&AA1A1AD#A A1A1A#A1A1A#ALA1A1A""A1A1A %4AK^ $@ ؤ@x@@@  a @8@ o@oo@PaF$@V$@f$@v$@$@$@$@$@$@$@$@$@%@%@&%@6%@F%@V%@f%@v%@%@%@%@%@%@%@%@%@&@&@&&@6&@F&@V&@f&@v&@&@&@&@&@&@&@&@&@'@'@&'@6'@F'@V'@f'@v'@'@'@'@'@'@'@'@'@(@(@&(@6(@F(@V(@f(@v(@(@(@(@(@(@(@(@(@)@)@&)@6)@F)@V)@f)@v)@)@)@)@)@)@)@)@)@*@*@&*@6*@F*@V*@f*@v*@*@*@*@*@*@*@*@*@duaGCC: (GNU) 5.3.0GCC: (GNU) 5.5.0.shstrtab.interp.note.ABI-tag.hash.dynsym.dynstr.gnu.version.gnu.version_r.rela.dyn.rela.plt.init.plt.got.text.fini.rodata.eh_frame_hdr.eh_frame.ctors.dtors.jcr.data.rel.ro.dynamic.got.plt.data.bss.comment 8@8T@T !x@x' @ /@7o@Do@S8@8]B@ g$@$$b0$@0$m+@+v+@+y|ؤ@ؤ@h]Ah]^A^ xsaxssassassasY PaPpqa8axxax*a 0"usr/bin/clamconf0100755000000000000000000026513013365330320012653 0ustar rootrootELF>-@@c@8 @@@@@@88@8@@@44 xxaxa]a @]@]a@]appTT@T@ Ptdpp@p@QtdRtdxxaxa[[/lib64/ld-linux-x86-64.so.2GNU CL&? 7@,3IEHF2"*KJ8#4 -:(A6CG=D;5)9!'$%0 +>1B</. OCW)p:  Jfx]@W^ 8bao 3(n  OfB@_ba!_baWXfa~IAwyba:(Pba0ba0Y @Clibclamav.so.7__gmon_start___Jv_RegisterClasseshave_clamjitcli_detect_environmentcl_initcli_strbcasestr_ITM_deregisterTMCloneTable_ITM_registerTMCloneTablecli_printcxxverget_fpu_endiancl_retdbdircli_strtokenizecl_cvdheadcli_regexeccl_retflevelcl_cvdfreecli_regfreecli_filecopycl_cleanup_cryptohave_rarcli_regcompcl_retverlibxml2.so.2_finiliblzma.so.5libltdl.so.7libdl.so.2libssl.so.1libcrypto.so.1libjson-c.so.2libpcre.so.1libm.so.6libclammspack.so.0libpthread.so.0__errno_locationlibz.so.1zlibVersionzlibCompileFlagslibbz2.so.1libc.so.6fflushexitsprintfstrncmpoptindstrrchr__strdupperrorclosedirstrncpyputsforkputcharstrtolfgetscallocstrlendup2ctimestdoutfclosestrtoulmallocstrcasecmpopendirgetenvoptargstderrsystemoptoptfwritestrchrfprintfreaddir64setsidfopen64accessopterrstrcmp__libc_start_mainsnprintf_edata__bss_start_endZLIB_1.2.0.2GLIBC_2.2.5CLAMAV_PRIVATECLAMAV_PUBLIC 2 ui 9 ui EӇ_ _a _a _a_a_a_a<_aC_aH`a `a(`a0`a8`a@`aH`aP`aX`a ``a h`a p`ax`a`a`a`a`a`a`a`a`a`a`a`a`a `a!`a"`a#`a$aa%aa&aa'aa( aa)(aa+0aa,8aa-@aa.Haa/Paa0Xaa2`aa3haa4paa5xaa6aa7aa9aa:aa;aa=aa>aa?aa@aaAaaDaaEaaIaaKHHH!Ht&!FH5H!%H!@%H!h%H!h%H!h%H!h%H!h%H!h%H!h%H!hp%H!h`%H!h P%H!h @%zH!h 0%rH!h %jH!h %bH!h%ZH!h%RH!h%JH!h%BH!h%:H!h%2H!h%*H!h%"H!h%H!hp%H!h`% H!hP%H!h@%G!h0%G!h %G!h%G!h%G!h%G!h %G!h!%G!h"%G!h#%G!h$%G!h%%G!h&%G!h'p%G!h(`%G!h)P%G!h*@%zG!h+0%rG!h, %jG!h-%bG!h.%ZG!h/%RG!h0%JG!h1%BG!h2%:G!h3%2G!h4%*G!h5%"G!h6%G!h7p%G!h8`% G!h9P%D!fAWAVHAUATE1USA@1H@ jsH]A\ H5HIDh EH5$Lx H5ĸLDh EH5LƄ$ Ƅ$ L5bA!H-H@H=L$ HD$H1H$ Dl$$Ld$HD$H$ H$HL$HIL1LƄ$.HH=a1UII.HuLd$Dl$$LWH=({H=H1 7HHH-T1H=s1H=1H=~1tH=l1H=k1H=d1H=_1H=W1tH=P1fHB!8HB!8 $ H=rH$H= 1H Ht$H0}cH<$D$HH E1Ld$0 H8HHHuHaH=zD1LXH=I$aI$ I$M$H=R1^H=wH=LH=HUE hH`H5`H=HH1$$t0$H*H.I$H="HE1L$8T$4H=t$01H=<$<H5HcHl4H=uH1KLcH8 D[]A\A]A^A_ÿ E1,4H=-H1 H=\OH=C iH=-H=!H=H=N H= #LSH=11@-HH H9r ARjE1EF11LA3HHA[[H|$H5IX EM$EMm8MMEMtIcE,HH>A!HL$AD$5utID$ I9EA} AD$/IUH=1LsMe0Mt'f.It$H=1MMd$0Mu 9H=SL1##H=WL1 u9H=oL1AFB@ HuH=kL1H=1K1HDH=HH1H=r1HHú H<$HHPƄ$H=1%H5D$Mct$0HH&!H5'L$ H81DD$(HMYT$0HH&!H5(L$ H81IMH$LD$PHL$@Ht$8|$4HD$d=:;HHDD$LEt8;$XHD$@L$LHP81fDH ;Z9uH%!H5%H81uMMLD$hHLHLMIHp%!H5&HH81$MuMu {HsHtUC0H|$ ED$H‰D$H8H|$ E111LH|$ D$#D$0C7vMPHt$X1LHD$sLD$A8"{HT$xHMtKH=?AH HHLD$hE1M^I\$"H>HA|$|IHcD$dHH@HH-&!L rH#!H=7")1HSH|$hyHH[]A\A]A^A_ÃLD$hH5LLD$LD$tA<$1A|$E11HHH@CML 1xE1HcLD$hgD$LD9AL=&HcD$LBƄHD$HHDŽ@HDŽPDŽXDŽHVH"!H=6!*1H"H|$hHL%|LD$h1D$0CH1"!HSH5#H81H|$uH\$hdH|$tH|$;MuH\$hH?L%$!A$9D$4*|$4)ǃHcHHC@A,$9l$4H|$8HcL,׉fI9l$4)HcI}HHH\$hA$HC@)HcH<uH>!!H=/&HeHA"MHH !H57%H81LD$h|$0 MH !T$ H5!HH81wL$0&C{H !HSH5E!H81;H5LLD$1ɅLD$E1H? !HSH5,"H81A<$uCH !HSH5 #H81fLc(1kqmuH=HHgMIH!H5/#HH81Z\$0Hz!H5LH81.HZ!H=33HoH5!H=RHJH!HSH5 H81~H!IRH5D H81H!IH5 IRHH81{MIlH!H5!HH81ODL$0EHm!L$ H5HH81DT$0EmH3!L$ H5HH81IH!HSH5T!H81(ABH!IRH5!H81H!H=11HJH|$hpH!H=]"1HH|$h?CtrHP!HSH5!H81IABtNH#!IRH5H81Hh1[]A\A]A^A_HN!H=_.HHl$(IqHAA0H\$@L $H߃҃vL $t)H!IQH5 LH81Hl$($Ht$1E11HL $MH߉LH5L $AAK 'H\$H5{L $HL $t;1Y{OHD$HT$H|$(HLL $L $KHD$(Hh[]A\A]A^A_L $HHD$L $HHt$81H;"L $ HT$8M@,HHD$HDN@u+H|$H2IY(H\$$f.HH|$H|$ 1L $HD$HL $KH=?HH WH|$H5'L $HD$L $IQH5"H!H5LL $H81QHD$L $DkkmuH=HLH51HD$f.fAWAVIAUATAUSH=IHH1һ++ N!H=;!H-!HLcEHcHcLMIOLI1H5!2@u`@H!I? !Hcɀ< tjDE9}DeH[]A\A]A^A_H2@t9ur !@:yW]tIcHcIT< uAY!DuDuE9XIcIDH -@+@-Du@HA9H -uztLLD]NHcA9ILDu{LA9~HcITfH2HHru9|HA9uHcMDuDufH[]A\A]A^A_@H!IUH5ܛH81HcE ,!IML4@;fMHcA<2z:8AV!D9U H ! .1:AD:fDA:A4Fը8:BHcȃA:EfDDBA-tlE(LLD=!A!DuHH>A!DuI1H7!zuADu zADuKTHJA9ܺDuDH+!IUH5xH81: q!Du:?ff.AWAVAAUATH=ƙUSHIHxDL$ HL$LD$^HDL$ 1D$ ++H!H=!D;HE9IcH<Ll=H|$ IU -@+@-LEfAHE9H -uztLD$HL$LHDD+E9AIcHt}RAMH~D9~'HcHDfHAHHPA9|HA9ωHcAH|uDzfE_ADE9}$D3DHx[]A\A]A^A_fAHxD[]A\A]A^A_z@-t@ELHDDAfDA$<:D$ A4VՁ<|$ :P3HcʃA< @:@|$ EfDE_H5!DIEHH!-:5Iu~Ht$XlHt$X~-@@HD|$8HD$0<=D$gHcljHD=tHuT$gL$`HD$HHHD$PWD$`+D$8LD$PD|$HPH@E1DADfDHcЍHAHcA44@:t-Wu@;t"9uHxLH[D]A\A]A^A_HHcA<4:E͉|$8iH!A?E_H5}DIMHUHQ!H81IEHD$XD$8D$` xH3!EA?2HHUH5jH !H81DE_E9DSH!E1|$ : AGd:HHUH5ET$`H5!HcHT$XH=Ht$ HT5H5!H$D`DCHt$D$`1+D$8Ll$(Dt$@D|$ PCREMatchLimit are superfluous. WARNING: setting this limit too high may severely impact performance.This option sets the maximum filesize for which PCRE subsigs will be executed. Files exceeding this limit will not have PCRE subsigs executed unless a subsig is encompassed to a smaller buffer. Negative values are not allowed. Setting this value to zero disables the limit. WARNING: setting this limit too high or disabling it may severely impact performance.This option enables on-access scanning (Linux only)This option specifies a directory or mount point which should be scanned on access. The mount point specified, or the mount point containing the specified directory will be watched, but only notifications will occur. If any directories are specified, this option will preempt the DDD system. It can also be used multiple times.This option specifies a directory (including all files and directories inside it), which should be scanned on access. This option can be used multiple times.This option allows excluding directories from on-access scanning. It can be used multiple times. Only works with DDD system.Use this option to whitelist the root UID (0) and allow any processes run under root to access all watched files without triggering scans.With this option you can whitelist specific UIDs. Processes with these UIDs will be able to access all files. This option can be used multiple times (one per line). Using a value of 0 on any line will disable this option entirely. To whitelist the root UID please enable the OnAccessExcludeRootUID option.Files larger than this value will not be scanned in on access.This option toggles the dynamic directory determination system for on-access scanning (Linux only).This option changes fanotify behavior to prevent access attempts on malicious files instead of simply notifying the user (On Access scan only).Enables extra scanning and notification after catching certain inotify events. Only works with the DDD system enabled.When started by root freshclam will drop privileges and switch to the user defined in this option.This option defined how many times daily freshclam should check for a database update.Use DNS to verify the virus database version. Freshclam uses DNS TXT records to verify the versions of the database and software itself. With this directive you can change the database verification domain. WARNING: Please don't change it unless you're configuring freshclam to use your own database verification domain.DatabaseMirror specifies to which mirror(s) freshclam should connect. You should have at least two entries: db.XY.clamav.net (or db.XY.ipv6.clamav.net for IPv6) and database.clamav.net (in this order). Please replace XY with your country code (see https://www.iana.org/domains/root/db). database.clamav.net is a round-robin record which points to our most reliable mirrors. It's used as a fall back in case db.XY.clamav.net is not working.db.XY.clamav.net database.clamav.netThis option allows you to easily point freshclam to private mirrors. If PrivateMirror is set, freshclam does not attempt to use DNS to determine whether its databases are out-of-date, instead it will use the If-Modified-Since request or directly check the headers of the remote database files. For each database, freshclam first attempts to download the CLD file. If that fails, it tries to download the CVD file. This option overrides DatabaseMirror, DNSDatabaseInfo and Scripted Updates. It can be used multiple times to provide fall-back mirrors.mirror1.mynetwork.com mirror2.mynetwork.comThis option defines how many attempts freshclam should make before giving up.With this option you can control scripted updates. It's highly recommended to keep them enabled.With this option enabled, freshclam will attempt to load new databases into memory to make sure they are properly handled by libclamav before replacing the old ones.By default freshclam will keep the local databases (.cld) uncompressed to make their handling faster. With this option you can enable the compression. The change will take effect with the next database update.Download an additional 3rd party signature database distributed through the ClamAV mirrors. This option can be used multiple times.With this option you can provide custom sources (http:// or file://) for database files. This option can be used multiple times.http://myserver.com/mysigs.ndb file:///mnt/nfs/local.hdbIf you're behind a proxy, please enter its address here.A user name for the HTTP proxy authentication.A password for the HTTP proxy authentication.If your servers are behind a firewall/proxy which does a User-Agent filtering you can use this option to force the use of a different User-Agent header.Send the RELOAD command to clamd after a successful update.Run a command after a successful database update.Run a command when a database update error occurs.Run a command when freshclam reports an outdated version. In the command string %v will be replaced with the new version number.With this option you can provide a client address for the database downloading. Useful for multi-homed systems.Timeout in seconds when connecting to database server.Timeout in seconds when reading from database server.This option enables support for Google Safe Browsing. When activated for the first time, freshclam will download a new database file (safebrowsing.cvd) which will be automatically loaded by clamd and clamscan during the next reload, provided that the heuristic phishing detection is turned on. This database includes information about websites that may be phishing sites or possible sources of malware. When using this option, it's mandatory to run freshclam at least every 30 minutes. Freshclam uses the ClamAV's mirror infrastructure to distribute the database and its updates but all the contents are provided under Google's terms of use. See https://transparencyreport.google.com/safe-browsing/overview and https://www.clamav.net/documents/safebrowsing for more information.This option enables downloading of bytecode.cvd, which includes additional detection mechanisms and improvements to the ClamAV engine.Disable authenticode certificate chain verification in PE files.Initialize a supplementary group access (the process must be started by root).Define the clamd socket to connect to for scanning. This option is mandatory! Syntax: ClamdSocket unix:path ClamdSocket tcp:host:port The first syntax specifies a local unix socket (needs an absolute path) e.g.: ClamdSocket unix:/var/run/clamd/clamd.socket The second syntax specifies a tcp local or remote tcp socket: the host can be a hostname or an ip address; the ":port" field is only required for IPv6 addresses, otherwise it defaults to 3310 ClamdSocket tcp:192.168.0.1 This option can be repeated several times with different sockets or even with the same socket: clamd servers will be selected in a round-robin fashion.Define the interface through which we communicate with sendmail. This option is mandatory! Possible formats are: [[unix|local]:]/path/to/file - to specify a unix domain socket; inet:port@[hostname|ip-address] - to specify an ipv4 socket; inet6:port@[hostname|ip-address] - to specify an ipv6 socket./tmp/clamav-milter.socket inet:7357Define the group ownership for the (unix) milter socket.Sets the permissions on the (unix) milter socket to the specified mode.Messages originating from these hosts/networks will not be scanned This option takes a host(name)/mask pair in CIRD notation and can be repeated several times. If "/mask" is omitted, a host is assumed. To specify a locally originated, non-smtp, email use the keyword "local".local 192.168.0.0/24 1111:2222:3333::/48^(Accept|Reject|Defer|Blackhole|Quarantine)$Action to be performed on clean messages (mostly useful for testing). The following actions are available: Accept: the message is accepted for delivery Reject: immediately refuse delivery (a 5xx error is returned to the peer) Defer: return a temporary failure message (4xx) to the peer Blackhole: like Accept but the message is sent to oblivion Quarantine: like Accept but message is quarantined instead of being deliveredAction to be performed on error conditions (this includes failure to allocate data structures, no scanners available, network timeouts, unknown scanner replies and the like. The following actions are available: Accept: the message is accepted for delivery; Reject: immediately refuse delivery (a 5xx error is returned to the peer); Defer: return a temporary failure message (4xx) to the peer.This option allows you to set a specific rejection reason for infected messages and it's therefore only useful together with "OnInfected Reject" The string "%v", if present, will be replaced with the virus name.If this option is set to "Replace" (or "Yes"), an "X-Virus-Scanned" and an "X-Virus-Status" headers will be attached to each processed message, possibly replacing existing headers. If it is set to Add, the X-Virus headers are added possibly on top of the existing ones. Note that while "Replace" can potentially break DKIM signatures, "Add" may confuse procmail and similar filters.When AddHeader is in use, this option allows you to set the reported hostname. This may be desirable in order to avoid leaking internal names. If unset the real machine name is used.Execute a command when an infected message is processed. The following parameters are passed to the invoked program in this order: virus name, queue id, sender, destination, subject, message id, message date. Note #1: this requires MTA macroes to be available (see LogInfected below) Note #2: the process is invoked in the context of clamav-milter Note #3: clamav-milter will wait for the process to exit. Be quick or fork to avoid unnecessary delays in email delivery/usr/local/bin/my_infected_message_handlerChroot to the specified directory. Chrooting is performed just after reading the config file and before dropping privileges.This option specifies a file which contains a list of basic POSIX regular expressions. Addresses (sent to or from - see below) matching these regexes will not be scanned. Optionally each line can start with the string "From:" or "To:" (note: no whitespace after the colon) indicating if it is, respectively, the sender or recipient that is to be whitelisted. If the field is missing, "To:" is assumed. Lines starting with #, : or ! are ignored.Messages from authenticated SMTP users matching this extended POSIX regular expression (egrep-like) will not be scanned. As an alternative, a file containing a plain (not regex) list of names (one per line) can be specified using the prefix "file:". e.g. SkipAuthenticated file:/etc/good_guys Note: this is the AUTH login name!SkipAuthenticated ^(tom|dick|henry)$This option allows you to tune what is logged when a message is infected. Possible values are Off (the default - nothing is logged), Basic (minimal info logged), Full (verbose info logged) Note: For this to work properly in sendmail, make sure the msg_id, mail_addr, rcpt_addr and i macroes are available in eom. In other words add a line like: Milter.macros.eom={msg_id}, {mail_addr}, {rcpt_addr}, i to your .cf file. Alternatively use the macro: define(`confMILTER_MACROS_EOM', `{msg_id}, {mail_addr}, {rcpt_addr}, i') Postfix should be working fine with the default settings.This option allows you to tune what is logged when no threat is found in a scanned message. See LogInfected for possible values and caveats. Useful in debugging but drastically increases the log size.This option affects the behaviour of LogInfected, LogClean and VirusAction when a message with multiple recipients is scanned: If SupportMultipleRecipients is off (the default) then one single log entry is generated for the message and, in case the message is determined to be malicious, the command indicated by VirusAction is executed just once. In both cases only the last recipient is reported. If SupportMultipleRecipients is on: then one line is logged for each recipient and the command indicated by VirusAction is also executed once for each recipient. Note: although it's probably a good idea to enable this option, the default value is currently set to off for legacy reasons.yesExampleERROR: Unknown option passed footruehelp^(yes|true|1|no|false|0)$config-file/etc/clamd.conf/etc/freshclam.conf/etc/clamav-milter.confdebuggen-jsondumpcertsquietleave-tempsno-warningsshow-progressstdoutdaemonno-dnslist-mirrorsupdate-dbreloadmultiscanfdpassstreamallmatchdatabase/usr/share/clamavrecursivegen-mdbfollow-dir-symlinks^[0-9]+$follow-file-symlinksbellno-summaryfile-listinfectedsuppress-ok-resultscopyremoveexcludeexclude-dirinclude-dirstructured-ssn-formathex-dumpmd5sha1sha256impprint-certshtml-normaliseascii-normaliseutf16-decodebuildmax-bad-sigs3000flevelcvd-versionno-cdiffserverunpackunpack-currentinfolist-sigsfind-sigsdecode-sigstest-sigsvbavba-hexcomparerun-cdiffverify-cdiffhybriddefaultcolorsconfig-dir/etcnon-defaultgenerate-configforce-interpretertrust-bytecodeprintsrcPrint source code of bytecodeprintbcirinputtracebytecode trace levelno-trace-showsourcearchive-verbosebytecode-trust-allhttp-proxyproxy-userlog-verboseforcedisable-summarydisable-archiveno-archiveno-peno-elfno-ole2no-pdfno-htmlno-mailno-phishing-sigsno-phishing-scan-urlsno-algorithmicno-phishing-restrictedscanmax-ratiomax-space^[0-9]+[KM]?$unzipunrararjunzoolhajartartgzdebblock-maxPreludeEnableprelude-enableEnable preludePreludeAnalyzerNameprelude-analyzer-name/tmp/clamav.logLogFileUnlockLogFileMaxSizeLogTimeLog time with each message.LogCleanLogSyslogLogFacilityLOG_LOCAL6LOG_MAILLogVerboseEnable verbose logging.LogRotatelog-rotateExtendedDetectionInfoPidFile/var/run/clam.pidTemporaryDirectorytempdir/tmpDatabaseDirectorydatadir/var/lib/clamavOfficialDatabaseOnlyofficial-db-onlynoYaraRulesyara-rulesLocalSocket/tmp/clamd.socketLocalSocketGroupvirusgroupLocalSocketMode660FixStaleSocketTCPSocket3310TCPAddr127.0.0.1MaxConnectionQueueLength30StreamMaxLength25MStreamMinPort1024StreamMaxPort2048MaxThreads120CommandReadTimeoutSendBufTimeout200300MaxQueueIdleTimeout^/proc/ ^/sys/MaxDirectoryRecursionmax-dir-recursion15FollowDirectorySymlinksFollow directory symlinks.FollowFileSymlinksCrossFilesystemscross-fsSelfCheck600DisableCachedisable-cacheVirusEventExitOnOOMAllowAllMatchScanForegroundforegroundDon't fork into background.DebugLeaveTemporaryFilesUserBytecodeBytecodeSecurity^(TrustSigned|Paranoid)$TrustSignedBytecodeTimeoutbytecode-timeout5000BytecodeUnsignedbytecode-unsignedBytecodeModebytecode-modeAutoStatisticsstatisticsNoneDetectPUAdetect-puaExcludePUAexclude-puaNetTool PWToolIncludePUAinclude-puaSpy Scanner RATAlgorithmicDetectionalgorithmic-detectionScanPEscan-peScanELFscan-elfDetectBrokenExecutablesdetect-brokenScanMailscan-mailScanPartialMessagesPhishingSignaturesPhishingScanURLsPhishingAlwaysBlockCloakphishing-cloakphishing-sslPartitionIntersectionpartition-intersectionHeuristicScanPrecedenceheuristic-scan-precedenceStructuredDataDetectiondetect-structuredStructuredMinCreditCardCountstructured-cc-countStructuredMinSSNCountstructured-ssn-countStructuredSSNFormatNormalStructuredSSNFormatStrippedScanHTMLscan-htmlScanOLE2scan-ole2OLE2BlockMacrosblock-macrosScanPDFscan-pdfScanSWFscan-swfScanXMLDOCSscan-xmldocsScanHWP3scan-hwp3ScanArchivescan-archiveArchiveBlockEncryptedblock-encryptedForceToDiskforce-to-diskmax-scansize100Mmax-recursion16max-files10000MaxEmbeddedPEmax-embeddedpe10MMaxHTMLNormalizemax-htmlnormalizeMaxHTMLNoTagsmax-htmlnotags2MMaxScriptNormalizemax-scriptnormalizeMaxZipTypeRcgmax-ziptypercg1MMaxPartitionsmax-partitions128MaxIconsPEmax-iconspe100MaxRecHWP3max-rechwp3TimeLimittimelimitPCREMatchLimitpcre-match-limit100000PCRERecMatchLimitpcre-recmatch-limitPCREMaxFileSizepcre-max-filesizeOnAccessMountPath/ /home/userOnAccessIncludePathon-access-include/home /studentsOnAccessExcludePath/home/bofh /rootOnAccessExcludeRootUIDOnAccessExcludeUIDOnAccessMaxFileSizeOnAccessDisableDDDdisable-dddOnAccessPreventionOnAccessExtraScanningDevACOnlydev-ac-onlyDevACDepthdev-ac-depthDevPerformancedev-performanceDevLiblogdev-liblogUpdateLogFile/var/log/freshclam.logDatabaseOwnerCheckschecksDNSDatabaseInfocurrent.cvd.clamav.netDatabaseMirrorPrivateMirrorMaxAttemptsScriptedUpdatesTestDatabasesCompressLocalDatabaseExtraDatabasedbname1 dbname2DatabaseCustomURLHTTPProxyServeryour-proxyHTTPProxyPortHTTP proxy's port8080HTTPProxyUsernameusernameHTTPProxyPasswordHTTPUserAgentNotifyClamddaemon-notifyOnUpdateExecuteon-update-executecommandOnErrorExecuteon-error-executeOnOutdatedExecuteon-outdated-executeLocalIPAddresslocal-addressaaa.bbb.ccc.dddConnectTimeoutReceiveTimeoutSafeBrowsingDisableCertChecknocertsMailMaxRecursionArchiveMaxScanSizeArchiveMaxRecursionArchiveMaxFilesArchiveMaxCompressionRatioArchiveBlockMaxArchiveLimitMemoryUsageMailFollowURLsmail-follow-urlsClamukoScanOnAccessClamukoScannerCountClamukoScanOnOpenClamukoScanOnCloseClamukoScanOnExecClamukoIncludePathClamukoExcludePathClamukoExcludeUIDClamukoMaxFileSizeAllowSupplementaryGroupsClamdSockettcp:scanner.mydomain:7357MilterSocketMilterSocketGroupMilterSocketModeLocalNetOnCleanAcceptOnInfectedQuarantineOnFail^(Accept|Reject|Defer)$DeferRejectMsgMTA specificAddHeader^(No|Replace|Yes|Add)$ReplaceReportHostnamemy.mail.server.nameVirusActionChroot/newrootWhitelist/etc/whitelisted_addressesSkipAuthenticatedLogInfectedBasicSupportMultipleRecipientsPOSIXLY_CORRECT%s: illegal option -- %c %s: unrecognized option `%s' %s: option `%s' is ambiguous %s: option requires an argument -- %c %s: option `--%s' doesn't allow an argument %s: option `--%s' requires an argument 0.100.2%s/daily.cvd%s/daily.cldClamAV %s ClamAV %s/%u/%s/dev/nullCan't open /dev/null dup2(%d, %d) failed %s/Unable to allocate memory for db directory... ERROR: This tool requires libclamav with functionality level %u or higher (current f-level: %u) ERROR: --file-list: Can't open file %s ARGBig-endianLittle-endianSun studioMicrosoft Visual C++Intel CompilerLLVM-GCCClangGNU C %s# %s # Default: %s # Default: disabled# Default: %lld #%s %s %s/%s %s not found Config file: %s *** %s is DEPRECATED *** %s disabled %s = "%s", "%s"%s = "%lld", "%lld"%s = "yes" Version: %s Optional features supported: MEMPOOL IPv6 AUTOIT_EA06 BZIP2 LIBXML2 PCRE ICONV JSON RAR JITDatabase directory: %s .db.db2.db3.hdb.hdu.fp.mdb.mdu.hsb.hsu.sfp.msb.msu.ndb.ndu.ldb.ldu.sdb.zmd.rmd.pdb.gdb.wdb.cbc.ftm.cfg.cud.cdb.cat.crb.idb.ioc.yar.yara.pwdb[3rd Party] %s: bytecode [3rd Party] %s: %u sig%c uname: %s %s %s %s /usr/bin/lsb_releaseFull OS version: /usr/bin/lsb_release -d -sfailed to determine1.2.11Triple: %s CPU: %s, %s platform id: 0x%08x%08x%08x -L/usr/lib64sizeof(void*) = %d Engine flevel: %d, dconf: %d 5.5.0%s: %s%s(%u.%u.%u) ERROR: Can't parse command line options Clam AntiVirus: Configuration Tool %s By The ClamAV Team: https://www.clamav.net/about.html#credits (C) 2009-2018 Cisco Systems, Inc. --help -h Show this help --version -V Show version --config-dir=DIR -c DIR Read configuration files from DIR --non-default -n Only display non-default settings --generate-config=NAME -g NAME Generate example config fileClam AntiVirus Configuration Tool %s ERROR: Unknown config file Available options:## ## %s - automatically generated by clamconf 0.100.2 ## # Comment out or remove the line below. Example# You may use 'M' or 'm' for megabytes (1M = 1m = 1048576 bytes) # and 'K' or 'k' for kilobytes (1K = 1k = 1024 bytes). To specify the size # in bytes just don't use modifiers.!!! %s: UNKNOWN INTERNAL TYPE !!! Checking configuration files in %s Software settings -----------------WARNING: Version mismatch: libclamav=%s, clamconf=%s Database information --------------------WARNING: freshclam.conf and clamd.conf point to different database directoriesprint_dbs: Can't open directory %s print_dbs: Can't allocate memory for dbfile%s: Can't get information about the database %s: version %u, sigs: %u, built on %s%s: WARNING: This database requires f-level %u (current f-level: %u) Total number of signatures: %u Platform information --------------------OS: linux-gnu, ARCH: x86_64, CPU: x86_64WARNING: zlib version mismatch: %s (%s) zlib version: %s (%s), compile flags: %02lx Build information -----------------'--prefix=/usr' '--libdir=/usr/lib64' '--localstatedir=/var' '--sysconfdir=/etc' '--mandir=/usr/man' '--with-user=clamav' '--with-group=clamav' '--with-dbdir=/usr/share/clamav' '--enable-id-check' '--enable-clamdtop' '--disable-check' '--disable-static' '--build=x86_64-slackware-linux' '--with-libjson' '--enable-milter' 'build_alias=x86_64-slackware-linux' 'CFLAGS=-O2 -fPIC' 'LDFLAGS=-L/usr/lib64' 'PKG_CONFIG_PATH=/usr/local/lib64/pkgconfig:/usr/local/share/pkgconfig:/usr/lib64/pkgconfig:/usr/share/pkgconfig'-O2 -fPIC -fno-strict-aliasing -D_LARGEFILE_SOURCE -D_LARGEFILE64_SOURCE -D_FILE_OFFSET_BITS=64 -D_LARGEFILE_SOURCE -D_LARGEFILE64_SOURCE -D_FILE_OFFSET_BITS=64CPPFLAGS: %s CFLAGS: %s CXXFLAGS: %s LDFLAGS: %s Configure: %s 1,1111; ($68Pp8@:;0@@r(@@@H@(@xe@@P@d@@@m@d@@@@(@@@@(@@@@f@@@i(@@@@o(@@@@@@@@@@(@@@@@@@@@?@@@@@@@d@@@@(@ @@@(@ @@@(@ @@ @(@ @@L@(@ @@@(@ @@@ @@$@ @@3@ @@C@ @@P@b @@V@d@ e@c@h@d@] f@@o@d@ f@@@(@ @@{@(@ @@@ @@@u @@@ @@@i @@@l,@ @@@f,@ @@@(@ @@@ @@@ @@@ @@@d @@@c @@@r @@@ @@@(@ Hf@@@d(@@@@c@@@@ @n(@@@@,@g@@@<@f(@f@@N@t(@f@@@i(@f@@]@p(@f@@@c(@g@@@r0g@@@Td@@@@s(@Xg@@@a(@@@@t(@@@@@@@@@@@@@(@@@@(@@@@(@@@.@(@@@9@(@@@?@(@@@F@(@@@N@(@@@U@(@@@]@(@@@e@(@@@v@(@@@@(@@@@(@@@@d@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@9@@(@ @@ @@(@)@8@L@g@j@@lg@b@r@(@g@@@@Ph@@@(@@@@(@h@@@(@h@@@@ i@@@(@@@ @@(@pi@@@(@i@@4@J@p0j@<@N@a@-Pj@i@n@@,@#j@@@@(@ @k@@@@k@@@0l@@@hl@@@l@ @$@(@l@@3@d@m@=@B@8m@J@T@d@m@m@p@@n@@@d@n@@@d@o@@@d@ 8o@@@d@xpo@@@d@o@0@@d@xp@@@d@xq@@@d@dHq@@@d@r@!@@0s@@@@d@ s@/@2@(@J@@e@(@s@@x@@(@ t@@@d@X@t@@@@(@ t@@@t@u@@(@v@@@(@Pv@@@@F(@@@@(@xv@@@(@v@@.@v@@3@{@(@ (w@@<@M@f@w@f@r@@d@ (y@@@@(@ Py@@@@y@@ y@@@@z@ {@@@@(@ {@@ @@ {@"@1@<@ |@H@X@m@(@ }@@@@(@ }@@@@(@ h@@@@(@ X@@@@(@ ؀@@@(@x@@@h@(@ p@@@y@(@ Ђ@@@-@(@ @@@<@(@ @@I@_@(@ @@v@@(@ h@@@@(@ @@@@d@ (@0@@@d@ @0@.@(@@@H@(@P@@d@m@(@ @@w@@(@ `@@@@(@ 0@@@@(@ @@@@(@ h@@@@(@ @@@@(@ Ȍ@@@@(@ `@@@$@(@ @@4@@@(@ P@@@N@@@ 0@[@@@@ P@@@`@d@ @n@@q@d@' @{@@@@ ȓ@@@@@ Д@@@@@ Е@@@@@P @@ @@@ @)@,@:@d@2 @I@M@X@d@d @@d@h@s@d@ `@n@@@d@Ȝ@g@@@d@ P@@@@d@ Ȟ@@@@@ @@@(@@@@ @@!@5@h@G@W@@k@|@(@@@@d@@g@@@PP@@@@(@@@@(@@@@(@@@@ @(@ @@@#@d@ @@0@?@(@ @@O@Y@(@@@d@@lg@r@@@u@@@@@cd@ h@@@@@@@@@@@@@d@8@0@@(@@@@(@@@@(@@@)@p@7@G@@@Y@@i@t@d@@@@@@@0@@@`@$@@@N@@@@@@@@@'@x@@8@J@@@^@m@a8@{@@d@@m@@d@@m@@(@@@3@(@(@@@@(@ @@@@@@@@@@@@@@@@@2@(@@@B@(@@@Z@i@(@ @@z@(@@@@d@@@@(@@@@(@@@@(@@@@@@@@@@d@@@@@P@@$@(@@@=@H@I@c@Ȼ@@p@ @@@`@ @@@@@@@ @@@@@ @@@@@@@@X@@@@@0@@&@@5@I@h@@@U@p@\@e@@o@@@@@(@@@p@@@(@@@@@(@@@n@@@@(@@@@(@@@@(@@@@@@Z@(@@@@@@@@d@@@@d@@@@(@@@@(@@@d@(@@@@(@@@w@(@@@@(@@@p@@@@B@@@3@d@@@N@@@S@c@w@Yly-9 @ x]@x@ @@  `ap@@ o@@oo@@]aF@V@f@v@@@@@@@@@@@&@6@F@V@f@v@@@@@@@@@@@&@6@F@V@f@v@@@@@@@@@@@&@6@F@V@f@v@@@@@@@aGCC: (GNU) 5.3.0GCC: (GNU) 5.5.0.shstrtab.interp.note.ABI-tag.hash.dynsym.dynstr.gnu.version.gnu.version_r.rela.dyn.rela.plt.init.plt.got.text.fini.rodata.eh_frame_hdr.eh_frame.ctors.dtors.jcr.data.rel.ro.dynamic.got.plt.data.bss.comment 8@8T@T !x@xD' @ / @ 7o@Do@@@S@]B@pg@$b0@0m@v@B|x]@x]]@]p@pP@PxaxaaaX @]a@]pq_a_@`a`aaa  bab8 0b"*busr/bin/clamdscan0100755000000000000000000054221013365330320013013 0ustar rootrootELF>:@@H@8 @@@@@@88@8@@@lJlJ SSbSbh~ ȭȭbȭbTT@T@ PtdBBddQtdRtdSSbSbH\H\/lib64/ld-linux-x86-64.so.2GNU _sN]D}TQ3P8&zBoRFqj<OZrg@?t$^wuEHe\axL7` 6.~5l i(b{|XvGp4,+%) -= / :2;9 'MdYhS">JAI[mkCfyKn#!V0Wc1*UW$'q?"  \5?hA2-U b; AF/S U8go'{c ĴbJuNmV8bkv&!bb#Hw]?Pm)c8O8b 8Wqx*9b/'|bNI -@libssl.so.1X509_STORE_CTX_initEVP_SignFinalEVP_MD_size_ITM_deregisterTMCloneTableX509_VERIFY_PARAM_newEVP_DigestFinal_exEVP_VerifyFinalBIO_pushBIO_read_finiEVP_PKEY_freeSSL_library_initEVP_DigestInit_exBIO_set_flags__gmon_start__X509_verify_certX509_get_pubkeyX509_STORE_freeEVP_DigestUpdatePEM_read_bio_X509_AUXEVP_MD_CTX_set_flagsEVP_MD_CTX_destroyEVP_get_digestbynameBIO_newBIO_ctrlBIO_freeX509_VERIFY_PARAM_freeEVP_PKEY_sizeX509_STORE_newX509_freeSSL_load_error_stringsEVP_MD_CTX_md_Jv_RegisterClassesBIO_free_allERR_load_crypto_stringsPEM_read_bio_X509_ITM_registerTMCloneTableBIO_writeBIO_s_fileBIO_s_memEVP_MD_CTX_createlibcrypto.so.1X509_LOOKUP_filePEM_read_X509X509_STORE_add_lookupBIO_f_base64X509_STORE_CTX_newX509_STORE_CTX_freeX509_LOOKUP_ctrlX509_CRL_freeOPENSSL_add_all_algorithms_noconfOpenSSL_add_all_digestsEVP_cleanupX509_LOOKUP_hash_dirBIO_new_mem_bufX509_VERIFY_PARAM_set_flagsX509_STORE_set_flagsOpenSSL_add_all_ciphersX509_STORE_add_crlPEM_read_PrivateKeyPEM_read_X509_CRLX509_STORE_set1_paramX509_cmp_current_timeEVP_MD_block_sizelibz.so.1libjson-c.so.2libpcre.so.1libpthread.so.0sendrecv__errno_locationfcntlsigactionconnectsendmsglibc.so.6socket__xpg_basenamefflushexitsprintfsrandgai_strerrorstrncmpoptindstrrchr__strdupperrorclosedirstrncpyforkunlinkselectreallocclockmemchrstrftimelocaltime_rstrtolctime_rsyslogfgetscallocstrlensigemptysetgetaddrinfomemsetbindmemcmpdup2__fxstat64strptimevsnprintfsigaddsetstdoutfputsmemcpyfclosestrtoulmallocumaskstrcasecmp__lxstat64opendir__xstat64__ctype_b_locgetenvoptargstderroptoptfilenogetcwdfwritegettimeofdayrenamestrchrfprintfreaddir64__ctype_toupper_loc__ctype_tolower_locfreeaddrinfosetsidmemmovefopen64opterrstrcmp__libc_start_mainstpcpycloselog_edata__bss_start_endGLIBC_2.2.5GLIBC_2.14GLIBC_2.3 ui gsii ~ui gbbȯb2Яb:دbybb b(b0b8b@bHbPbXb `b hb pb xb bbbbbbbbbȰbаbذbbbbbb b!b#b$ b%(b&0b'8b(@b)Hb*Pb+Xb,`b.hb/pb0xb1b3b4b5b6b7b8b9b;b<ȱb=бb>رb?b@bAbBbCbDbEbFbG bH(bI0bJ8bK@bLHbMPbNXbO`bPhbQpbSxbTbUbVbWbXbYbZb[b\b]Ȳb^вb_زb`bbbcbdbebfbgbhbi bj(bk0bl8bm@bnHboPbqXbr`bshbtpbuxbvbwbxbzb{b|b}b~bbȳbгbسbbbbbbbbb b(b0b8b@bHbPbXb`bhbpbxbbbHH"Ht 1;H5‚"%Ă"@%‚"h%"h%"h%"h%"h%"h%"h%"hp%"h`%z"h P%r"h @%j"h 0%b"h %Z"h %R"h%J"h%B"h%:"h%2"h%*"h%""h%"h%"h% "hp%"h`%"hP%"h@%"h0%"h %ځ"h%ҁ"h%ʁ"h%"h %"h!%"h"%"h#%"h$%"h%%"h&%"h'p%"h(`%z"h)P%r"h*@%j"h+0%b"h, %Z"h-%R"h.%J"h/%B"h0%:"h1%2"h2%*"h3%""h4%"h5%"h6% "h7p%"h8`%"h9P%"h:@%"h;0%"h< %ڀ"h=%Ҁ"h>%ʀ"h?%€"h@%"hA%"hB%"hC%"hD%"hE%"hF%"hGp%"hH`%z"hIP%r"hJ@%j"hK0%b"hL %Z"hM%R"hN%J"hO%B"hP%:"hQ%2"hR%*"hS%""hT%"hU%"hV% "hWp%"hX`%"hYP%"hZ@%"h[0%"h\ %"h]%"h^%"h_%"h`%"ha%"hb%"hc%"hd%"he%"hf%"hgp%"hh`%z"hiP%r"hj@%j"hk0%b"hl %Z"hm%R"hn%J"ho%B"hp%:"hq%2"hr%*"hs%""ht%"hu%"hv% "hwp%"hx`%~"hyP%~"hz@%~"h{0%~"h| %~"h}%~"h~%~"h%~"h%~"h%~"h%~"h%~"h%~"h%~"h%~"hp%~"h`%z~"hP%r~"h@%j~"h0%b~"h %Z~"h%R~"h%ry"fAUATHUSA1AHD$D$ jHA]Z[H5{HHHHxE1j11AH-"HHEA[A\1H5HNDP EtHV"fHj"fH5aHDH Et H$"fH5iHD@ EGH5Hx )H5Hp H5HH  H5HP "H"HH5Hh@ H߅CLd$0&Ll$8LLHD$0X L1L \H|$H|$1HT$HHcH}AJH5Hh [H#~DVH"fHr"HH} HPHx"H=H1 H=1HH}H~H}u`FBH|$ 1HT$(+T$H=Ll$ D+l$A)ŅҸ@BH1j 4$H=1Y t$H"0H"0uvD<H=BAЙD1 H=V1H[]A\A]H5HHpH=J1 H=G1 wH=#1 WH=1 3`HA0H}'RDZH`t .H=H1HH}1 1I^HHPTIPhAHgAHP6@fDH=1"H1"UH)HHvHt"Ht ]fD]@f.H="H5"UH)HHHH?HHtHat"Ht ]f]@f.="ubUH'"H"HATSH"L% "H)HHH9s@HHm"AHb"H9r[A\]E"H="H?u .fDHs"HtUH]AWAVAUATUSHH|$(H$H$L$L$t@)$ )$0)$@)$P)$`)$p)$)$H$HHD$`H$D$XD$\0HD$hIIILl$h1A HL9sO|%uHDMct$0HHV"H5XL$ H81:DD$(HՅMYT$0HHV"H5L$ H81MH$LD$PHL$@Ht$8|$4HD$d=:;HoHDD$LEt8;$XHD$@L$LHP81fDH ;Z9uHU"H5H81uMMLD$hHLHLMIHpU"H5qHH81MuMu {HsHtUC0H|$ ED$H‰D$Hm8H|$ E111LH|$ D$s D$0C7MPHt$X1LHD$CLD$A8"{HT$xHMtKH=?AH HHLD$hE1M^I\$"H^HA|$|IHcD$dHH@HHd"L rHS"H=)1HH|$hyHH[]A\A]A^A_ÃLD$hH5gLLD$LD$tA<$1A|$E11HHH@CML 1E1HcLD$hgD$LD9AL=&HcD$LBƄHD$HHDŽ@HDŽPDŽXDŽHVHR"H=*1HrH|$hHL%TLD$h1D$0CH1R"HSH5H81tH|$uH\$hdH|$tH|$MuH\$hH?L%V"A$9D$4*|$4)ǃHcHHC@A,$9l$4H|$8HcL,׉fI9l$4)HcI}HHH\$hA$HC@)HcH<uH>Q"H=HeHA"MHHP"H5H81ELD$h|$0 MHP"T$ H5HH81L$0&C{HP"HSH5H81H5LLD$1ɅLD$E1H?P"HSH5H81A<$uCHP"HSH5H81GfLc(1kqmuH=HHgMIHO"H5HH81\$0HzO"H5[ LH81HZO"H= 3H9oH5O"H=*~HJHO"HSH5 H81S~HN"IRH5H812HN"IH5IRHH81 MIlHN"H5HH81DL$0EHmN"L$ H5 HH81DT$0EmH3N"L$ H5p HH81sIHN"HSH5,H81R(ABHM"IRH5sH81!HM"H=f 11HH|$hpHM"H=51HiH|$h?CtrHPM"HSH5H81IABtNH#M"IRH5 H81fHh1[]A\A]A^A_HNJ"H=7 .H-Hl$(IqHAA0H\$@L $H߃҃VL $t)HI"IQH5 LH81/Hl$($Ht$1E11HL $H߉3LH5 L $AAK 'H\$H5SxL $HL $t;1Y{OHD$HT$H|$(HLL $L $KHD$(Hh[]A\A]A^A_L $HHD$L $HHt$81Hj;"L $ HT$8M@,HHD$HDN@u+H|$H2IY(H\$$f.HH|$H|$ 1L $HD$HL $KH=?HH WH|$H5vL $ HD$L $IQH5"HG"H5 LL $H81HD$L $DkkmuH=HLH51HD$f.fHՋW"ATUSHt/HS@HbW"HH‰ W"[]A\f.HH5`w1Iċ@ tHW"HH=pS"HH=VS"OW"IH2H!ကtDHBHDЉHH)HHt;AT t u+H R"LH9tPH t t[HR"]A\f.I|$H5yHHHV"HE"IT$H5H81Ht E61H=ZV"m1fDof.AUATH=US11HH=ÉD$1H=ʼnD$1D$ E1AHl$DD}t#IIFlDDZuHD"H5DDLd$H81tHL9t]]uHqD"H=0Hl$Ld$HFtHL9t]uHL9uH[]A\A]ÃLd$HL9t]~HJL9uptuH1[]A\A]1@f.ATUSIHH0HxtH0[]A\HH|/H\$ tQLHaƄ$ 1E11HH1HH0ډ[]A\HLH1Ƅ$ f.1?/ATUH5vSHHtTH1If.1<$#HLHuHhH[]A\f.H1[]A\fAWAVIAUATAUSH=aIHH1һ++ S"H=R"H-F"HLcEHcHcLMIOLI1H5R"2@u`@HF"I? R"Hcɀ< tjDE9}DeH[]A\A]A^A_H2@t9ur GR"@:yW]tIcHcIT< uAR"DuDuE9XIcIDH -@+@-Du@HA9H -uztLLD]NHcA9ILDu{LA9~HcITfH2HHru9|HA9uHcMDuDufH[]A\A]A^A_@H@"IUH5<H81ZHcE P"IML4@;fMHcA<2z:8AVP"D9U H D" .1:AD:fDA:A4Fը8:BHcȃA:EfDDBA-tlE(LLDO"AO"DuHH>AO"DuI1H7!zuADu zADuKTHJA9ܺDuDH[>"IUH5؃H81: )O"Du:?ff.AWAVAAUATH=&USHIHxDL$ HL$LD$~HDL$ 1D$ ++HB"H=N"D;HE9IcH<Ll=H|$ IU -@+@-LEfAHE9H -uztLD$HL$LHDD+E9AIcHt}RAMH~D9~'HcHDfHAHHPA9|HA9ωHcAH|uDzfE_ADE9}$D3DHx[]A\A]A^A_fAHxD[]A\A]A^A_z@-t@ELHDDAfDA$<:D$ A4VՁ<|$ :P3HcʃA< @:@|$ EfDE_H5L"DIEHHL"-:5Iu~Ht$XlHt$X~-@@HD|$8HD$0<=D$gHcljHD=tHuT$gL$`HD$HHHD$PWD$`+D$8LD$PD|$HPH@E1DADfDHcЍHAHcA44@:t-Wu@;t"9uHxLH[D]A\A]A^A_HHcA<4:E͉|$8iH>"A?E_H5~DIMHUH9"H81ϾIEHD$XD$8D$` xH#>"EA?2HHUH5~H9"H81aDE_E9DSH="E1|$ : AGd:HHUH5~T$`H5I"HcHT$XH=Ht$ HT5H5qI"H$D`DCHt$D$`1+D$8Ll$(Dt$@D|$@H|$ 1HHAHhwH|$:,HIHD$H5zLxL胮AH=zAFLH譿H;"HHHAFH=kzAFLHq@I^ Ht;ufD;t4HHCHuH=y12HH[]A\A]A^A_HԐf1@H=y1ھHRI^ fUSHH5{lHH:"H8P HÅt!HsHtH[0Hu1H[]DHJ"tH=HyH1IH[]f.kf.AWAVHAUATIUSIAHI;CAwHT|JcHL$I1LHHCAP?I 8HcL?)LHHH ԉHKLA?ɉIE1H?)LHH Ā1ɋCLx"zCP?I 0Hcƒ?)IL<LĀ+dHHCCELuHC HEC Hk ZuX{L`AEpCCHHEkHC LEt?H[]A\A]A^A_ÃCCHHEkHC 货L謧@1@H=4wL1CfH=x1H=Ix1ݻCm@H=vL1迻COfD{8ILA?H=8xH1~ @HxLئ؋{LAL軦8诧H=xH1ff.AWAVAAUATUSAHHH$HL$LD$HjAHYyDHcHDHDAEE1D$Ll$8Ld$0f.AMLLH<HuHt$0H=u1$A3$~Lt$0:LFHHFx t;Lt$0(LHtLt$0:LHHLL$8H5tHL$ MALL$(LL$NL$HL$ H5ttLH $%uAHD$H $HtHD$Ht AQH=&tHH12fADHDAcDHH臤IH!"IcHHH$jElIcEJHHD$0H$dH5sHH1贤Ht$0DDH|$0 DEl$u>HQHT$@H޿dLD$Xl$%=@RH[]A\A]A^A_D@E1HD$HD$HD@LL$(HD$AAAtID$HAH=-s1HH衷Hz3"HH^HTHH $GH53"H蘥H $tH=i3"HރD$7PC"H $DHt$0H=r1H $H $H2"HHH|$0H=;rL1H=rH1ɶH=rLuBAH5qwHM"McJ4H=s1胶M>H=qL1Y#8âH=tsH12H=&s1H=q1ȣ8qH=sHH1ݵAWAVH5oVAUATUSHXH1"H;P te1ҾHAxJH5A"nWD58ޡHuH=+sH1ID聞H;H5=VLl$Ld$ Lt$rHHHp L1H;H5VIHHE H]H;a1LHLLLHD$(ƞ跤HHH=\p1胴Hm0ADC8H=QpH1[H[(HH|$负@Hm0HFHX[]A\A]A^A_{nB{y8{.1LHL1LLD$(H\$HS s{A.SHsxx$H|$DHX[]A\A]A^A_;8HuH=iqH1OD臜fYH5Hf.1fHAVMAUIATAUSHt H-u!MLHD[]A\A]A^fD[1]A\A]A^f.AVAUHATUISIAI(E A6HqDHcHf}uHMLEL"AhEDe[]A\A]A^uHMLELMAtLcEDuAt1ۉ[]A\A]A^@H=lL1觱E닐H=!n1蒱wDH=m1uEV@H=elL1WE8fDs1MtL謜E@f.ATUISHHDH DH0H="L t$HD$D$D$ EAEЉD$LD$HD$HD$LT$A$T$ u tGtB\$tH0[]A\f.H=llH1OH0[]A\@\$tH=;lH11%AWAVEAUATIUSIԉIDHH,D$ H5l H<"\$H\$L LD$H DLD$D$D$D$$HD$0H\$EՉD$(K|$ H5k9HHuH|$0u|$ cD$A$D$AEH|$0t{H=HcAAtM|@u%IAw@t HHuHcM<At{E9uMdAfDIAt$A@t H轋HtA9t>A)A}Hcd/HHtGIcLHHK+HH[]A\A]A^A_1H[]A\A]A^A_I11m1H=_1+1DEAWAVAAUATIUSHHHL$1E1f.AHHt=HcAAtM|@u$fDIAw@t H跊HuHcM<EEtkE9uMlAA@IAuA@t HnHtA9t0Lt$A)LIcHL AHL[]A\A]A^A_H1[]A\A]A^A_I111AWAVAUATUSH(A9A}H9D DzE1ҍAHHD$HBE8AE1HD$AE8A)1AA fDD9wCD:|uLlE:Mt!DD9vE1H(L[]A\A]A^A_@HT$H|$HtDL$DT$貊DT$DL$u뻐2H([]A\A]A^A_HUIHHt%HuHHVHO҈QuHHH= ^14)1AUATUSHHtaHID1H9Hxt6HDI|胈HuH9HvfDHH9IDuHH[]A\A]1ff.AWAVAUATAUSH(HM[HRLD$L$Ht$H<$蛈I荆H<$L Ht$L$LD$IIHADT HtII9IADT HuI9҃-?+$?0>.A D$HE81II9gE115A0A9@ukI9wfI9uiD9ڽ}_II9tnMC\ut[ffۃ 7A)A"fDH([]A\A]A^A_@뢐MMc۽Mt$tIڅtL9tEt I9sA9uM1fII9s$LcH<$HT$ItHLCH<$DpHt7MLBDHLt&MTBDPMtHT$MBDPu LLIW@AEA A fA J /Cf tPfvTf=wUf?ȀAIHtH=T1 H1[]A\A]A^A_ˈf ƒ?fȀ?AʀQfDHxAWAVIAUATIUSIE1HIEI]@,IM9GC,7@\tT@DIMIEHYH9vHI}H9HBÉH#HIMI]IEHYfINI9vCt7FHt$HLDvAHuAqHtsHD[]A\A]A^A_fHAqHJsqHA-sAHAqAWAVIAUATMUSIHH(|$`8HL$1LALL$HILL$E11LLHߋl$HI0HsHILlvHHD$ pHHHǾs1LHtHT$LH2vLLHtuD$`LpHq+LnpT$`tL^pHqfDH([]A\A]A^A_f.E11LLHHItHrHILoLoLofDLoCLot$`dfLoL$`tLoH߽ q;fDAVAUMATUISHAqHt2HHMDLHH߉q[]A\A]A^fDfAWAVMAUATIUSH5e"IAH*sHtU111HHlHHHt@$rMDLLH@HqH[]A\A]A^A_Dqf.AVAUEATUISHApHt2HHEDLHH߉p[]A\A]A^fDfAWAVEAUATIUSH5e!IAH*rHtU111HHkHHHt@$qEDLLH@HpH[]A\A]A^A_Dpf.AWAVMAUATAUSHIMHoHtIHHLD$HHMMDHPH߉nXZH[]A\A]A^A_ffAWAVMAUATAUSIMHHt$H56 qHt`111HHjHHHtKoHLMD$XMDHPHt$ H߉oXZH[]A\A]A^A_øof.AWAVIAUATIUSHEH(HT$nHIKkHHLlHc:oHHH!n1LHoL4qHt$HcH4qtpHT$LHHntYEu$T$AHmH(H[]A\A]A^A_t$H蔡HIHtTkLLYk‰D$뱐H8kHlH(1[]A\A]A^A_Df.AWAVEAUATIUSH5UIIHoHtU111HHiHHHtAnELLLH`HHulHH[]A\A]A^A_1@m1Df.AVAUEATUHSIHIHHT$ Ht6HHELHLHH$jHH[]A\A]A^@1ff.ATUISHHHDD$ fDD$ HLHHމ[]A\XUSH5HmHt1111HHgHHHtlHH[]fD1@l1USH5fHt0H111HhHHtfHH[]f.1ff.USHHlHzhHt]HlHHfHu'111HymHHeHH[]@HeH1[]1@HATUSHPLgMt=HL{hH v,8kHHtEttqH9hHP1[]A\fDAD$<0tnH5DAD$HLiHt1mHt$H|$HD$kD$0C HPH[]A\ÐAD$<0t.H59DAD$DAD$0AD$9H5 DAD$0AD$9H5Dq1f.HtsUSH5HkHHtI111HcdHHjHt+HHx HtRgxHH[]@HdH1[]1DAWAVIAUATIUSHHfH1HI.fgLHnjHHML!HIHLiEkHIHlhLLqdHHHuHHSHtsE1H~duLiMtLcMt$L(hH[]A\A]A^A_LhH[]A\A]A^A_+gLHpiHtE11ҹHcjHHiLkHHtv1HHLdHtleHAeMtLcMtLbgL*hH2h1EH[]A\A]A^A_E1E1HuekeLgMtLbMtLfHgLgLbf.AWAVAUATUSH(H|$Ht$dIĸM7HD$1E1@LiHx.tHXH5@HtL}LJ4~hHIH|$dHIcI|bHL$ID HHHL$HT$H5+)HH1LM8dL0iHXLL$0gLLgHHtQHT$JD 1HeHAtDHH<;cHuH.cDH([]A\A]A^A_HtfHI<cHuLbHt$f.HIMH.HHD$HHHe!Hf!Lt$ L|$PI^HD$ HT$(fDHCI9uH\$H=*E1L0H[HD$HT$!H!H!THItcL{IDH5-L1HILL9uHt$H,MLH1IL+LHXH[]A\A]A^A_HLH!8u1HX[]A\A]A^A_IH=x+1L61fUSHHHoHHHt1L‰E1t H[]M8|LH3H=2+H1H;`KHH []f.IH=+HuHHL>USHH(H1҅u$1E11HH1 kH~H([]AWAVHcAUATHUSHIHXHD$(HRH|$Ht$0T$HHD$HHD$$H u 1H$H|$0 HD$0H\$HHHHL$ -H\$H<$wH|$I4$HH7I$HD$ID$HIHD$@HD$8LIMM9HHOHt$LӃPLt$ MIH\$?fHLAԅx>u" $nIIIII)D$I)M9MuA+yM9LMLt$ w3$IEIIMII)D$IM9MBHLINjD$?HD$0HT$MHLHD$8I)H)L9IO…lHcLHH)<$L :@HHI9NPuLML)I)H)L9IGHc~-HLH)HI@AIHM9ANPuIcH9LIcH9,1I)HLD$HD$0fD<$Hct$LL9HHHH@xQcDD$LMMLt$ H\$0HH\$H9\$@LD,$IH$HH\$@H9\$HshL)LIHIHH9fDLHӅ~9EH8IHUIHEM)L)H9|$sHMuŋEA+MHL|$@HD$@H;$uHX[]A\A]A^A_f.Ht$(LLDHH9HHHHHxHQB@<$HcL$Lt|f.A0HIHHAvPP@H|$AE+=4$H|$8IMHHIEHl$8D$ HL$(fIH0HIHHIvHPH|$0HT$HHHHHH(HIHMD4 HHcIH|$McIHHILAׅLLAׅLl$LLAׅMHMHD$LM4HHD$ LHD$HAׅ`LLAׅLd$LLAׅMIHD$ L4LLHD$HAׅ5HLAׅLt$HLAׅLILLAׅLLAׅLLA׋<$MIM<$Hct$HD$fDA $HHIHHAT$\LML)I)H)L9IGHcHcLH)Ѓ<$Hf.IH0HIHHIvHHIcH91H|$LHHLD$L $H$LD$L $<$HcL$HD$8IfA6HHIH@pAVKMILl$LL$A4$IڋA99f)ƅ39MIM%AׅLLAׅMIMHHHDHHHHHHHOHPLML)I)H)L9IGхHcLH)HLAׅLt$HLAׅLHH|$HcLcL A9MA29>AA)EHIA4$IOA9M4AAA)EINM)E.AA9AA)EEDA)MILI999MIMLLAׅLd$LLAׅMHAׅALl$LLAׅMIM%Ht$(HI $HHIHHHIT$cHL$(HI6HHIHHpIV9AA)LIT$IMAHcT$Ht0f.A $0HIHHAt$HHT$(DI $H0HIHHIt$HHhLd$0HD$LH(II9Ld$~D,$H$LL<$L9|$shMHI)LILI:f.HHAօ~4EHu[HEHHUHL)L)H9|$sMIuȋ+ELLH,$H$H9D$zHX[]A\A]A^A_AHcT$Ht%fA $0HIHHAt$HHT$(I $H0HIHHIt$HHM9A9xRDMMA9)IMIډM)IMI։M9xMILL$AWAVHcAUATHUSHIHhHD$8HRH|$ Ht$@LD$HT$,HD$XHD$ D$H u 1HD$H|$@ HD$@H\$ IILHN4XILl$X|$H\$ IHHIHD$ MD$HHHD$PHD$HLMIL9IMwHT$ HH|$AՃpLLd$0MLd$ INfLLH|$AօxCu%L$xIIUIIEI)D$I)L9MuAA+$yLL9MLd$0Iw2T$HIHII)D$HL9I&LMINjD$FHD$@H|$ HHL HD$HH)H)H9HOƅHcHH)Ѓ|$Lf.HHI9OPuLML)M)H)L9IG…Hc~/HLH)HH@A$IHL9AL$PuHcH9|IcH901I)HLL$ HD$@{@|$Hct$,LLf:HHHH@xJ[DLMMINjD$Ld$0H\$@HH\$ H9\$PLDd$IH\$HH\$PH9\$ skIHL)LMIH<@HLH|$Ӆ~9EMHEIHUIL)M)L9T$ sHIuA+EMHL|$PHD$PH;D$tHh[]A\A]A^A_@Ht$8LLDHH:HHHHHxHJ:@|$HcT$,L|DA $0HIHHAt$HJf.H|$ +3t$H|$HHHHHHl$HD$HT$8@I $H0HIHHIt$HHH\$@H|$ HHHH(L,HHIDMmC$McHJ'HcHHH|$HD$AׅHHt$H|$&AׅHHt$ H|$AׅHH\$ H\$K&ILLd$0MH|$LAׅHLH|$AׅHLH|$MAׅLIHD$0H|$I\L$HLAׅlLHH|$AׅLLH|$LAׅIILHt$H|$ALd$HLLAׅMLt$LHLA׋|$LI6|$HcT$,HD$ +A6HHIH@pANLML)M)H)L9IG…HcHcLH)Ѓ|$Hf.I $H8HIHHI|$HHHcH91LD$H|$ HLHLL$LT$HLL$LT$N|$HcT$,HD$HmA4$HHIH@pAL$HD$ MLHD$kH|$ AMAE79q)…9IIIAׅLt$HLLAׅLHHHLHHHHLGHHLML)M)H)L9IG҅HHcLH)LHH|$AׅLLH|$LAׅIHH\$ IcEH< Ic܋7LA9NAA)ELIAIOA9M$AA $A)EMOT I)A$A9AMAA)EAډA)MIMI99W9LIMIHLH|$AׅhHLH|$AׅIIILAׅHHt$ H|$AׅHI\$ H\$HT$8HI6HHIHHpINHT$8HI4$HHIHHpIL$9lj)LHI|$ IAHcT$,Lt'fAM0HIHHAuHNHT$8fDIMH0HIHHIuHHLd$@HD$ LH(II9Ld$5LDl$IH\$HH\$H9\$ seIHL)LMIH6fHLH|$Ӆ~5EMuWHEIHUIL)M)L9T$ sHIuA+EMHL|$HD$H9D$zHh[]A\A]A^A_AHcT$,Lt%fA $0HIHHAt$HHT$8I $H0HIHHIt$HHQAM99xUMMA 9AA)IMIډMAA)IMIԉM9xLMH|$ f.DAWAVAUATIUSHL/HOI9s)LfDx9tPI$HHBH9rI$uAD$u AD$H!I$ID$1H[]A\A]A^A_8]uH9sH-϶!HL)Ht:L5!Lcf.LLH1uB|=t,II.Huڃt/AT$pAD$bAFH[]A\A]A^A_AEVff.USH1Hht4HH[]Ðt41HH[]fDHLcH Lc@LP1IMt fDNH (F HI9uKD H9t f.Hh HH H%H Hf.ATLgUSHHI9vR111%fHH4H]SL9TrtDH0BDFu΅~[]A\1fEuE H!HEHE[]A\ff.HHWH9r$OH!H !HGHHHH9v8[ux.uHS.HHHHKH9sHrH9v :.t=DSuCH5[!H3Hs[f.Gk@z]uHH[ÐH9w | fUSHHH4HHHtHCHk H[]CuC H!HHCf.AUATUSHH)Lo(t6HHHw HIhHCHK(JH4H,iDHLIMgL9s,8}Lpu8IA~} M9M7uAGuAG fH!I_(IIGIIIW(HپHLH)HEGEM7MgIO(M9sAPրv<A)S;A.qA[A(IG8H@hIG8L`hI  IG(KD@EOEOIIWH9s$HHH9v 8\)\LI  IG(KEGEIIOH9vLHPH9vC8\qAu2Mw(AGHdz!IIGH1A$L@1Mw(EoHIEGIG8H@IG8@DMw(IIOLeA{ADD`HIHHAOMcFHLHKAGIG8@dIIODH9s%*HpH9v \IIOMw(DID(A\EgEuAGH!IGHHBIDAEA)AwtwDIW(HLIHLL)H6IW(EOL)EHLXLEGMw(E]IIOL11f.A*u#uEWEuAG H!IIGALKIIOH;L$ t(AWMNMO(IG8H@IG8@HI_(H9\$HH[]A\A]A^A_@IG8@$E_Ez1Ҿ(LIIOf.LIIO@EWEAG fDA}Awf.L`LH)Mw(I1IO1LvfDPLIW(L)5E_EuAGH !IIG@x{IHLIoM'IGI9s A<$,LLIIOH9rcAwuAG I_(H9\$H!IIGXAGuAGH|!IIGHH[]A\A]A^A_fDHPH9v 8\H9tz\tIHHH9uIl@:}uH9ZAO^AG QfIT$H9IL$AT$HL$DPL19ÉAuAG H!IIG@HD$ M'LIOD$<^D$= D$>]IHD$(HL$D$?IG'HL$M'LIO[LpLIIOH96HPH9)fDLhLL@LL8LHD$cHD$Hfx}PMw(H1I1Lx)ERx)HI{1Ҿ L1ҾLf.AWAVAUATAUSAHtO AIHuUHS Iǿ覱HHŹ tH L$ I9v.H L$ H[]A\A]A^A_LI9rI)LHH|@H|$0螱HHD$(HD$8tLt$MHl$HLt$Lt$D$ D$@IF@IfHH@PHH9uHHHEHEHExHHEP)HDžpEx1E Dm$E@EDEHHEXE`HEhELHEdDD$ EHT$8AHBHE0AWLD$ HT$8HHRHU8HE(HD$8H|$(H4虰HHET$ HEE1E1E1AHpHHLQHHXtXHp!Hxt1LIIfDHB<u9uAAI됋ELAEЍPAĉULACtjMِA9uJM HEALcmQH~(088u"1fDD<8D8<0u L9uE!AIAupHD$8I9_({ HD$@$~fDID4I%IKHH9ufHD$HHPH9\$"H2H{B HCIG H9SI9_( H9sHp@_I9_(3HpHfI9_(; rfH=pMaH=xH=hIAHI+T$IHHLID$LMLMH(HD$xPLL$0HT$H^_ID$J,0{ HL$A$fAGAGAGI9_({ HL$A$DAGHD$@$@AHO|Ll$A/HDIO%IDH4LxL9LEHMLD$xHLPLL$0yHAXAYI$JH0J%H9uf.ID$8HL$ HH9YHHAD$xLML)HLPLt$0HT$MHAZA[:LMHHD$ @HD$ IT$8MHHHD$ AHI+T$IHLLID$MHLMHhHPD$xPLL$0HT$fHZYID$Jl01f.L\$HMD$xLHLPLL$0HT$HA^Z]L\$AO4;D$pdP6H9\$&fDHl$ MHD$H9Df.AWAVIAUATMUSIHH8HT$LL$ M9 M<$IL|$MIWf.H=DH= RH=(H9\$HIM9KJ4H%H=0SvH9 H9oH9I9_(vU3@ @t$T$H8Wu0_t+I9_ s%sHpHL_C1H8[]A\A]A^A_H=`LMM~NLL%H=X'AH=HH=P H=8uEAIcHID$L@ImHI)HT$L\$(HL$L)H9FID$LHLD$H&T$pL\$(HL$LD$A@IcI9t@J9MuMLÉT$pH=H9\$8HCHDI9_ >I9_({ HD$@$~fDID4I%IKHH9ufHD$HHPH9\$"H2H{B HCIG H9SI9_( H9ksHp@_I9_(A3HpHfI9_(; rfH=pMaH=xH=hIAHI+T$IHHLID$LMLMH(HD$xPLL$0HT$H^_ID$J,0{ HL$A$fAGAGAGI9_({ HL$A$DAGHD$@$@AHO|Ll$A/HDIO%IDH4LxL9LEHMLD$xHLPLL$0yHAXAYI$JH0J%H9uf.ID$8HL$ HH9YHHAD$xLML)HLPLt$0HT$MHAZA[:LMHHD$ @HD$ IT$8MHHHD$ AHI+T$IHLLID$MHLMHhHPD$xPLL$0HT$fHZYID$Jl01f.L\$HMD$xLHLPLL$0HT$HA^Z]L\$AO4;D$pdP6H9\$&fDHl$ MHD$H9Df.AWAAVAUATUSHˉHD$8IH9ALAHL$DɽAL$A~L$M4H LHX?H0t_QHtH H(uA~Tf.HMH9u[]A\A]A^A_fAAL|$ILHH9Bf.|$%HrA0HI8@f.AWAVIAUATMUSHHHHGhH;w HT$(HL$ H_PHD$HG`HD$8FD$HE1HHP(HD$ HAILH}HSHwAZL;}(A[HD$HD$|$ E7|$1E1A H}AtK~IDt$0LD$Lt$ H}HHwEAPLLI_AYuDt$0H}HD$At8|$H|$0L$HH|$0B_t_fuZAt*H|$0WHAH|$0Q!A_\$؃t0H|$0"HH|$0Bf|$_ A${/Ld$HL$H_(Ht$C<,LHIEHL$L;|$(HLLLd$8ILHEHt$HHP(H}HESHT$0MLHwL;}(HD$XZDt$|$ A fDH}G$E1A AtEj1AAt%AABA_AHHwLLD$EAPHT$0H}HD$Y^DEcH}A _DA_G$bAAEAĂ_HAE+@AHD$HH[]A\A]A^A_D$]@AWAVAUATIUSH8L9LD$HIIHEHJHD$JHƁHXHxHHLt$H|$HHH_]HhHXLt IUILLH;LD$HLHHI"I9uLD$ILLLHHLD$LLLHIMH;\$H8L[]A\A]A^A_ÐLD%HHHH9uHLIUILLH{LD$HLHHIbI9uIFH|$H\$HHEHHH8%Mt6fHEI^IHJ%IJIV%H9LDMHLLHI9uHMH\$HJ<2H|$&fH(tH0tHt IDII@%LH+UHHEIH{fHp%LH+UHHEIHPELIUILLHLD$HLHHII9uIFH\$ ML|$(H\$MHD$IH MIHLILLHI9tHLH\$ ML|$(t9LD$HL$HxIMwHxLMAWAVAAUATUSH?etHD[]A\A]A^A_@HGxEHD$uՋ@@AljD$AtAHD$DIIIHx(@vNHD$@$LEAHHHD$HHAHD$8HL$8H9L$IAT@$LEAHHHD$HHAHD$8HL$8H9L$wHD$L@XMHD$HH9{A\$LLd$ Ll$(HIAIL9 E8,$uHL$HL)HcQ`H9|HLnuL\$Ld$ Ll$(H9l$8HD$H|$8Ll$hL$HD$pD$Hp8HH0H$$L$HDŽ$HHHD$HL$HHDŽ$HH$HDŽ$H$HDŽ$IHDŽ$HDŽ$IH|$@HL\$xIHD$PH$D$IIHD$`ID$HLALLHD$8L$HMAP[]IHD$($HD$ D$X$@HD$HL$@H9D(L9D$(HD$ HDD$|$ HD$ 11|$A %A@t>~ %s -> %sLOG_AUTHLOG_AUTHPRIVLOG_CRONLOG_DAEMONLOG_FTPLOG_KERNLOG_LPRLOG_MAILLOG_NEWSLOG_SYSLOGLOG_USERLOG_UUCPLOG_LOCAL0LOG_LOCAL1LOG_LOCAL2LOG_LOCAL3LOG_LOCAL4LOG_LOCAL5LOG_LOCAL6LOG_LOCAL7WARNING: Log size limit met but log file rotation turned off. Forcing log file rotation anyways. Need to rotate log file due to size but ran out of memory. Need to rotate log file due to size but could not get local time. ERROR: Can't open %s in append mode (check permissions!). WARNING: File locking not supported (NFS?)ERROR: %s is locked by another process ERROR: optaddarg: Unregistered option %s ERROR: optaddarg: strdup() failed ERROR: optaddarg: malloc() failed ERROR: optparse: Can't register new option (not enough memory) ERROR: optparse: longopts[] is too small ERROR: optparse: shortopts[] is too small ERROR: optparse: (short|long)opts[] is too small ERROR: Please edit the example config file %s ERROR: Missing argument for option at line %d ERROR: Missing closing parenthesis in option %s at line %d ERROR: Empty argument for option %s at line %d ERROR: Incomplete option passed (missing argument) ERROR: optparse: No corresponding long name for option '-%c' ERROR: Parse error at line %d: Unknown option %s WARNING: Ignoring unsupported option %s at line %u WARNING: Ignoring unsupported option --%s (-%c) WARNING: Ignoring unsupported option --%s ERROR: Can't register argument for option %s ERROR: Can't register argument for option --%s WARNING: Ignoring deprecated option %s at line %u WARNING: Ignoring deprecated option --%s (-%c) WARNING: Ignoring deprecated option --%s ERROR: optparse: Can't compile regular expression %s for option %s ERROR: Incorrect argument format for option %s ERROR: Incorrect argument format for option --%s (-%c) ERROR: Incorrect argument format for option --%s ERROR: Option --%s (-%c) requires a non-empty string argument ERROR: Option --%s requires a non-empty string argument ERROR: Can't parse numerical argument for option %s ERROR: Can't parse numerical argument for option --%s (-%c) ERROR: Can't parse numerical argument for option --%s WARNING: Numerical value for option %s too high, resetting to 4G WARNING: Numerical value for option --%s (-%c) too high, resetting to 4G ERROR: optparse: calloc failed ERROR: optparse: strdup failed ERROR: Problem parsing options (name == NULL) Dump authenticode certificate chain.Perform HTML, script, and text normalizationAlways generate MDB entries for PE sectionsMaximum number of mismatched signatures when building a CVD. Zero disables this limit.Feature level to put in the CVDVersion number of the CVD to buildCreate a hybrid (standard and bytecode) database fileForce using the interpreter instead of the JITTrust loaded bytecode (default yes)Load and print bytecode information without executingPrint IR of bytecode signatureInput file to run the bytecode nDon't show source line during tracingName of the analyzer as seen in prewikkaSave all reports to a log file.By default the log file is locked for writing and only a single daemon process can write to it. This option disables the lock.Maximum size of the log file. Value of 0 disables the limit.Log all clean files. Useful in debugging but drastically increases the log size.Use the system logger (can work together with LogFile).Type of syslog messages. Please refer to 'man syslog' for the facility names.Rotate log file. Requires LogFileMaxSize option set prior to this option.Log additional information about the infected file, such as its size and hash, together with the virus name.Save the process ID to a file.This option allows you to change the default temporary directory.This option allows you to change the default database directory. If you enable it, please make sure it points to the same directory in both clamd and freshclam.Only load the official signatures published by the ClamAV project.By default, yara rules will be loaded. This option allows you to exclude yara rules when scanning and also to scan only using yara rules. Valid options are yes|no|onlyPath to a local socket file the daemon will listen on.Sets the group ownership on the unix socket.Sets the permissions on the unix socket to the specified mode.Remove a stale socket after unclean shutdownA TCP port number the daemon will listen on.By default clamd binds to INADDR_ANY. This option allows you to restrict the TCP address and provide some degree of protection from the outside world.Maximum length the queue of pending connections may grow to.Close the STREAM session when the data size limit is exceeded. The value should match your MTA's limit for the maximum attachment size.The STREAM command uses an FTP-like protocol. This option sets the lower boundary for the port range.This option sets the upper boundary for the port range.Maximum number of threads running at the same time.This option specifies the time (in seconds) after which clamd should timeout if a client doesn't provide any data.This option specifies the time (in seconds) after which clamd should timeout if a client doesn't provide any initial command after connecting.This option specifies how long to wait (in milliseconds) if the send buffer is full. Keep this value low to prevent clamd hanging.Waiting for data from clamd will timeout after this time (seconds).Maximum number of queued items (including those being processed by MaxThreads threads). It is recommended to have this value at least twice MaxThreads if possible. WARNING: you shouldn't increase this too much to avoid running out of file descriptors, the following condition should hold: MaxThreads*MaxRecursion + MaxQueue - MaxThreads + 6 < RLIMIT_NOFILE (usual max for RLIMIT_NOFILE is 1024) This option specifies how long (in seconds) the process should wait for a new job.Don't scan files/directories whose names match the provided regular expression. This option can be specified multiple times.Maximum depth the directories are scanned at.Follow symlinks to regular files.Scan files and directories on other filesystems.This option specifies the time intervals (in seconds) in which clamd should perform a database check.This option allows you to disable clamd's caching feature.Execute a command when a virus is found. In the command string %v will be replaced with the virus name. Additionally, two environment variables will be defined: $CLAM_VIRUSEVENT_FILENAME and $CLAM_VIRUSEVENT_VIRUSNAME./usr/bin/mailx -s "ClamAV VIRUS ALERT: %v" alert < /dev/nullStop the daemon when libclamav reports an out of memory condition.Permit use of the ALLMATCHSCAN command.Enable debug messages in libclamav.Don't remove temporary files (for debugging purposes).Run the daemon as a specified user (the process must be started by root).With this option enabled ClamAV will load bytecode from the database. It is highly recommended you keep this option on, otherwise you'll miss detections for many new viruses.Set bytecode security level. Possible values: TrustSigned - trust bytecode loaded from signed .c[lv]d files, insert runtime safety checks for bytecode loaded from other sources Paranoid - don't trust any bytecode, insert runtime checks for all Recommended: TrustSigned, because bytecode in .cvd files already has these checks.Set bytecode timeout in milliseconds.Allow loading bytecode from outside digitally signed .c[lv]d files.^(Auto|ForceJIT|ForceInterpreter|Test)$Set bytecode execution mode. Possible values: Auto - automatically choose JIT if possible, fallback to interpreter ForceJIT - always choose JIT, fail if not possible ForceInterpreter - always choose interpreter Test - run with both JIT and interpreter and compare results. Make all failures fatal.^(none|None|bytecode|Bytecode|pcre|PCRE)$Collect and print execution statistics. Possible values: Bytecode - reports bytecode statistics PCRE - reports PCRE execution statistics None - reports no statisticsDetect Potentially Unwanted Applications.Exclude a specific PUA category. This directive can be used multiple times. See https://www.clamav.net/documents/potentially-unwanted-applications-pua for the complete list of PUA categories.Only include a specific PUA category. This directive can be used multiple times.In some cases (eg. complex malware, exploits in graphic files, and others), ClamAV uses special algorithms to provide accurate detection. This option controls the algorithmic detection.PE stands for Portable Executable - it's an executable file format used in all 32- and 64-bit versions of Windows operating systems. This option allows ClamAV to perform a deeper analysis of executable files and it's also required for decompression of popular executable packers such as UPX or FSG. If you turn off this option, the original files will still be scanned, but without additional processing.Executable and Linking Format is a standard format for UN*X executables. This option allows you to control the scanning of ELF files. If you turn off this option, the original files will still be scanned, but without additional processing.With this option enabled clamav will try to detect broken executables (both PE and ELF) and mark them as Broken.Executable.Enable the built in email scanner. If you turn off this option, the original files will still be scanned, but without parsing individual messages/attachments.Scan RFC1341 messages split over many emails. You will need to periodically clean up $TemporaryDirectory/clamav-partial directory. WARNING: This option may open your system to a DoS attack. Please don't use this feature on highly loaded servers.With this option enabled ClamAV will try to detect phishing attempts by using signatures.Scan URLs found in mails for phishing attempts using heuristics.Always block cloaked URLs, even if they're not in the database. This feature can lead to false positives.PhishingAlwaysBlockSSLMismatchAlways block SSL mismatches in URLs, even if they're not in the database. This feature can lead to false positives.Detect partition intersections in raw disk images using heuristics.Allow heuristic match to take precedence. When enabled, if a heuristic scan (such as phishingScan) detects a possible virus/phish it will stop scan immediately. Recommended, saves CPU scan-time. When disabled, virus/phish detected by heuristic scans will be reported only at the end of a scan. If an archive contains both a heuristically detected virus/phish, and a real malware, the real malware will be reported. Keep this disabled if you intend to handle "*.Heuristics.*" viruses differently from "real" malware. If a non-heuristically-detected virus (signature-based) is found first, the scan is interrupted immediately, regardless of this config option.Enable the Data Loss Prevention module.This option sets the lowest number of Credit Card numbers found in a file to generate a detect.This option sets the lowest number of Social Security Numbers found in a file to generate a detect.With this option enabled the DLP module will search for valid SSNs formatted as xxx-yy-zzzz.With this option enabled the DLP module will search for valid SSNs formatted as xxxyyzzzzPerform HTML/JavaScript/ScriptEncoder normalisation and decryption. If you turn off this option, the original files will still be scanned, but without additional processing.This option enables scanning of OLE2 files, such as Microsoft Office documents and .msi files. If you turn off this option, the original files will still be scanned, but without additional processing.With this option enabled OLE2 files with VBA macros, which were not detected by signatures will be marked as "Heuristics.OLE2.ContainsMacros".This option enables scanning within PDF files. If you turn off this option, the original files will still be scanned, but without decoding and additional processing.This option enables scanning within SWF files. If you turn off this option, the original files will still be scanned, but without decoding and additional processing.This option enables scanning xml-based document files supported by libclamav. If you turn off this option, the original files will still be scanned, but without additional processing.This option enables scanning HWP3 files. If you turn off this option, the original files will still be scanned, but without additional processing.Scan within archives and compressed files. If you turn off this option, the original files will still be scanned, but without unpacking and additional processing.Mark encrypted archives as viruses (Encrypted.Zip, Encrypted.RAR).This option causes memory or nested map scans to dump the content to disk. If you turn on this option, more data is written to disk and is available when the leave-temps option is enabled at the cost of more disk writes.This option sets the maximum amount of data to be scanned for each input file. Archives and other containers are recursively extracted and scanned up to this value. The value of 0 disables the limit. WARNING: disabling this limit or setting it too high may result in severe damage.Files/messages larger than this limit won't be scanned. Affects the input file itself as well as files contained inside it (when the input file is an archive, a document or some other kind of container). The value of 0 disables the limit. WARNING: disabling this limit or setting it too high may result in severe damage to the system.Nested archives are scanned recursively, e.g. if a Zip archive contains a RAR file, all files within it will also be scanned. This option specifies how deeply the process should be continued. The value of 0 disables the limit. WARNING: disabling this limit or setting it too high may result in severe damage to the system.Number of files to be scanned within an archive, a document, or any other container file. The value of 0 disables the limit. WARNING: disabling this limit or setting it too high may result in severe damage to the system.This option sets the maximum size of a file to check for embedded PE. Files larger than this value will skip the additional analysis step. Negative values are not allowed. WARNING: setting this limit too high may result in severe damage or impact performance.This option sets the maximum size of a HTML file to normalize. HTML files larger than this value will not be normalized or scanned. Negative values are not allowed. WARNING: setting this limit too high may result in severe damage or impact performance.This option sets the maximum size of a normalized HTML file to scan. HTML files larger than this value after normalization will not be scanned. Negative values are not allowed. WARNING: setting this limit too high may result in severe damage or impact performance.This option sets the maximum size of a script file to normalize. Script content larger than this value will not be normalized or scanned. Negative values are not allowed. WARNING: setting this limit too high may result in severe damage or impact performance.This option sets the maximum size of a ZIP file to reanalyze type recognition. ZIP files larger than this value will skip the step to potentially reanalyze as PE. Negative values are not allowed. WARNING: setting this limit too high may result in severe damage or impact performance.This option sets the maximum number of partitions of a raw disk image to be scanned. Raw disk images with more partitions than this value will have up to the value number partitions scanned. Negative values are not allowed. WARNING: setting this limit too high may result in severe damage or impact performance.This option sets the maximum number of icons within a PE to be scanned. PE files with more icons than this value will have up to the value number icons scanned. Negative values are not allowed. WARNING: setting this limit too high may result in severe damage or impact performance.This option sets the maximum recursive calls to HWP3 parsing function. HWP3 files using more than this limit will be terminated and alert the user. Scans will be unable to scan any HWP3 attachments if the recursive limit is reached. Negative values are not allowed. WARNING: setting this limit too high may result in severe damage or impact performance.This clamscan option is currently for testing only. It sets the engine parameter CL_ENGINE_TIME_LIMIT. The value is in milliseconds.This option sets the maximum calls to the PCRE match function during an instance of regex matching. Instances using more than this limit will be terminated and alert the user but the scan will continue. For more information on match_limit, see the PCRE documentation. Negative values are not allowed. WARNING: setting this limit too high may severely impact performance.This option sets the maximum recursive calls to the PCRE match function during an instance of regex matching. Instances using more than this limit will be terminated and alert the user but the scan will continue. For more information on match_limit_recursion, see the PCRE documentation. Negative values are not allowed and values > PCREMatchLimit are superfluous. WARNING: setting this limit too high may severely impact performance.This option sets the maximum filesize for which PCRE subsigs will be executed. Files exceeding this limit will not have PCRE subsigs executed unless a subsig is encompassed to a smaller buffer. Negative values are not allowed. Setting this value to zero disables the limit. WARNING: setting this limit too high or disabling it may severely impact performance.This option enables on-access scanning (Linux only)This option specifies a directory or mount point which should be scanned on access. The mount point specified, or the mount point containing the specified directory will be watched, but only notifications will occur. If any directories are specified, this option will preempt the DDD system. It can also be used multiple times.This option specifies a directory (including all files and directories inside it), which should be scanned on access. This option can be used multiple times.This option allows excluding directories from on-access scanning. It can be used multiple times. Only works with DDD system.Use this option to whitelist the root UID (0) and allow any processes run under root to access all watched files without triggering scans.With this option you can whitelist specific UIDs. Processes with these UIDs will be able to access all files. This option can be used multiple times (one per line). Using a value of 0 on any line will disable this option entirely. To whitelist the root UID please enable the OnAccessExcludeRootUID option.Files larger than this value will not be scanned in on access.This option toggles the dynamic directory determination system for on-access scanning (Linux only).This option changes fanotify behavior to prevent access attempts on malicious files instead of simply notifying the user (On Access scan only).Enables extra scanning and notification after catching certain inotify events. Only works with the DDD system enabled.When started by root freshclam will drop privileges and switch to the user defined in this option.This option defined how many times daily freshclam should check for a database update.Use DNS to verify the virus database version. Freshclam uses DNS TXT records to verify the versions of the database and software itself. With this directive you can change the database verification domain. WARNING: Please don't change it unless you're configuring freshclam to use your own database verification domain.DatabaseMirror specifies to which mirror(s) freshclam should connect. You should have at least two entries: db.XY.clamav.net (or db.XY.ipv6.clamav.net for IPv6) and database.clamav.net (in this order). Please replace XY with your country code (see https://www.iana.org/domains/root/db). database.clamav.net is a round-robin record which points to our most reliable mirrors. It's used as a fall back in case db.XY.clamav.net is not working.db.XY.clamav.net database.clamav.netThis option allows you to easily point freshclam to private mirrors. If PrivateMirror is set, freshclam does not attempt to use DNS to determine whether its databases are out-of-date, instead it will use the If-Modified-Since request or directly check the headers of the remote database files. For each database, freshclam first attempts to download the CLD file. If that fails, it tries to download the CVD file. This option overrides DatabaseMirror, DNSDatabaseInfo and Scripted Updates. It can be used multiple times to provide fall-back mirrors.mirror1.mynetwork.com mirror2.mynetwork.comThis option defines how many attempts freshclam should make before giving up.With this option you can control scripted updates. It's highly recommended to keep them enabled.With this option enabled, freshclam will attempt to load new databases into memory to make sure they are properly handled by libclamav before replacing the old ones.By default freshclam will keep the local databases (.cld) uncompressed to make their handling faster. With this option you can enable the compression. The change will take effect with the next database update.Download an additional 3rd party signature database distributed through the ClamAV mirrors. This option can be used multiple times.With this option you can provide custom sources (http:// or file://) for database files. This option can be used multiple times.http://myserver.com/mysigs.ndb file:///mnt/nfs/local.hdbIf you're behind a proxy, please enter its address here.A user name for the HTTP proxy authentication.A password for the HTTP proxy authentication.If your servers are behind a firewall/proxy which does a User-Agent filtering you can use this option to force the use of a different User-Agent header.Send the RELOAD command to clamd after a successful update.Run a command after a successful database update.Run a command when a database update error occurs.Run a command when freshclam reports an outdated version. In the command string %v will be replaced with the new version number.With this option you can provide a client address for the database downloading. Useful for multi-homed systems.Timeout in seconds when connecting to database server.Timeout in seconds when reading from database server.This option enables support for Google Safe Browsing. When activated for the first time, freshclam will download a new database file (safebrowsing.cvd) which will be automatically loaded by clamd and clamscan during the next reload, provided that the heuristic phishing detection is turned on. This database includes information about websites that may be phishing sites or possible sources of malware. When using this option, it's mandatory to run freshclam at least every 30 minutes. Freshclam uses the ClamAV's mirror infrastructure to distribute the database and its updates but all the contents are provided under Google's terms of use. See https://transparencyreport.google.com/safe-browsing/overview and https://www.clamav.net/documents/safebrowsing for more information.This option enables downloading of bytecode.cvd, which includes additional detection mechanisms and improvements to the ClamAV engine.Disable authenticode certificate chain verification in PE files.Initialize a supplementary group access (the process must be started by root).Define the clamd socket to connect to for scanning. This option is mandatory! Syntax: ClamdSocket unix:path ClamdSocket tcp:host:port The first syntax specifies a local unix socket (needs an absolute path) e.g.: ClamdSocket unix:/var/run/clamd/clamd.socket The second syntax specifies a tcp local or remote tcp socket: the host can be a hostname or an ip address; the ":port" field is only required for IPv6 addresses, otherwise it defaults to 3310 ClamdSocket tcp:192.168.0.1 This option can be repeated several times with different sockets or even with the same socket: clamd servers will be selected in a round-robin fashion.Define the interface through which we communicate with sendmail. This option is mandatory! Possible formats are: [[unix|local]:]/path/to/file - to specify a unix domain socket; inet:port@[hostname|ip-address] - to specify an ipv4 socket; inet6:port@[hostname|ip-address] - to specify an ipv6 socket./tmp/clamav-milter.socket inet:7357Define the group ownership for the (unix) milter socket.Sets the permissions on the (unix) milter socket to the specified mode.Messages originating from these hosts/networks will not be scanned This option takes a host(name)/mask pair in CIRD notation and can be repeated several times. If "/mask" is omitted, a host is assumed. To specify a locally originated, non-smtp, email use the keyword "local".local 192.168.0.0/24 1111:2222:3333::/48^(Accept|Reject|Defer|Blackhole|Quarantine)$Action to be performed on clean messages (mostly useful for testing). The following actions are available: Accept: the message is accepted for delivery Reject: immediately refuse delivery (a 5xx error is returned to the peer) Defer: return a temporary failure message (4xx) to the peer Blackhole: like Accept but the message is sent to oblivion Quarantine: like Accept but message is quarantined instead of being deliveredAction to be performed on error conditions (this includes failure to allocate data structures, no scanners available, network timeouts, unknown scanner replies and the like. The following actions are available: Accept: the message is accepted for delivery; Reject: immediately refuse delivery (a 5xx error is returned to the peer); Defer: return a temporary failure message (4xx) to the peer.This option allows you to set a specific rejection reason for infected messages and it's therefore only useful together with "OnInfected Reject" The string "%v", if present, will be replaced with the virus name.If this option is set to "Replace" (or "Yes"), an "X-Virus-Scanned" and an "X-Virus-Status" headers will be attached to each processed message, possibly replacing existing headers. If it is set to Add, the X-Virus headers are added possibly on top of the existing ones. Note that while "Replace" can potentially break DKIM signatures, "Add" may confuse procmail and similar filters.When AddHeader is in use, this option allows you to set the reported hostname. This may be desirable in order to avoid leaking internal names. If unset the real machine name is used.Execute a command when an infected message is processed. The following parameters are passed to the invoked program in this order: virus name, queue id, sender, destination, subject, message id, message date. Note #1: this requires MTA macroes to be available (see LogInfected below) Note #2: the process is invoked in the context of clamav-milter Note #3: clamav-milter will wait for the process to exit. Be quick or fork to avoid unnecessary delays in email delivery/usr/local/bin/my_infected_message_handlerChroot to the specified directory. Chrooting is performed just after reading the config file and before dropping privileges.This option specifies a file which contains a list of basic POSIX regular expressions. Addresses (sent to or from - see below) matching these regexes will not be scanned. Optionally each line can start with the string "From:" or "To:" (note: no whitespace after the colon) indicating if it is, respectively, the sender or recipient that is to be whitelisted. If the field is missing, "To:" is assumed. Lines starting with #, : or ! are ignored.Messages from authenticated SMTP users matching this extended POSIX regular expression (egrep-like) will not be scanned. As an alternative, a file containing a plain (not regex) list of names (one per line) can be specified using the prefix "file:". e.g. SkipAuthenticated file:/etc/good_guys Note: this is the AUTH login name!SkipAuthenticated ^(tom|dick|henry)$This option allows you to tune what is logged when a message is infected. Possible values are Off (the default - nothing is logged), Basic (minimal info logged), Full (verbose info logged) Note: For this to work properly in sendmail, make sure the msg_id, mail_addr, rcpt_addr and i macroes are available in eom. In other words add a line like: Milter.macros.eom={msg_id}, {mail_addr}, {rcpt_addr}, i to your .cf file. Alternatively use the macro: define(`confMILTER_MACROS_EOM', `{msg_id}, {mail_addr}, {rcpt_addr}, i') Postfix should be working fine with the default settings.This option allows you to tune what is logged when no threat is found in a scanned message. See LogInfected for possible values and caveats. Useful in debugging but drastically increases the log size.This option affects the behaviour of LogInfected, LogClean and VirusAction when a message with multiple recipients is scanned: If SupportMultipleRecipients is off (the default) then one single log entry is generated for the message and, in case the message is determined to be malicious, the command indicated by VirusAction is executed just once. In both cases only the last recipient is reported. If SupportMultipleRecipients is on: then one line is logged for each recipient and the command indicated by VirusAction is also executed once for each recipient. Note: although it's probably a good idea to enable this option, the default value is currently set to off for legacy reasons.yesExampleERROR: Unknown option passed footruehelp^(yes|true|1|no|false|0)$config-file/etc/clamd.conf/etc/freshclam.conf/etc/clamav-milter.confdebuggen-jsondumpcertsquietleave-tempsno-warningsshow-progressstdoutdaemonno-dnslist-mirrorsupdate-dbreloadmultiscanfdpassstreamallmatchdatabase/usr/share/clamavrecursivegen-mdbfollow-dir-symlinks^[0-9]+$follow-file-symlinksbellno-summaryfile-listinfectedsuppress-ok-resultscopyremoveexcludeexclude-dirinclude-dirstructured-ssn-formathex-dumpmd5sha1sha256impprint-certshtml-normaliseascii-normaliseutf16-decodebuildmax-bad-sigs3000flevelcvd-versionno-cdiffserverunpackunpack-currentinfolist-sigsfind-sigsdecode-sigstest-sigsvbavba-hexcomparerun-cdiffverify-cdiffhybriddefaultcolorsconfig-dir/etcnon-defaultgenerate-configforce-interpretertrust-bytecodeprintsrcPrint source code of bytecodeprintbcirinputtracebytecode trace levelno-trace-showsourcearchive-verbosebytecode-trust-allhttp-proxyproxy-userlog-verboseforcedisable-summarydisable-archiveno-archiveno-peno-elfno-ole2no-pdfno-htmlno-mailno-phishing-sigsno-phishing-scan-urlsno-algorithmicno-phishing-restrictedscanmax-ratiomax-space^[0-9]+[KM]?$unzipunrararjunzoolhajartartgzdebblock-maxPreludeEnableprelude-enableEnable preludePreludeAnalyzerNameprelude-analyzer-name/tmp/clamav.logLogFileUnlockLogFileMaxSizeLogTimeLog time with each message.LogCleanLogSyslogLogFacilityLogVerboseEnable verbose logging.LogRotatelog-rotateExtendedDetectionInfoPidFile/var/run/clam.pidTemporaryDirectorytempdir/tmpDatabaseDirectorydatadir/var/lib/clamavOfficialDatabaseOnlyofficial-db-onlynoYaraRulesyara-rulesLocalSocket/tmp/clamd.socketLocalSocketGroupvirusgroupLocalSocketMode660FixStaleSocketTCPSocket3310TCPAddr127.0.0.1MaxConnectionQueueLength30StreamMaxLength25MStreamMinPort1024StreamMaxPort2048MaxThreads120CommandReadTimeoutSendBufTimeout200300MaxQueueIdleTimeout^/proc/ ^/sys/MaxDirectoryRecursionmax-dir-recursion15FollowDirectorySymlinksFollow directory symlinks.FollowFileSymlinksCrossFilesystemscross-fsSelfCheck600DisableCachedisable-cacheVirusEventExitOnOOMAllowAllMatchScanForegroundforegroundDon't fork into background.DebugLeaveTemporaryFilesUserBytecodeBytecodeSecurity^(TrustSigned|Paranoid)$TrustSignedBytecodeTimeoutbytecode-timeout5000BytecodeUnsignedbytecode-unsignedBytecodeModebytecode-modeAutoStatisticsstatisticsNoneDetectPUAdetect-puaExcludePUAexclude-puaNetTool PWToolIncludePUAinclude-puaSpy Scanner RATAlgorithmicDetectionalgorithmic-detectionScanPEscan-peScanELFscan-elfDetectBrokenExecutablesdetect-brokenScanMailscan-mailScanPartialMessagesPhishingSignaturesPhishingScanURLsPhishingAlwaysBlockCloakphishing-cloakphishing-sslPartitionIntersectionpartition-intersectionHeuristicScanPrecedenceheuristic-scan-precedenceStructuredDataDetectiondetect-structuredStructuredMinCreditCardCountstructured-cc-countStructuredMinSSNCountstructured-ssn-countStructuredSSNFormatNormalStructuredSSNFormatStrippedScanHTMLscan-htmlScanOLE2scan-ole2OLE2BlockMacrosblock-macrosScanPDFscan-pdfScanSWFscan-swfScanXMLDOCSscan-xmldocsScanHWP3scan-hwp3ScanArchivescan-archiveArchiveBlockEncryptedblock-encryptedForceToDiskforce-to-diskmax-scansize100Mmax-recursion16max-files10000MaxEmbeddedPEmax-embeddedpe10MMaxHTMLNormalizemax-htmlnormalizeMaxHTMLNoTagsmax-htmlnotags2MMaxScriptNormalizemax-scriptnormalizeMaxZipTypeRcgmax-ziptypercg1MMaxPartitionsmax-partitions128MaxIconsPEmax-iconspe100MaxRecHWP3max-rechwp3TimeLimittimelimitPCREMatchLimitpcre-match-limit100000PCRERecMatchLimitpcre-recmatch-limitPCREMaxFileSizepcre-max-filesizeOnAccessMountPath/ /home/userOnAccessIncludePathon-access-include/home /studentsOnAccessExcludePath/home/bofh /rootOnAccessExcludeRootUIDOnAccessExcludeUIDOnAccessMaxFileSizeOnAccessDisableDDDdisable-dddOnAccessPreventionOnAccessExtraScanningDevACOnlydev-ac-onlyDevACDepthdev-ac-depthDevPerformancedev-performanceDevLiblogdev-liblogUpdateLogFile/var/log/freshclam.logDatabaseOwnerCheckschecksDNSDatabaseInfocurrent.cvd.clamav.netDatabaseMirrorPrivateMirrorMaxAttemptsScriptedUpdatesTestDatabasesCompressLocalDatabaseExtraDatabasedbname1 dbname2DatabaseCustomURLHTTPProxyServeryour-proxyHTTPProxyPortHTTP proxy's port8080HTTPProxyUsernameusernameHTTPProxyPasswordHTTPUserAgentNotifyClamddaemon-notifyOnUpdateExecuteon-update-executecommandOnErrorExecuteon-error-executeOnOutdatedExecuteon-outdated-executeLocalIPAddresslocal-addressaaa.bbb.ccc.dddConnectTimeoutReceiveTimeoutSafeBrowsingDisableCertChecknocertsMailMaxRecursionArchiveMaxScanSizeArchiveMaxRecursionArchiveMaxFilesArchiveMaxCompressionRatioArchiveBlockMaxArchiveLimitMemoryUsageMailFollowURLsmail-follow-urlsClamukoScanOnAccessClamukoScannerCountClamukoScanOnOpenClamukoScanOnCloseClamukoScanOnExecClamukoIncludePathClamukoExcludePathClamukoExcludeUIDClamukoMaxFileSizeAllowSupplementaryGroupsClamdSockettcp:scanner.mydomain:7357MilterSocketMilterSocketGroupMilterSocketModeLocalNetOnCleanAcceptOnInfectedQuarantineOnFail^(Accept|Reject|Defer)$DeferRejectMsgMTA specificAddHeader^(No|Replace|Yes|Add)$ReplaceReportHostnamemy.mail.server.nameVirusActionChroot/newrootWhitelist/etc/whitelisted_addressesSkipAuthenticatedLogInfectedBasicSupportMultipleRecipients0.100.2/dev/nullCan't open /dev/null dup2(%d, %d) failed %s/ERROR: --file-list: Can't open file %s POSIXLY_CORRECT%s: illegal option -- %c %s: unrecognized option `%s' %s: option `%s' is ambiguous %s: option requires an argument -- %c %s: option `--%s' doesn't allow an argument %s: option `--%s' requires an argument %s/%s%s/%s.%03u~%s: copied to '%s' !Can't copy file '%s' !Can't unlink '%s': %s ~%s: moved to '%s' !Can't move file %s !Can't remove file '%s'. ~%s: Removed. !'%s' doesn't exist or is not a directory !Can't send to clamd: %s UNKNOWN COMMAND !Communication error !Overlong reply from clamd !Command rejected by clamd (wrong clamd version?) ClamAV %s Infected files: %d Total errors: %d Not removed: %d Not moved: %d Clam AntiVirus: Daemon Client %s By The ClamAV Team: https://www.clamav.net/about.html#credits (C) 2007-2018 Cisco Systems, Inc. clamdscan [options] [file/directory/-] --help -h Show this help --version -V Print version number and exit --verbose -v Be verbose --quiet Be quiet, only output error messages --stdout Write to stdout instead of stderr (this help is always written to stdout) --log=FILE -l FILE Save scan report in FILE --file-list=FILE -f FILE Scan files from FILE --remove Remove infected files. Be careful! --move=DIRECTORY Move infected files into DIRECTORY --copy=DIRECTORY Copy infected files into DIRECTORY --config-file=FILE Read configuration from FILE. --allmatch -z Continue scanning within file after finding a match. --multiscan -m Force MULTISCAN mode --infected -i Only print infected files --no-summary Disable summary at end of scanning --reload Request clamd to reload virus database --fdpass Pass filedescriptor to clamd (useful if clamd is running as a different user) --stream Force streaming files to clamd (for debugging and unit testing) !Can't parse command line options !Can't parse clamd configuration file %s -------------------------------------- !Problem with internal logger. ----------- SCAN SUMMARY ----------- Time: %d.%3.3d sec (%d m %d s) STDIN~%s: Access denied. ERROR zINSTREAM!Failed to read from %s. zFILDES!FD send failed: %s !Bogus session id from clamd !Failed to parse reply FOUND~%s%s ERROR~%s: Excluded !Can't access file %s ^%s: Not supported file type unidentifiedz%s %s~%s UNKNOWN COMMANDFailed to parse reply: "%s" ~%s%s FOUND ~%s FOUND STDIN: noreply from clamd .~%s: no reply from clamd %lld!Could not lookup %s: %s !Can't create the socket: %s ~%s: OK ~%s: No files scanned zIDSESSIONzENDCONTSCANMULTISCANALLMATCHSCAN!Memory allocation failed in ftw ^Directory recursion limit reached !select() failed during session: %s !Failed to allocate scanid entry: %s Filename cannot be NULL for MULTISCAN or CONTSCAN. !Cannot allocate a command buffer: %s clamd replied "UNKNOWN COMMAND". Command was %s ~%s: stat() failed with %s, clamd may not be responding !Could not connect to clamd on LocalSocket %s: %s !Could not connect to clamd on %s: %s !Clamd closed the connection before scanning all files. %%lhhPhԏF^Can't make room for fullpath. ^Can't get absolute pathname of current working directory. !Can't lookup clamd hostname: %s isremote: socket() returning: %s. !Error occurred while receiving version information. !Clamd did not reload the database client.c: fstat failed for file name "%s", with %s .^Only scanning files from --file-list (files passed at cmdline are ignored) !Scanning from standard input requires "-" to be the only file argument zVERSIONzRELOADRELOADINGcli_hex2ui(): Malformed hexstring: %s (length: %u) cli_hex2str(): Malformed hexstring: %s (length: %u) cli_hex2num(): Malformed hexstring: %s (length: %d) cli_xtoi(): cli_malloc fails. cli_strtok: Unable to allocate memory for buffer cli_unescape: Unable to allocate memory for string utf16 length is not multiple of two: %lu UTF16 surrogate encountered at wrong pos cli_utf16toascii: length < 2 cli_strrcpy: NULL argument 0123456789````````````````````````````````````````````````````Ы```````````0 `  %y%m%d%H%M%S%Y%m%d%H%M%S.crtcli_malloc(): Attempt to allocate %lu bytes. Please report to https://bugzilla.clamav.net cli_malloc(): Can't allocate memory (%lu bytes). cli_calloc(): Attempt to allocate %lu bytes. Please report to https://bugzilla.clamav.net cli_calloc(): Can't allocate memory (%lu bytes). cli_realloc(): Attempt to allocate %lu bytes. Please report to https://bugzilla.clamav.net cli_realloc(): Can't re-allocate memory to %lu bytes. cli_realloc2(): Attempt to allocate %lu bytes. Please report to https://bugzilla.clamav.net cli_realloc2(): Can't re-allocate memory to %lu bytes. cli_strdup(): s == NULL. Please report to https://bugzilla.clamav.net cli_strdup(): Can't allocate memory (%u bytes). Unable to readdir() directory %s: %s cli_gentemp('%s'): out of memory cli_gentempfd: Can't create temporary file %s: %s malloc_problemcalloc_problemrealloc_problemstrdup_problembuffer too small for ctime invalid timestampTMPDIRcli_readn: read error: %s cli_writen: write error: %s %02x%s/clamav-%s.tmp(?i)>h 5P H`HP[:<:]][:>:]]NULSOHSTXETXEOTENQACKBELalertBSbackspaceHTnewlineVTvertical-tabFFform-feedCRcarriage-returnSOSIDLEDC1DC2DC3DC4NAKSYNETBEMSUBESCIS4FSIS3GSIS2RSIS1USexclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stopzerotwothreefourfivesixseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketbackslashreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-brackettildeDELalnumalphablank cntrlgraphlowerabcdefghijklmnopqrstuvwxyzprintpunct upperABCDEFGHIJKLMNOPQRSTUVWXYZxdigit0123456789ABCDEFabcdefABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ !"#$%&'()*+,-./:;<=>?@[\]^_`{|}~;d`p "P$)(@)H- 66 7X8`::8;h@KPX Pp R R @T U` Ux U Y p` ` ` a bP c c e eH e` g `i(jx lPnn8nPr@wzX`z||@~P(0 8 `PHh0h@0`0pP``x0@  ` Xp8pp@0 Ю0(X  !8!h! !@!`!P"`0"pH"`""""#`0#оX#0###0$H$p$$P %`%%@%8&@p&&P'('P'' ((0(((P()P)))P)**+h++ 8,, -`!-P%. ).0-.1 /4/80L(1MP1@Mh1N1O2P(2pPp2zRx h*zRx $ FJ w?;*3$"LDpBBB B(A0A8Jb 8A0A(B BBBH "7Hb F L"BBB B(A0A8G 8A0A(B BBBE Lp& BBB B(A0A8G  8D0A(B BBBG 4T0/bBDH A ABF AFB4h/eFAJ } CAF DDA</BBD A(J0h (A ABBG d01BBE B(D0A8RP 8A0A(B BBBH L 8C0A(B BBBA 4lX2eFAJ } CAF DDA,2KAD AB\@3BBE B(D0A8J,,D,X,C, 8D0A(B BBBA 4pBBBE B(D0A8IGUBW 8C0A(B BBBA n 8C0A(B BBBA U 8A0A(B BBBA pG<hGHAA h ABK  HBK HL4HBBH A(H@/ (F ABBA B (C ABBA D JBAF MX  CABD X  EABH J <J~BAH GM  CABK G CABd$J4BBE B(D0A8N@ 8A0A(B BBBI D 8F0A(B BBBE |NBBE B(H0A8J^ 8A0A(B BBBJ J 8D0A(B BBBI v 8G0D(B BBBE  T$T L<TBBA A(G@ (A ABBA b (A ABBA ,UAAG0d AAA ,(V AAG0Q AAD W:AP O YD (W#BAH Jo  CABF t  CABF \TXJBD A(L0S (F ABBE D (C ABBA IPXLXXBBE B(D0A8L@ 8D0A(B BBBJ ZD\4BBD A(WWJA\IdB+ (F ABBA L0[oBBB B(D0A8G@ 8A0A(B BBBK 4P\HBAD D  AABC L h].BBE B(A0A8I) 8A0A(B BBBD 4l H_AAN @ AAF cFA _L _BBE B(D0A8M 8C0A(B BBBA L Xb8BBE B(C0A8M* 8C0A(B BBBF d\ HgBBI B(A0A8D 8F0A(B BBBH  8A0A(B BBBI L iSEEE D(C0` (A BBBK A(C BBBL iBBE A(D0 (A BBBD D (A BBBE Dd kBAD YP  CABK U  CABE | kBBE B(D0A8O 8F0A(B BBBJ R 8A0A(B BBBD ] 8F0A(B BBBD L, l`BBE B(D0A8RPk 8A0A(B BBBI || mBBI B(A0A8Dt 8A0A(B BBBE  8C0A(B BBBH ` 8F0A(B BBBA < (pBBG A(G(U (D ABBG T< pBAF G(U  CABE v  CABD u  CABE l qBBB B(D0A8J 8A0A(B BBBA TGVDKYAt4XuBAD x DBK V DBD Tuv4lvBAD  ABG T CBG $pvjAJ A C A YLvBBA A(G0] (A ABBH D (D ABBE ,wAAR0 AAA 4LwAAD Z AAF ^CA,w>BAD qCBxiFZPx=MBE B(D0A8G@ 8D0A(B BBBA F 8A0A(B BBBA LC@t\y)OBE B(D0A8GP 8D0A(B BBBA D 8C0A(B BBBA IdyBBB B(A0A8D` 8D0A(B BBBE y 8A0A(B BBBH <hz@Di A <\ztBBA A(D0\ (D ABBA LzBBB B(D0A8D`x 8A0A(B BBBE L}BBB B(D0A8D` 8A0A(B BBBA <T<Ar E Cdt JBBE B(A0A8DPe 8A0A(B BBBH z 8C0A(B BBBA lKBE B(D0A8JPk 8A0A(B BBBH CPLhFddBBB B(A0E8GP 8A0A(B BBBG ` 8H0A(B BBBE )DddBBE B(A0A8Gp  8A0A(B BBBH O 8A0A(B BBBG L|BBE B(D0A8J 8A0A(B BBBA LBBD A(J0U (D ABBG L(C ABB$$AAJ IGAD\LtBBE B(D0A8MP 8C0A(B BBBE L BBE B(D0A8JP 8D0A(B BBBC LP BBE B(D0A8L`- 8C0A(B BBBK <dWBBE A(D0t (A BBBG L0BBE B(D0A8Q@O 8A0A(B BBBF <WBBE A(D0t (A BBBG L4BBE B(D0A8Q@O 8A0A(B BBBF TwBBE B(D0A8M@NHZPPHA@F 8A0A(B BBBJ TBBE B(D0A8JP{XT`UXAPF 8A0A(B BBBA d4p1BBE B(D0A8J` 8D0A(B BBBD D8C0A(B BBBLHBBE B(D0A8Q@Q 8A0A(B BBBD DdBBE A(D0M@x 0A(A BBBE ,48BAD J0S LAB,dЏYAAK r AAG ,DAAD m AAK 4 |AAG P AAE L CAH LhKAA DpJ  CABG O  DABB P4L8{FAK D DAE LCA|SBBE B(D0A8G@ 8A0A(B BBBA L 8F0A(B BBBI  8A0A(B BBBD L`BBB B(A0A8D`[ 8A0A(B BBBA 4T0aAAD  DAF IFAh.NN,?AAD j CAD dBBE B(D0A8MPh 8A0A(B BBBA O 8D0I(B BBBL 0( $$AJA AA $ $AJA  AK ,( AAJA AAF $LAJAA$tVEV E T A `$(oEo D U A `$pSEV E Q A `4|FAA _ ABF T ABI $$RDP A g D QLL(AAD ] AAK R HAE _ DAD KDAh#KW$.AAJ \DA\BBD A(OW (F ABBF G (F ABBF G(D ABBL<؜BBD A(OU (F ABBH G(D ABB<(BAC z DBE H FBA \ BBE B(A0A8GVGaBP 8A0A(B BBBB , H.\D `vBBE B(D0A8OBXAW 8A0A(B BBBB 4 yBAA F0k  AABW d Ȥ~BBB B(D0A8D 8D0A(B BBBA Z 8A0A(B BBBA 4D!AAJ v AAD sFA|!8($!PIAAL@vCAd!x BBE B(E0A8J 8A0A(B BBBK  8A0A(B BBBH d$"1 BBE B(E0A8J 8A0A(B BBBE U 8A0A(B BBBA d"BBB B(D0A8D@] 8A0A(B BBBH  8A0A(B BBBA 4"PJAAI a AAB WAA,#hXD#4\#BEA W CBA kAB$# IL[N,#fQAR Z AAH 4#WBBA A(D0C(D ABB,$$ bAAJ0d AAF ,T$`MAD |AB|$BBI B(D0A8QPt 8A0A(B BBBE h 8A0A(B BBBF b 8D0A(B BBBI |%p BBB B(D0A8DPy 8A0A(B BBBD  8I0A(B BBBM  8O0A(B BBBL L%BBA A(I@I (A ABBB J (A ABBH d%P" BBF B(D0A8I 8A0A(B BBBF  8A0A(B BBBA d<&BBE B(A0A8D 8A0A(B BBBE  8A0A(B BBBG L&BDB B(D0A8S[ 8C0A(B BBBA &QBBE B(D0A8Op7 8A0A(B BBBH xbSxApxQOxBpMx^WxBpUxdSxApjxQTxAp'QBBE B(D0A8Op7 8A0A(B BBBH xbSxApxQOxBpMx^WxBpUxdSxApjxQTxApD$(BHB B(A0A8 0A(B BBBJ l(HBBE B(D0A8D\JYGQAHQD 8A0A(B BBBA L(BBE B(A0A8D`' 8D0A(B BBBK DD)PBBE B(A0A8 0A(B BBBE )BBE B(D0A8GMXKF{IRBFD^AQTA 8A0A(B BBBA L$*0BBB B(D0A8Dp0 8D0A(B BBBB t*BBH B(A0A8GO 8D0A(B BBBE fdFAHSEJQASHNDHZBEHUBAzAIRADYAVQKA HYADHZA$+PuQS D H+:d+tBBE B(D0A8JPr 8D0A(B BBBG  8A0A(B BBBH <<,BBD A(G@ (A ABBG |,ZD,eBBE B(H0H8M@r8A0A(B BBB,iA iAP,iAH5iA@iAXHiAQiA0YiAbiA8iA kiA(viAiA@iAiAiAiAiAiAiAiAAhABBAc&ABBA6ABBAcJABBKAVABBbAA+BBhAA)BBAvA:BBqAArAB{AA:BBAABBAABBAABBAA:BBAdABBAABBAABBABBAABBAmABBAABBAABBAzABBAA sABAdABBArABB AAPsAB(AAB\AcAtABfAruABlATAABBRAB?B@B[B\B\B],B^7B^IB_TB_]B`jB{uB{B|B}B}B~BBXBBBBBBBBBBB7B|BBBBBBBBBXBBBBBABBBBB6B=BBBGCC: (GNU) 5.3.0GCC: (GNU) 5.5.0.shstrtab.interp.note.ABI-tag.hash.dynsym.dynstr.gnu.version.gnu.version_r.rela.dyn.rela.plt.init.plt.got.text.fini.rodata.eh_frame_hdr.eh_frame.ctors.dtors.jcr.data.rel.ro.dynamic.got.plt.data.bss.comment 8@8T@T !x@x' @/@7ox@x>Do@`S@]B@h g-@-$b@-@@- m@6@@6vP6@P6G2|hAhhAh BdHBH$-SbSSbSSbSSbSY ȭbȭqb0bb @b8 08"Zusr/bin/sigtool0100755000000000000000000050657013365330320012557 0ustar rootrootELF>@@8@8 @@@@@@88@8@@@<<   b bd(i 0}0}b0}bTT@T@ PtdAADDQtdRtd  b bh_h_/lib64/ld-linux-x86-64.so.2GNU lx[Mt`^=?&J~{X7Qc_zI\1}v@$#hNm<dW)qK F;aV:"unO0yerg (-3%,/G>.!96ERBP bTfZ2kA]8owSC |H'sU*pY5 + D4Lji #41)r[tg> M ULo)|v$( A2ciUEb6(J BnzD* /6Q r +z9aT!gkb/3aW5~*b7NvbZof@8Yw*bRTap Gb&b= 0@EJ?libclamav.so.7cli_ac_chklsigcli_vba_readdircli_checkfp_pe__gmon_start___Jv_RegisterClasseshtml_normalise_mapcl_loadgzclosetext_normalize_mapcli_utf16toasciicl_initcli_strbcasestrEVP_MD_CTX_createcli_gentempcli_cvdunpackcl_engine_newcli_fmap_scandesccli_hex2strcli_initrootscli_ppt_vba_readcl_sha1cli_strtok_ITM_deregisterTMCloneTablecli_versig2cli_wm_readdircl_engine_compile_ITM_registerTMCloneTablecli_calloctext_normalize_resetcli_ctimegzdopencl_retdbdircli_ldbtokenizecli_chomptext_normalize_initcl_hash_destroycli_hashfilecli_hashstreamcl_hash_initfmapcli_strtokenizeEVP_MD_CTX_destroycl_cvdheadcli_parse_addcl_strerrorcli_regexeccli_hex2uicl_retflevelcli_isnumbercl_engine_freeuniq_getcl_cvdfreecl_debugcli_ole2_extractcli_regfreecli_vba_inflatecli_str2hexcli_filecopycl_cleanup_cryptocl_cvdverifycli_gettmpdirgzgetscl_finish_hashEVP_DigestInit_exEVP_DigestFinal_excli_rmdirscli_wm_decrypt_macrocl_engine_set_numcli_regcompEVP_DigestUpdatecli_genhash_pecl_update_hashlibxml2.so.2_finigzwriteliblzma.so.5libbz2.so.1libltdl.so.7libdl.so.2libssl.so.1EVP_sha256libcrypto.so.1libjson-c.so.2libpcre.so.1libm.so.6libclammspack.so.0libz.so.1gzopen64libresolv.so.2libpthread.so.0sendrecv__errno_locationlseek64fcntlconnectlibc.so.6socket__xpg_basenamefflushexitsprintfsetlocalestrncmpoptindstrrchr__strdupperrorclosedirftellstrncpyforkunlinkselectmkdirreallocstdinstrftimerewindlocaltime_rstrtolsyslogfgetsstrlenmemsetstrstrtcsetattrfseekchdirdup2__fxstat64vsnprintfstdoutfputcinet_addrfputsfclosestrtoulmallocumaskstrcasecmp__lxstat64opendir__xstat64__ctype_b_locgetenvsscanfoptargstderroptoptfilenogetcwdfwritefreadrenamelocaltimestrchrfprintffdopenreaddir64qsorttcgetattrsleepsetsidfopen64accessopterrstrcmp__libc_start_mainstpcpycloselog_edata__bss_start_endZLIB_1.2.3.3GLIBC_2.2.5GLIBC_2.3CLAMAV_PUBLICCLAMAV_PRIVATE 3 ui %0ii ui Ӈ_ Ebbb6bCbKbbb b(b0b8b@bHbPbXb `b hb pb xb bbbbbbbbbȀbЀb؀bbbbbb b!b#b$ b%(b&0b'8b(@b)Hb*Pb+Xb,`b-hb.pb0xb1b2b3b4b5b7b8b9b:b;ȁb<Ёb=؁b>b?b@bAbBbDbEbFbG bH(bI0bJ8bL@bMHbNPbOXbP`bQhbRpbSxbTbUbVbWbXbYbZb[b\b]Ȃb^Ђb`؂babbbcbdbebfbgbhbi bj(bk0bl8bm@bnHboPbpXbr`bshbtpbuxbvbwbxbybzb{b|b}b~bȃbЃb؃bbbbbbbbb b(b0b8b@bHbPbXb`bhbpbxbbbbbbbbbbȄbЄb؄bbbbbHHN"Ht .p H5O"%O"@%O"h% O"h%O"h%N"h%N"h%N"h%N"h%N"hp%N"h`%N"h P%N"h @%N"h 0%N"h %N"h %N"h%N"h%N"h%N"h%N"h%zN"h%rN"h%jN"h%bN"h%ZN"hp%RN"h`%JN"hP%BN"h@%:N"h0%2N"h %*N"h%"N"h%N"h%N"h % N"h!%N"h"%M"h#%M"h$%M"h%%M"h&%M"h'p%M"h(`%M"h)P%M"h*@%M"h+0%M"h, %M"h-%M"h.%M"h/%M"h0%M"h1%M"h2%zM"h3%rM"h4%jM"h5%bM"h6%ZM"h7p%RM"h8`%JM"h9P%BM"h:@%:M"h;0%2M"h< %*M"h=%"M"h>%M"h?%M"h@% M"hA%M"hB%L"hC%L"hD%L"hE%L"hF%L"hGp%L"hH`%L"hIP%L"hJ@%L"hK0%L"hL %L"hM%L"hN%L"hO%L"hP%L"hQ%L"hR%zL"hS%rL"hT%jL"hU%bL"hV%ZL"hWp%RL"hX`%JL"hYP%BL"hZ@%:L"h[0%2L"h\ %*L"h]%"L"h^%L"h_%L"h`% L"ha%L"hb%K"hc%K"hd%K"he%K"hf%K"hgp%K"hh`%K"hiP%K"hj@%K"hk0%K"hl %K"hm%K"hn%K"ho%K"hp%K"hq%K"hr%zK"hs%rK"ht%jK"hu%bK"hv%ZK"hwp%RK"hx`%JK"hyP%BK"hz@%:K"h{0%2K"h| %*K"h}%"K"h~%K"h%K"h% K"h%K"h%J"h%J"h%J"h%J"h%J"hp%J"h`%J"hP%J"h@%J"h0%J"h %J"h%J"h%J"h%J"h%J"h%J"h%zJ"h%rJ"h%jJ"h%bJ"h%ZJ"hp%RJ"h`%JJ"hP%BJ"h@%:J"h0%2J"h %D"fAWAV1AUAT1USIHuH=.1LkkE1E1ILHÉ~1A< u E9ELE1HA9uH=L1j AEH[]A\A]A^A_ATIUHS11LHHHHH9vH=1hjD*u~HHDH=Z1FH=`1 FH|$@H\$@;*u{uH=˖E-H-HthHL$-HtH= i1EH|$|tH|$ntHT$Ht$H=ƕ1bE'H=h1OExH=uH19EHt$HH=1&EH=1EH|$PH\$P;*u{uH=֕D-H8Ht^HL$-HH|$H|$HT$Ht$H=۔1wD'H=.h1dDH=H1NDH=ϔ1@DH|$X&H\$X;*u{uH=D-H`Ht^HL$-H/H|$H|$ HT$Ht$H=1C'H=g1CH=H1vCH=1hCH|$`NH|$`u/?*uuH=>CDH=Ug1+CT1 H5kHfH=5HD1BH=1BH|$hH\$h;*u{uH=B-H Ht^HL$-HH|$kH|$YHT$Ht$H=1IB'H=f16B_H=\H1 BH\$8H5ڒHltH5ӒH1WH\$p;*u{uH=11A1HHu}tH= fAH=t1A1CH|$0Ht$ XHT$0HH9T$Hv HHt$HH="1"AHt$0H=#1AHt$8H=)1@Ht$@H=-1@H=31@H|$@}Ht$PH=+1@Ht$XH=01@uHt$`H=01@HT$hHt$`H=1m@Cv&H=b1R@H=1?@hHt$0H=1'@uHt$PH=1@uHT$XHt$PH=1?H|$8uH=d?H=͑1?H|$81 HHcHH=1?H=1s?H=1`?H=|1M?H=o1:?H=b1'?H=Y1?vH=N1?fH=U1>VH=R1>FH=I1>6H=>1>&H=51>H=Sc1>Ht$@H=h1>AuH=1u>H|$HHt$@>*u ~HDH|$HD1l=HHtIH=HhH1>AuH=11=H"D1H1H=b1=HX[]A\A]A^A_USHH-N"HH}HUH1HtH<$u1HuH[]AUATUSHH@uH=Eb1>=H50H7YHxH5HHu)H50HYHpH=b1<HC@1IH81sAu.H50HXHpH=a1<HDKHL-HtL<$u1DLuɉDHH=jXEtH$E1HD$0KIHIHpPH-1H=n1A)D$TL$LE1LqW1DD6H=UL1&l$H5H-x tHH5H,x oH5HHDŽ$,x /H5HA,L`11L6A1#HI"H誤DkHItlH$HLoLu2lH$Ht DLlLLhNlL裠LKD軛L3H=UL1LD芛H=teL1DH5THE1+L`H5=Hr+x xH59HY+x HC@HH8躞HHDxuH5H+Hx荞HdD`HHAE911tHIHAyH5H*HxL褚A1!HIH訢AHC@LH8]A]HC@H$Lt$ H8HbEH L1|LLLdLA裞L蛞LCL;AH5H)Hp1LAHl$@H\bL 1HHL菡tvLDКH=N1b \H51H^)x HC@HH!H5H(HL"+)HxHL軧H=MH1D DHC@H=TDH01 LtLlLL H=SL1D LL3LۚuH=Tg aH5wHc(x DHr!H5WHH<(LxMژHI H輛1LbH=SIEXH ZjjjH"_QH5ZE1H8E11CH H=SfLȞALL$#L3.D,LL$DŽ$7b@AEHpmHH$IH$0HH$811L苚Aq115HT$@D胘HT$pL$81D,HIH$811HT$pHHP`HL|$ Ht$p1HL趛1ҹLLnR4H=tS1% H$xH$8kDL;H=OQ1 H5HD%HpH=P1 LgLAwH=OP1 H5qH߃%HpH=O1l fHC@H=OH01O IH=O; 5H=?PL1D" LzH=O1 H=hR1H=Q1uH=Q1H=Q1H=6QH$H$8D\L贗nH=PL1^H$豖L膗@H=zP13H=O1 H=^1 H5H$x tsH5H߽#L`H5ZLyH11LTANWDtL@|H5cH~#x HC@HH0H$肙$H5H%=@HC@H(ta#HxH1H=]L1DH5[L1HH=gP"HxH1zHC@H=PH01}H=_PoiwZf.1I^HHPTIAHpAH@'fDH=!H!UH)HHvH!Ht ]fD]@f.H=!H5!UH)HHHH?HHtHI!Ht ]f]@f.=!ubUH!H!HATSH!L%!H)HHH9s@HH]!AHR!H9r[A\]5!H=!H?u .fDH!HtUH]AWAVAUATUSHH|$(H$H$L$L$t@)$ )$0)$@)$P)$`)$p)$)$H$HHD$`H$D$XD$\0HD$hҒIIILl$h1A HL9sO|%uHDH[DfAWAVAUATUSHH$8H$@H$HL$PL$Xt@)$`)$p)$)$)$)$)$)$H!f8tH[]A\A]A^A_@H !HD$D$0L0H$ HD$ H$0HD$(贍IIIoHD$(1AHD$ HL9sO|%uHDHPH@E1DADfDHcЍHAHcA44@:t-Wu@;t"9uHxLH[D]A\A]A^A_HHcA<4:E͉|$8iH!A?E_H5fDIMHUH!H81/}IEHD$XD$8D$` xH{!EA?2HHUH5fH!H81|DE_E9DSH.!E1|$ : AGd:HHUH5fT$`H5e!HcHT$XH=Ht$ HT5H5A!H$D`DCHt$D$`1+D$8Ll$(Dt$@D|$qI|$4qI\$8L'qHtIDH[0[]A\ff.AWAVIAUATEUSEHL$@t$4HT$8L$0HD$hHD$pMtLT$hHD$pL=9!A1D\$ Ƅ$:HD$ HD$h1I7AHD$(3E4Du EtAtMMI7HHۉH,HUHuH}uMD\$LLc\$ cH5LtHHD$HD$xD$HD$ Dd$(HD$XH$HD$ HD$dHD$PH$@HD$@MH$@HT$HnHHl$xHH!%tDHVHD@HH1H)fHH t X9|HcHHD$ Hl$x9oHGE<#;H5H t- Hu  HuD\$0EtH!T$ H5O_H81sHD$HtH3rH|$h1 fHUHtkAIcHHH @E0}t H}(HHDŽHHAHDŽPUXE|$ ~HcL$ }QD$ HcƄ:E0H}(HD$ Ƅ:/fDHHDŽHVLT$D\$HMWE0PHt$0H|$8LM LE(VZYD\$LT$Hc!H=\?1HqH|$hI7D$ @I7T$ @HHZHl1ҍpH"IH t 9|HcL$Ll~HHcAt HA~@v(@ t"zfALHxq@v uHuzHAA<$"3LD$hHLLD$HLD$UHcP,EH IHʋS4tIAtDT$(u>Mct$0HH!H5]L$ H81pDD$(H5MYT$0HH!H5W^L$ H819pMH$LD$PHL$@Ht$8|$4HD$d=:;HlHDD$LEt8;$XHD$@L$LHP81fDH ;Z9uHյ!H5\H81youMMLD$hHLHLMIHp!H5\HH81oMuMu {HsHtUC0H|$ ED$H‰D$H=f8H|$ E111L1iH|$ D$jD$0C7lMPHt$X1LHD$nLD$A8"{HT$xHMtKH=?AH HHLD$hE1M^I\$"HiHA|$|IHcD$dHH@HH!L rHƳ!H=oX)1HmH|$hyHH[]A\A]A^A_ÃLD$hH5LLD$rfLD$tA<$1A|$E11HHH@CML 1hiE1HcLD$hgD$LD9AL=&HcD$LBƄHD$HHDŽ@HDŽPDŽXDŽHVH!H=nW*1HkH|$hHL%LD$h1D$0CH1!HSH5&ZH81kH|$uH\$hdH|$tH|$kjMuH\$hH?L%!A$9D$4*|$4)ǃHcjHHC@A,$9l$4H|$8HcL,׉fI9l$4)HcI}HeHH\$hA$HC@)HcH<uH>!H=g\H}jeHA"MHH!H5o[H81jLD$h|$0 MHǰ!T$ H5LWHH81gjL$0&C{H!HSH5}WH81+jH5LLD$bc1ɅLD$E1H?!HSH5dXH81iA<$uCH!HSH5AYH81ifLc(1kqmuH=HHgMIH!H5gYHH81Ji\$0Hz!H5TLH81iHZ!H=kU3HhoH5!H=HthJH!HSH5=VH81h~H!IRH5|VH81hHή!IH5$WIRHH81khMIlH!H5Hh1[]A\A]A^A_HN!H=U.HcHl$(IqHAA0H\$@L $H߃҃&[L $t)H!IQH5DRLH81cHl$($Ht$1E11HL $]H߉c_LH5FRL $AAK 'H\$H5L $H_\L $t;1Y{OHD$HT$H|$(HLL $L $KHD$(Hh[]A\A]A^A_L $D`HHD$L $HHt$81Hb;"L $ HT$8M@,HHD$HDN@u+H|$H2IY(H\$$f.HH|$H|$ 1L $s^HD$HL $KH=?HH WH|$H5_L $ZHD$L $IQH5KO"H!H5RLL $H81AaHD$L $DkkmuH=HLH5Q1HD$f.fH,AWAVAUATUSH _HH=1j1E11AHHZY^H5HH,Iċ@ u*H*[HHHH[]A\A]A^A_DMl$HL8^tL\[HIQ[I|YHIDH5_HL1[L:_L%_L[HIt}H5HL1I[L^L^L[HItLgZAGA9EvIl$LZLZL8ZHH[]A\A]A^A_Yf.IT$H5lL1ZDLYIl$두H5AHL1lZ3H!H=.HG^1DAVAUATUHSHHYHx XHHIE1H5LH1YH]E1H5LH1YHk]HEt}H|${UHH=lHHD1UHH[]A\A]A^XHIH=H1yUH[]A\A]A^@H=H1RUHYH H0HDhHL$X fDHhYHPA9s H0AHL$HtXLX1HLHHHx qVHHt MiLW*HG[1҃\w);[H!H5]H81\HË!ATUSHt/HS@Hb|!HH‰ o![]A\f.HH5pIċ@ tH8!HH= !FVHH=!!IH2H!ကtDHBHDЉHH)HHt;AT t u+H !LH9tPH t t[Hn!]A\f.I|$H5׽ZHHHJ!Hm!IT$H5H81[Ht E61H= !Y1fDXf.AUATH=UUS11HVH=?ÉD$1VH=&ʼnD$1VD$ E1AHl$DDRt#IIFlDDQuHf!H5DDLd$H81ZtvRHL9t]]uH!!H=lHl$Ld$HVYt*RHL9t]uHL9uH[]A\A]ÃLd$HL9t]~HQL9uXtubQH1[]A\A]1>R@f.ATUSIHH0HrPtH0[]A\HH T|/H\$ tQLHWƄ$ 1E11HH1%SHTH0ډ[]A\H>LH1wPƄ$ f.1?/ATUH5ɺSHWHtTH1If.1<$#HL5RHuHVH[]A\f.H1[]A\fSHH?Ht.RH fDHxRH{HGHCRHCHuHCHCHt[@Hx_RH{HGHCNRHCHuHC Ht4@Hx/RHC Hx"RH{ HGHC RHC Hu[fDAWAVAUATUSH8H>L$ HLfIIH^Ln MMHtUI?H5j*VHHwfDH{HStGH JQt5H[HuH$UL1H8[]A\A]A^A_fHTI7H=1H5#UHHD$H=:NHHD$(H|$(H5[UHHD$L1HT$t$ LOHMtA;,$tpMt A;mHt$LRuH|$D$ 1TH|$'TH\$(HZOH=#H1HAPL$ It$HHt$ NPHt$ HLNMd$4@IuHHt$ PHt$ HLWNI}Ht$QQ|Ht$ yOthMmH|$NSH|$DSMMI?jNI7H|$(UxH|$(AO~H|$RH|$RH\$(HNH=H1zHOH|$RH|$RH\$(HMHNIH=%1,XH|$hRH|$^RH\$(HMHNIH=1H=]1H\$(HQMHINH=1I7H=1I7H=mH=WH|$QyH\$(IH=D$ 1H&HLHML$ CI7H=D$ 1H\$(H\$(H=1HH|$!QHYMDf.ATUSt51E1 fDA9t+ XHHA u[1]A\H1uLtfJHu9t)‰Ս}TKHItHHH~PA,L[]A\ÐH[]A\TL1ÐAWAVAAUATIUSHH4$HT$11*HL-J!HH=1MfII>HH%OuH[IDHXHtopLHteHKDHT$H4$LӅuHKH[]A\A]A^A_H=H1HKϐHH=~H=HHxKH=/1돐AUATUSHH6HHIH1UKI3A.t&KHHQtDH=LHu0L9rLItgL1JH[]A\A]H=1LJH[]A\A]H=1H[]A\A]H=qL1ϿLWJH=1貿AWAVAUATUSHHH6HdHվ1HAHI1 HKLHD$8D$I1ҾHHI1 H[KLIAID9l$81ҾHSHHD$1ҾH6HHD$1ҾHHHD$(H|$(H5IMHI1ҾHHHD$8H|$H5MHIH=(FHHD$0eH|$0H5IMHHD$ Z1fLDHGH9\$H\$HHHHHFp\$0D9DLDHGH-ۍCLHIuH|$D$HH|$ HH|$(HLKLKH|$ KH\$0HFHGH\$H=vH1,HGL$HH[]A\A]A^A_Ht$ HIMt.LD$/KH|$eGH|$[GH|$QGL$H|$(L$?GLJH|$ JH\$0H FNLJH|$GH|$FLl$LGHHL\EH|$FE1H=1$LbJH|$ XJM!H|$(E{Ht$(H|$0LH|$(ZFH|$0PF1DFH|$(:FLIH|$ IL|$0LELFH=|1sIH|$EH|$EH|$(ELIH|$ELIH|$ wIH\$0HDHEt$8H=1H=?1L&IH|$\EH|$REH\$0HEDH=EL|$H\$(H=1LH菺HELEUH=1g=H=F1O%H=9H=#H|$DH|$DH=H|$DH=vٹH|$_DH|$UDH|$(KDLHH|$9DLGwH\$H=1H聹H|$DH|$CH|$(CLGHC)H=z=H|$CH|$CH|$(CLgGH\$(H= 1HH|$}CH|$sCHkCH\$0H=1H軸H|$ACH|$7CH|$(-CLFH|$CLFH CQH\$(H=D$1HWHBH\$0HAHBL$L|$(H\$0H=D$1LHLBDAUAT1USIHH4H1Hú HCHINB1ҾHHHtnHHHtL EHtjI|$ HXHhD(tIT$(HBID$(1H[]A\A]ID$ HAH=R1+H= 1H=XHAHAff.AVAU1ATUISIH1Iź HBLHʼn.ALHI| DHIt$Lh(HtD9s8Ht 9rH9HVrHt 1HPHF1[]A\A]A^Hp[ID$1]A\A]A^H=1H=p1H=εLV@Df.USHHHtL HCHtJHSHhHtHBHC1H[]fDHCHCH1[]H=`19H={&H?AVAUIATUSFHI6IHH1?I:A.t&?HHQt,H=-AHuL9r[M&1]A\A]A^H=i1rL>[]A\A]A^H= H1KL>H=1.AWAV1AUATUSAH(!L|$`D$< LH9=rDl$HIHD$L$E5IHDL@HH$t;oH$B D$11?HI:HHD$9H|$1HE1?H$ HD$+fDEdD9d$6Ht$H|$HcE3AHt$ 9Ld$Ll$@1LL?L=Ht$ H HlLT?H=211 ?HILd$E1D$IAt3L<9H~AA<$:uԃD$D$ufDH|$HT$8H5gMc1BƄ t;H=ZH5w:HHD$Dd$8E11EHD$HHڋ H!%tHDHJHD@HH)A)9t<#cL$^1BH=n1DL$ LD$HL$DT$,LH|$4DL$ HL$LD$EtDT$,EoHtHf6L^6HLD$G6LD$L:6sH=1蒫3TH= 1s|3H5-H=ùH=1@I3H5L5DH=ڸ1H=UD$13H=12Ha5LY5DH=b1豪`H==螪MfAWAV1AUATAUSHH1IH":6Hƿ@4AL$1@dLLHL8L$0HI|$| 1Ƅ$1I$1LfDHHH9uI$Hk1X1HLH?4tJL$LH#4t. Lp2~=HuLcLDL9L9t҉AT1HĘ"D[]A\A]A^A_ÉE151HT$0t1@LHHH?H7H %HtJ)LHߍE1|3AA덺LD8H=_AdH)LDHE1P8HAA<00@AUATAUSH3HtWH71HIHC t[3HHHCht`11D7HHEtkHH[]A\A]DH=\01H=D0H\21H=$0L<2H421H=0H{h2fUSHHHFhHHPXxm/H{h1H{ 2HH[]1f.AWAV1AUATUSHt$,H5H|$HT$ H׺ [/H$D$(|$(HD$4HD$dT$(Ht$ H|$m0HI.H8H@E1D$B O,$1fDIIO(H}AپHN(1-11HƄ$2tcIGHT$ωL$B4 13L$IƉ#.Mt8D$4LpHcL5IHcD$4H=mLA1N-Lf0IGB9 MD$IT$A9W8I?60I-0I($0I0L0l$(|$(Hl$8H|$ H5~H-XL$Lt$LD$8H@ALL1,11LƄ$0At51#5HItt$,HL1L_/D,ۍCuH|$ H5H -/hL$LD$8HL$HAL1,11LƄ$-0AJ,HI@81ۅ~qDIEDIE T$4 IE4>.Ht8T$4HǍrHcG3IHcD$4H=hLA1I+La.CHA9E8D+I}C.I}:.I}(1.I}(.I} .I}.L.EtH|$Ld$@A.HHH3HHH;t{.Lt$HL-HI-I|F1H5<HIHL1.LL|/tD$X%=@tlLO-H3HHjHS11H[]A\A]A^A_C.<.J{;@Dp*HT$ t$,LL,Ht$H=1-fDAWAVAUATIUSHt$ ,HHHD$(Ll$0HD$H82HHH}t}.LuLo,LId,I|,HHH5HLL1,LH.tD$H%=@tu=H+H1HHZfDH/1H[]A\A]A^A_@E<.1}"Dt$ HtHP+Hh/뛐HD$(-Hj(HIH011H=,AHHD$HT$Ht$L-HT$(Ht t$ LHt$DL,L*H=UL1H=C(H[*Hs.H=:L1'H0*HH.L *pH=H1&H)H.L)=H)DS'ԉljD$ ,H=H1&Ht$DL+L)H-H)T$ f.ATUSH I1L'HƿHHcp.HHt5H/)1 L'HH []A\H={1蔚H(H6H?+DAWAVIAUATUSHH5H0-H5 I*'HHL H'HL)H=/ H/L )HH5,LLpE1J*fL HP'HHt2H'E111HHh'uH=HLrA;#t=H)HgH5H(HtH=bH1&aH5L)H5L{)H5Ld)H5~LM)H5lL6)H5ZL)H5HL)AH53L(tzL H%HteL H%HtP;H(H;HGE111HH%uH=HLfLE1*H=&HD[]A\A]A^A_H5)L9(L H@%HtH%;#tHE111HHS%uH=HL]H%Lh)1"HHHh+AHL"#AMHH;H'H@%H5^LL'D$ @L HH$HH$Ht2E111HH`$uH=HLjD$ ;#tHH*HIH5H%HtH=JL1Lf$IH=+H1:H={LDؕLA'H"$H5#L.&H5L&H5L&H5L%H5L%H5L%oH5L%XH5L%AH5Lv%E1L H{"HH #HJE111HH"uH=HL虔H=1A|H"Lt$ H=1}H=eAHH"LX&VH=1AL7&5H=L1AH=$L H=KL1AΓHv$H"H=L1E襓HM$H!H=y1A|A;#H5L#tF;H#HWH5H"HtH=RH1&H5L#u:HQ#L%H?!H=H1ƒAVAUIATUIS]!HHH&HH8tx.HXH5H"uH5H"H LI I|$HI`H5.HHL1!LLSLS H&HSfH1V$[]A\A]A^P.4x %@H5H"8H5H!!H5H! H5H!H5H!H5H!H5H!H5Hp!H5{HY!H5iHB!iH5WH+!RH5EH!;H53H $H5!H  H5H H5H H5H H5H H5cHs H5tH\ /H=1赏H-"H=L1藏LH"H=CL1lH=eH1NH=H18H=I1*H=1H=!1H=51H=1H=1H=1֎H=1ȎH=A1躎H={1謎H=1螎H=1萎H=A1肎H=1tH=1fH=1XH=91JH={1Ift$H=1辈HI$H=sJ4(1蝈H[]A\A]A^A_fT$H|$1H=x1YH=1<|$=Ha!T$1H8HH2H=6H1HR1NH=,1݇H=I$H=J4(1贇H=1衇HH=1膇HH4$H=1gH$HH=1?Hw|H=&H$yH$lDH=#19H=1ކ %s -> %sLOG_AUTHLOG_AUTHPRIVLOG_CRONLOG_DAEMONLOG_FTPLOG_KERNLOG_LPRLOG_MAILLOG_NEWSLOG_SYSLOGLOG_USERLOG_UUCPLOG_LOCAL0LOG_LOCAL1LOG_LOCAL2LOG_LOCAL3LOG_LOCAL4LOG_LOCAL5LOG_LOCAL6LOG_LOCAL7WARNING: Log size limit met but log file rotation turned off. Forcing log file rotation anyways. Need to rotate log file due to size but ran out of memory. Need to rotate log file due to size but could not get local time. ERROR: Can't open %s in append mode (check permissions!). WARNING: File locking not supported (NFS?)ERROR: %s is locked by another process POSIXLY_CORRECT%s: illegal option -- %c %s: unrecognized option `%s' %s: option `%s' is ambiguous %s: option requires an argument -- %c %s: option `--%s' doesn't allow an argument %s: option `--%s' requires an argument ERROR: optaddarg: Unregistered option %s ERROR: optaddarg: strdup() failed ERROR: optaddarg: malloc() failed ERROR: optparse: Can't register new option (not enough memory) ERROR: optparse: longopts[] is too small ERROR: optparse: shortopts[] is too small ERROR: optparse: (short|long)opts[] is too small ERROR: Please edit the example config file %s ERROR: Missing argument for option at line %d ERROR: Missing closing parenthesis in option %s at line %d ERROR: Empty argument for option %s at line %d ERROR: Incomplete option passed (missing argument) ERROR: optparse: No corresponding long name for option '-%c' ERROR: Parse error at line %d: Unknown option %s WARNING: Ignoring unsupported option %s at line %u WARNING: Ignoring unsupported option --%s (-%c) WARNING: Ignoring unsupported option --%s ERROR: Can't register argument for option %s ERROR: Can't register argument for option --%s WARNING: Ignoring deprecated option %s at line %u WARNING: Ignoring deprecated option --%s (-%c) WARNING: Ignoring deprecated option --%s ERROR: optparse: Can't compile regular expression %s for option %s ERROR: Incorrect argument format for option %s ERROR: Incorrect argument format for option --%s (-%c) ERROR: Incorrect argument format for option --%s ERROR: Option --%s (-%c) requires a non-empty string argument ERROR: Option --%s requires a non-empty string argument ERROR: Can't parse numerical argument for option %s ERROR: Can't parse numerical argument for option --%s (-%c) ERROR: Can't parse numerical argument for option --%s WARNING: Numerical value for option %s too high, resetting to 4G WARNING: Numerical value for option --%s (-%c) too high, resetting to 4G ERROR: optparse: calloc failed ERROR: optparse: strdup failed ERROR: Problem parsing options (name == NULL) Dump authenticode certificate chain.Perform HTML, script, and text normalizationAlways generate MDB entries for PE sectionsMaximum number of mismatched signatures when building a CVD. Zero disables this limit.Feature level to put in the CVDVersion number of the CVD to buildCreate a hybrid (standard and bytecode) database fileForce using the interpreter instead of the JITTrust loaded bytecode (default yes)Load and print bytecode information without executingPrint IR of bytecode signatureInput file to run the bytecode nDon't show source line during tracingName of the analyzer as seen in prewikkaSave all reports to a log file.By default the log file is locked for writing and only a single daemon process can write to it. This option disables the lock.Maximum size of the log file. Value of 0 disables the limit.Log all clean files. Useful in debugging but drastically increases the log size.Use the system logger (can work together with LogFile).Type of syslog messages. Please refer to 'man syslog' for the facility names.Rotate log file. Requires LogFileMaxSize option set prior to this option.Log additional information about the infected file, such as its size and hash, together with the virus name.Save the process ID to a file.This option allows you to change the default temporary directory.This option allows you to change the default database directory. If you enable it, please make sure it points to the same directory in both clamd and freshclam.Only load the official signatures published by the ClamAV project.By default, yara rules will be loaded. This option allows you to exclude yara rules when scanning and also to scan only using yara rules. Valid options are yes|no|onlyPath to a local socket file the daemon will listen on.Sets the group ownership on the unix socket.Sets the permissions on the unix socket to the specified mode.Remove a stale socket after unclean shutdownA TCP port number the daemon will listen on.By default clamd binds to INADDR_ANY. This option allows you to restrict the TCP address and provide some degree of protection from the outside world.Maximum length the queue of pending connections may grow to.Close the STREAM session when the data size limit is exceeded. The value should match your MTA's limit for the maximum attachment size.The STREAM command uses an FTP-like protocol. This option sets the lower boundary for the port range.This option sets the upper boundary for the port range.Maximum number of threads running at the same time.This option specifies the time (in seconds) after which clamd should timeout if a client doesn't provide any data.This option specifies the time (in seconds) after which clamd should timeout if a client doesn't provide any initial command after connecting.This option specifies how long to wait (in milliseconds) if the send buffer is full. Keep this value low to prevent clamd hanging.Waiting for data from clamd will timeout after this time (seconds).Maximum number of queued items (including those being processed by MaxThreads threads). It is recommended to have this value at least twice MaxThreads if possible. WARNING: you shouldn't increase this too much to avoid running out of file descriptors, the following condition should hold: MaxThreads*MaxRecursion + MaxQueue - MaxThreads + 6 < RLIMIT_NOFILE (usual max for RLIMIT_NOFILE is 1024) This option specifies how long (in seconds) the process should wait for a new job.Don't scan files/directories whose names match the provided regular expression. This option can be specified multiple times.Maximum depth the directories are scanned at.Follow symlinks to regular files.Scan files and directories on other filesystems.This option specifies the time intervals (in seconds) in which clamd should perform a database check.This option allows you to disable clamd's caching feature.Execute a command when a virus is found. In the command string %v will be replaced with the virus name. Additionally, two environment variables will be defined: $CLAM_VIRUSEVENT_FILENAME and $CLAM_VIRUSEVENT_VIRUSNAME./usr/bin/mailx -s "ClamAV VIRUS ALERT: %v" alert < /dev/nullStop the daemon when libclamav reports an out of memory condition.Permit use of the ALLMATCHSCAN command.Enable debug messages in libclamav.Don't remove temporary files (for debugging purposes).Run the daemon as a specified user (the process must be started by root).With this option enabled ClamAV will load bytecode from the database. It is highly recommended you keep this option on, otherwise you'll miss detections for many new viruses.Set bytecode security level. Possible values: TrustSigned - trust bytecode loaded from signed .c[lv]d files, insert runtime safety checks for bytecode loaded from other sources Paranoid - don't trust any bytecode, insert runtime checks for all Recommended: TrustSigned, because bytecode in .cvd files already has these checks.Set bytecode timeout in milliseconds.Allow loading bytecode from outside digitally signed .c[lv]d files.^(Auto|ForceJIT|ForceInterpreter|Test)$Set bytecode execution mode. Possible values: Auto - automatically choose JIT if possible, fallback to interpreter ForceJIT - always choose JIT, fail if not possible ForceInterpreter - always choose interpreter Test - run with both JIT and interpreter and compare results. Make all failures fatal.^(none|None|bytecode|Bytecode|pcre|PCRE)$Collect and print execution statistics. Possible values: Bytecode - reports bytecode statistics PCRE - reports PCRE execution statistics None - reports no statisticsDetect Potentially Unwanted Applications.Exclude a specific PUA category. This directive can be used multiple times. See https://www.clamav.net/documents/potentially-unwanted-applications-pua for the complete list of PUA categories.Only include a specific PUA category. This directive can be used multiple times.In some cases (eg. complex malware, exploits in graphic files, and others), ClamAV uses special algorithms to provide accurate detection. This option controls the algorithmic detection.PE stands for Portable Executable - it's an executable file format used in all 32- and 64-bit versions of Windows operating systems. This option allows ClamAV to perform a deeper analysis of executable files and it's also required for decompression of popular executable packers such as UPX or FSG. If you turn off this option, the original files will still be scanned, but without additional processing.Executable and Linking Format is a standard format for UN*X executables. This option allows you to control the scanning of ELF files. If you turn off this option, the original files will still be scanned, but without additional processing.With this option enabled clamav will try to detect broken executables (both PE and ELF) and mark them as Broken.Executable.Enable the built in email scanner. If you turn off this option, the original files will still be scanned, but without parsing individual messages/attachments.Scan RFC1341 messages split over many emails. You will need to periodically clean up $TemporaryDirectory/clamav-partial directory. WARNING: This option may open your system to a DoS attack. Please don't use this feature on highly loaded servers.With this option enabled ClamAV will try to detect phishing attempts by using signatures.Scan URLs found in mails for phishing attempts using heuristics.Always block cloaked URLs, even if they're not in the database. This feature can lead to false positives.PhishingAlwaysBlockSSLMismatchAlways block SSL mismatches in URLs, even if they're not in the database. This feature can lead to false positives.Detect partition intersections in raw disk images using heuristics.Allow heuristic match to take precedence. When enabled, if a heuristic scan (such as phishingScan) detects a possible virus/phish it will stop scan immediately. Recommended, saves CPU scan-time. When disabled, virus/phish detected by heuristic scans will be reported only at the end of a scan. If an archive contains both a heuristically detected virus/phish, and a real malware, the real malware will be reported. Keep this disabled if you intend to handle "*.Heuristics.*" viruses differently from "real" malware. If a non-heuristically-detected virus (signature-based) is found first, the scan is interrupted immediately, regardless of this config option.Enable the Data Loss Prevention module.This option sets the lowest number of Credit Card numbers found in a file to generate a detect.This option sets the lowest number of Social Security Numbers found in a file to generate a detect.With this option enabled the DLP module will search for valid SSNs formatted as xxx-yy-zzzz.With this option enabled the DLP module will search for valid SSNs formatted as xxxyyzzzzPerform HTML/JavaScript/ScriptEncoder normalisation and decryption. If you turn off this option, the original files will still be scanned, but without additional processing.This option enables scanning of OLE2 files, such as Microsoft Office documents and .msi files. If you turn off this option, the original files will still be scanned, but without additional processing.With this option enabled OLE2 files with VBA macros, which were not detected by signatures will be marked as "Heuristics.OLE2.ContainsMacros".This option enables scanning within PDF files. If you turn off this option, the original files will still be scanned, but without decoding and additional processing.This option enables scanning within SWF files. If you turn off this option, the original files will still be scanned, but without decoding and additional processing.This option enables scanning xml-based document files supported by libclamav. If you turn off this option, the original files will still be scanned, but without additional processing.This option enables scanning HWP3 files. If you turn off this option, the original files will still be scanned, but without additional processing.Scan within archives and compressed files. If you turn off this option, the original files will still be scanned, but without unpacking and additional processing.Mark encrypted archives as viruses (Encrypted.Zip, Encrypted.RAR).This option causes memory or nested map scans to dump the content to disk. If you turn on this option, more data is written to disk and is available when the leave-temps option is enabled at the cost of more disk writes.This option sets the maximum amount of data to be scanned for each input file. Archives and other containers are recursively extracted and scanned up to this value. The value of 0 disables the limit. WARNING: disabling this limit or setting it too high may result in severe damage.Files/messages larger than this limit won't be scanned. Affects the input file itself as well as files contained inside it (when the input file is an archive, a document or some other kind of container). The value of 0 disables the limit. WARNING: disabling this limit or setting it too high may result in severe damage to the system.Nested archives are scanned recursively, e.g. if a Zip archive contains a RAR file, all files within it will also be scanned. This option specifies how deeply the process should be continued. The value of 0 disables the limit. WARNING: disabling this limit or setting it too high may result in severe damage to the system.Number of files to be scanned within an archive, a document, or any other container file. The value of 0 disables the limit. WARNING: disabling this limit or setting it too high may result in severe damage to the system.This option sets the maximum size of a file to check for embedded PE. Files larger than this value will skip the additional analysis step. Negative values are not allowed. WARNING: setting this limit too high may result in severe damage or impact performance.This option sets the maximum size of a HTML file to normalize. HTML files larger than this value will not be normalized or scanned. Negative values are not allowed. WARNING: setting this limit too high may result in severe damage or impact performance.This option sets the maximum size of a normalized HTML file to scan. HTML files larger than this value after normalization will not be scanned. Negative values are not allowed. WARNING: setting this limit too high may result in severe damage or impact performance.This option sets the maximum size of a script file to normalize. Script content larger than this value will not be normalized or scanned. Negative values are not allowed. WARNING: setting this limit too high may result in severe damage or impact performance.This option sets the maximum size of a ZIP file to reanalyze type recognition. ZIP files larger than this value will skip the step to potentially reanalyze as PE. Negative values are not allowed. WARNING: setting this limit too high may result in severe damage or impact performance.This option sets the maximum number of partitions of a raw disk image to be scanned. Raw disk images with more partitions than this value will have up to the value number partitions scanned. Negative values are not allowed. WARNING: setting this limit too high may result in severe damage or impact performance.This option sets the maximum number of icons within a PE to be scanned. PE files with more icons than this value will have up to the value number icons scanned. Negative values are not allowed. WARNING: setting this limit too high may result in severe damage or impact performance.This option sets the maximum recursive calls to HWP3 parsing function. HWP3 files using more than this limit will be terminated and alert the user. Scans will be unable to scan any HWP3 attachments if the recursive limit is reached. Negative values are not allowed. WARNING: setting this limit too high may result in severe damage or impact performance.This clamscan option is currently for testing only. It sets the engine parameter CL_ENGINE_TIME_LIMIT. The value is in milliseconds.This option sets the maximum calls to the PCRE match function during an instance of regex matching. Instances using more than this limit will be terminated and alert the user but the scan will continue. For more information on match_limit, see the PCRE documentation. Negative values are not allowed. WARNING: setting this limit too high may severely impact performance.This option sets the maximum recursive calls to the PCRE match function during an instance of regex matching. Instances using more than this limit will be terminated and alert the user but the scan will continue. For more information on match_limit_recursion, see the PCRE documentation. Negative values are not allowed and values > PCREMatchLimit are superfluous. WARNING: setting this limit too high may severely impact performance.This option sets the maximum filesize for which PCRE subsigs will be executed. Files exceeding this limit will not have PCRE subsigs executed unless a subsig is encompassed to a smaller buffer. Negative values are not allowed. Setting this value to zero disables the limit. WARNING: setting this limit too high or disabling it may severely impact performance.This option enables on-access scanning (Linux only)This option specifies a directory or mount point which should be scanned on access. The mount point specified, or the mount point containing the specified directory will be watched, but only notifications will occur. If any directories are specified, this option will preempt the DDD system. It can also be used multiple times.This option specifies a directory (including all files and directories inside it), which should be scanned on access. This option can be used multiple times.This option allows excluding directories from on-access scanning. It can be used multiple times. Only works with DDD system.Use this option to whitelist the root UID (0) and allow any processes run under root to access all watched files without triggering scans.With this option you can whitelist specific UIDs. Processes with these UIDs will be able to access all files. This option can be used multiple times (one per line). Using a value of 0 on any line will disable this option entirely. To whitelist the root UID please enable the OnAccessExcludeRootUID option.Files larger than this value will not be scanned in on access.This option toggles the dynamic directory determination system for on-access scanning (Linux only).This option changes fanotify behavior to prevent access attempts on malicious files instead of simply notifying the user (On Access scan only).Enables extra scanning and notification after catching certain inotify events. Only works with the DDD system enabled.When started by root freshclam will drop privileges and switch to the user defined in this option.This option defined how many times daily freshclam should check for a database update.Use DNS to verify the virus database version. Freshclam uses DNS TXT records to verify the versions of the database and software itself. With this directive you can change the database verification domain. WARNING: Please don't change it unless you're configuring freshclam to use your own database verification domain.DatabaseMirror specifies to which mirror(s) freshclam should connect. You should have at least two entries: db.XY.clamav.net (or db.XY.ipv6.clamav.net for IPv6) and database.clamav.net (in this order). Please replace XY with your country code (see https://www.iana.org/domains/root/db). database.clamav.net is a round-robin record which points to our most reliable mirrors. It's used as a fall back in case db.XY.clamav.net is not working.db.XY.clamav.net database.clamav.netThis option allows you to easily point freshclam to private mirrors. If PrivateMirror is set, freshclam does not attempt to use DNS to determine whether its databases are out-of-date, instead it will use the If-Modified-Since request or directly check the headers of the remote database files. For each database, freshclam first attempts to download the CLD file. If that fails, it tries to download the CVD file. This option overrides DatabaseMirror, DNSDatabaseInfo and Scripted Updates. It can be used multiple times to provide fall-back mirrors.mirror1.mynetwork.com mirror2.mynetwork.comThis option defines how many attempts freshclam should make before giving up.With this option you can control scripted updates. It's highly recommended to keep them enabled.With this option enabled, freshclam will attempt to load new databases into memory to make sure they are properly handled by libclamav before replacing the old ones.By default freshclam will keep the local databases (.cld) uncompressed to make their handling faster. With this option you can enable the compression. The change will take effect with the next database update.Download an additional 3rd party signature database distributed through the ClamAV mirrors. This option can be used multiple times.With this option you can provide custom sources (http:// or file://) for database files. This option can be used multiple times.http://myserver.com/mysigs.ndb file:///mnt/nfs/local.hdbIf you're behind a proxy, please enter its address here.A user name for the HTTP proxy authentication.A password for the HTTP proxy authentication.If your servers are behind a firewall/proxy which does a User-Agent filtering you can use this option to force the use of a different User-Agent header.Send the RELOAD command to clamd after a successful update.Run a command after a successful database update.Run a command when a database update error occurs.Run a command when freshclam reports an outdated version. In the command string %v will be replaced with the new version number.With this option you can provide a client address for the database downloading. Useful for multi-homed systems.Timeout in seconds when connecting to database server.Timeout in seconds when reading from database server.This option enables support for Google Safe Browsing. When activated for the first time, freshclam will download a new database file (safebrowsing.cvd) which will be automatically loaded by clamd and clamscan during the next reload, provided that the heuristic phishing detection is turned on. This database includes information about websites that may be phishing sites or possible sources of malware. When using this option, it's mandatory to run freshclam at least every 30 minutes. Freshclam uses the ClamAV's mirror infrastructure to distribute the database and its updates but all the contents are provided under Google's terms of use. See https://transparencyreport.google.com/safe-browsing/overview and https://www.clamav.net/documents/safebrowsing for more information.This option enables downloading of bytecode.cvd, which includes additional detection mechanisms and improvements to the ClamAV engine.Disable authenticode certificate chain verification in PE files.Initialize a supplementary group access (the process must be started by root).Define the clamd socket to connect to for scanning. This option is mandatory! Syntax: ClamdSocket unix:path ClamdSocket tcp:host:port The first syntax specifies a local unix socket (needs an absolute path) e.g.: ClamdSocket unix:/var/run/clamd/clamd.socket The second syntax specifies a tcp local or remote tcp socket: the host can be a hostname or an ip address; the ":port" field is only required for IPv6 addresses, otherwise it defaults to 3310 ClamdSocket tcp:192.168.0.1 This option can be repeated several times with different sockets or even with the same socket: clamd servers will be selected in a round-robin fashion.Define the interface through which we communicate with sendmail. This option is mandatory! Possible formats are: [[unix|local]:]/path/to/file - to specify a unix domain socket; inet:port@[hostname|ip-address] - to specify an ipv4 socket; inet6:port@[hostname|ip-address] - to specify an ipv6 socket./tmp/clamav-milter.socket inet:7357Define the group ownership for the (unix) milter socket.Sets the permissions on the (unix) milter socket to the specified mode.Messages originating from these hosts/networks will not be scanned This option takes a host(name)/mask pair in CIRD notation and can be repeated several times. If "/mask" is omitted, a host is assumed. To specify a locally originated, non-smtp, email use the keyword "local".local 192.168.0.0/24 1111:2222:3333::/48^(Accept|Reject|Defer|Blackhole|Quarantine)$Action to be performed on clean messages (mostly useful for testing). The following actions are available: Accept: the message is accepted for delivery Reject: immediately refuse delivery (a 5xx error is returned to the peer) Defer: return a temporary failure message (4xx) to the peer Blackhole: like Accept but the message is sent to oblivion Quarantine: like Accept but message is quarantined instead of being deliveredAction to be performed on error conditions (this includes failure to allocate data structures, no scanners available, network timeouts, unknown scanner replies and the like. The following actions are available: Accept: the message is accepted for delivery; Reject: immediately refuse delivery (a 5xx error is returned to the peer); Defer: return a temporary failure message (4xx) to the peer.This option allows you to set a specific rejection reason for infected messages and it's therefore only useful together with "OnInfected Reject" The string "%v", if present, will be replaced with the virus name.If this option is set to "Replace" (or "Yes"), an "X-Virus-Scanned" and an "X-Virus-Status" headers will be attached to each processed message, possibly replacing existing headers. If it is set to Add, the X-Virus headers are added possibly on top of the existing ones. Note that while "Replace" can potentially break DKIM signatures, "Add" may confuse procmail and similar filters.When AddHeader is in use, this option allows you to set the reported hostname. This may be desirable in order to avoid leaking internal names. If unset the real machine name is used.Execute a command when an infected message is processed. The following parameters are passed to the invoked program in this order: virus name, queue id, sender, destination, subject, message id, message date. Note #1: this requires MTA macroes to be available (see LogInfected below) Note #2: the process is invoked in the context of clamav-milter Note #3: clamav-milter will wait for the process to exit. Be quick or fork to avoid unnecessary delays in email delivery/usr/local/bin/my_infected_message_handlerChroot to the specified directory. Chrooting is performed just after reading the config file and before dropping privileges.This option specifies a file which contains a list of basic POSIX regular expressions. Addresses (sent to or from - see below) matching these regexes will not be scanned. Optionally each line can start with the string "From:" or "To:" (note: no whitespace after the colon) indicating if it is, respectively, the sender or recipient that is to be whitelisted. If the field is missing, "To:" is assumed. Lines starting with #, : or ! are ignored.Messages from authenticated SMTP users matching this extended POSIX regular expression (egrep-like) will not be scanned. As an alternative, a file containing a plain (not regex) list of names (one per line) can be specified using the prefix "file:". e.g. SkipAuthenticated file:/etc/good_guys Note: this is the AUTH login name!SkipAuthenticated ^(tom|dick|henry)$This option allows you to tune what is logged when a message is infected. Possible values are Off (the default - nothing is logged), Basic (minimal info logged), Full (verbose info logged) Note: For this to work properly in sendmail, make sure the msg_id, mail_addr, rcpt_addr and i macroes are available in eom. In other words add a line like: Milter.macros.eom={msg_id}, {mail_addr}, {rcpt_addr}, i to your .cf file. Alternatively use the macro: define(`confMILTER_MACROS_EOM', `{msg_id}, {mail_addr}, {rcpt_addr}, i') Postfix should be working fine with the default settings.This option allows you to tune what is logged when no threat is found in a scanned message. See LogInfected for possible values and caveats. Useful in debugging but drastically increases the log size.This option affects the behaviour of LogInfected, LogClean and VirusAction when a message with multiple recipients is scanned: If SupportMultipleRecipients is off (the default) then one single log entry is generated for the message and, in case the message is determined to be malicious, the command indicated by VirusAction is executed just once. In both cases only the last recipient is reported. If SupportMultipleRecipients is on: then one line is logged for each recipient and the command indicated by VirusAction is also executed once for each recipient. Note: although it's probably a good idea to enable this option, the default value is currently set to off for legacy reasons.yesExampleERROR: Unknown option passed footruehelp^(yes|true|1|no|false|0)$config-file/etc/clamd.conf/etc/freshclam.conf/etc/clamav-milter.confdebuggen-jsondumpcertsquietleave-tempsno-warningsshow-progressstdoutdaemonno-dnslist-mirrorsupdate-dbreloadmultiscanfdpassstreamallmatchdatabase/usr/share/clamavrecursivegen-mdbfollow-dir-symlinks^[0-9]+$follow-file-symlinksbellno-summaryfile-listinfectedsuppress-ok-resultscopyremoveexcludeexclude-dirinclude-dirstructured-ssn-formathex-dumpmd5sha1sha256print-certshtml-normaliseascii-normaliseutf16-decodebuildmax-bad-sigs3000flevelcvd-versionno-cdiffserverunpackunpack-currentlist-sigsfind-sigsdecode-sigstest-sigsvbavba-hexcomparerun-cdiffverify-cdiffhybriddefaultcolorsconfig-dir/etcnon-defaultgenerate-configforce-interpretertrust-bytecodeprintsrcPrint source code of bytecodeprintbcirinputtracebytecode trace levelno-trace-showsourcearchive-verbosebytecode-trust-allhttp-proxyproxy-userlog-verboseforcedisable-summarydisable-archiveno-archiveno-peno-elfno-ole2no-pdfno-htmlno-mailno-phishing-sigsno-phishing-scan-urlsno-algorithmicno-phishing-restrictedscanmax-ratiomax-space^[0-9]+[KM]?$unzipunrararjunzoolhajartartgzdebblock-maxPreludeEnableprelude-enableEnable preludePreludeAnalyzerNameprelude-analyzer-name/tmp/clamav.logLogFileUnlockLogFileMaxSizeLogTimeLog time with each message.LogCleanLogSyslogLogFacilityLogVerboseEnable verbose logging.LogRotatelog-rotateExtendedDetectionInfoPidFile/var/run/clam.pidTemporaryDirectorytempdir/tmpDatabaseDirectorydatadir/var/lib/clamavOfficialDatabaseOnlyofficial-db-onlynoYaraRulesyara-rulesLocalSocket/tmp/clamd.socketLocalSocketGroupvirusgroupLocalSocketMode660FixStaleSocketTCPSocket3310TCPAddr127.0.0.1MaxConnectionQueueLength30StreamMaxLength25MStreamMinPort1024StreamMaxPort2048MaxThreads120CommandReadTimeoutSendBufTimeout200300MaxQueueIdleTimeout^/proc/ ^/sys/MaxDirectoryRecursionmax-dir-recursion15FollowDirectorySymlinksFollow directory symlinks.FollowFileSymlinksCrossFilesystemscross-fsSelfCheck600DisableCachedisable-cacheVirusEventExitOnOOMAllowAllMatchScanForegroundforegroundDon't fork into background.DebugLeaveTemporaryFilesUserBytecodeBytecodeSecurity^(TrustSigned|Paranoid)$TrustSignedBytecodeTimeoutbytecode-timeout5000BytecodeUnsignedbytecode-unsignedBytecodeModebytecode-modeAutoStatisticsstatisticsNoneDetectPUAdetect-puaExcludePUAexclude-puaNetTool PWToolIncludePUAinclude-puaSpy Scanner RATAlgorithmicDetectionalgorithmic-detectionScanPEscan-peScanELFscan-elfDetectBrokenExecutablesdetect-brokenScanMailscan-mailScanPartialMessagesPhishingSignaturesPhishingScanURLsPhishingAlwaysBlockCloakphishing-cloakphishing-sslPartitionIntersectionpartition-intersectionHeuristicScanPrecedenceheuristic-scan-precedenceStructuredDataDetectiondetect-structuredStructuredMinCreditCardCountstructured-cc-countStructuredMinSSNCountstructured-ssn-countStructuredSSNFormatNormalStructuredSSNFormatStrippedScanHTMLscan-htmlScanOLE2scan-ole2OLE2BlockMacrosblock-macrosScanPDFscan-pdfScanSWFscan-swfScanXMLDOCSscan-xmldocsScanHWP3scan-hwp3ScanArchivescan-archiveArchiveBlockEncryptedblock-encryptedForceToDiskforce-to-diskmax-scansize100Mmax-recursion16max-files10000MaxEmbeddedPEmax-embeddedpe10MMaxHTMLNormalizemax-htmlnormalizeMaxHTMLNoTagsmax-htmlnotags2MMaxScriptNormalizemax-scriptnormalizeMaxZipTypeRcgmax-ziptypercg1MMaxPartitionsmax-partitions128MaxIconsPEmax-iconspe100MaxRecHWP3max-rechwp3TimeLimittimelimitPCREMatchLimitpcre-match-limit100000PCRERecMatchLimitpcre-recmatch-limitPCREMaxFileSizepcre-max-filesizeOnAccessMountPath/ /home/userOnAccessIncludePathon-access-include/home /studentsOnAccessExcludePath/home/bofh /rootOnAccessExcludeRootUIDOnAccessExcludeUIDOnAccessMaxFileSizeOnAccessDisableDDDdisable-dddOnAccessPreventionOnAccessExtraScanningDevACOnlydev-ac-onlyDevACDepthdev-ac-depthDevPerformancedev-performanceDevLiblogdev-liblogUpdateLogFile/var/log/freshclam.logDatabaseOwnerCheckschecksDNSDatabaseInfocurrent.cvd.clamav.netDatabaseMirrorPrivateMirrorMaxAttemptsScriptedUpdatesTestDatabasesCompressLocalDatabaseExtraDatabasedbname1 dbname2DatabaseCustomURLHTTPProxyServeryour-proxyHTTPProxyPortHTTP proxy's port8080HTTPProxyUsernameusernameHTTPProxyPasswordHTTPUserAgentNotifyClamddaemon-notifyOnUpdateExecuteon-update-executecommandOnErrorExecuteon-error-executeOnOutdatedExecuteon-outdated-executeLocalIPAddresslocal-addressaaa.bbb.ccc.dddConnectTimeoutReceiveTimeoutSafeBrowsingDisableCertChecknocertsMailMaxRecursionArchiveMaxScanSizeArchiveMaxRecursionArchiveMaxFilesArchiveMaxCompressionRatioArchiveBlockMaxArchiveLimitMemoryUsageMailFollowURLsmail-follow-urlsClamukoScanOnAccessClamukoScannerCountClamukoScanOnOpenClamukoScanOnCloseClamukoScanOnExecClamukoIncludePathClamukoExcludePathClamukoExcludeUIDClamukoMaxFileSizeAllowSupplementaryGroupsClamdSockettcp:scanner.mydomain:7357MilterSocketMilterSocketGroupMilterSocketModeLocalNetOnCleanAcceptOnInfectedQuarantineOnFail^(Accept|Reject|Defer)$DeferRejectMsgMTA specificAddHeader^(No|Replace|Yes|Add)$ReplaceReportHostnamemy.mail.server.nameVirusActionChroot/newrootWhitelist/etc/whitelisted_addressesSkipAuthenticatedLogInfectedBasicSupportMultipleRecipients0.100.2%s/daily.cvd%s/daily.cldClamAV %s ClamAV %s/%u/%s/dev/nullCan't open /dev/null dup2(%d, %d) failed %s/Unable to allocate memory for db directory... ERROR: This tool requires libclamav with functionality level %u or higher (current f-level: %u) ERROR: --file-list: Can't open file %s !cdiff_cmd_close: No database to close !cdiff_cmd_close: Can't open file %s for reading !cdiff_cmd_close: Can't generate temporary name !cdiff_cmd_close: Can't open file %s for writing !cdiff_cmd_close: Can't apply DEL at line %d of %s !cdiff_cmd_close: Can't apply XCHG at line %d of %s !cdiff_cmd_close: Can't write to %s !cdiff_cmd_close: Not all DEL/XCHG have been executed !cdiff_cmd_close: Can't unlink %s !cdiff_cmd_close: Can't rename %s to %s !cdiff_cmd_close: Can't open file %s for appending !cdiff_apply: Problem parsing line !cdiff_apply: Unknown command %s !cdiff_apply: Not enough arguments for %s !cdiff_apply: Can't execute command %s !cdiff_cmd_unlink: Database %s is still open !cdiff_cmd_unlink: Can't get first argument !cdiff_cmd_unlink: Forbidden characters found in database name !cdiff_cmd_unlink: Can't unlink %s !cdiff_cmd_move: Database %s is still open !cdiff_cmd_move: Can't get third argument !cdiff_cmd_move: Can't get fifth argument !cdiff_cmd_move: end_line < start_line !cdiff_cmd_move: Can't get fourth argument !cdiff_cmd_move: Can't get sixth argument !cdiff_cmd_move: Can't get first argument !cdiff_cmd_move: Can't open %s for reading !cdiff_cmd_move: Can't get second argument !cdiff_cmd_move: Can't open %s for appending !cdiff_cmd_move: Can't generate temporary name !cdiff_cmd_move: Can't open file %s for writing !cdiff_cmd_close: Can't apply MOVE due to conflict at line %d !cdiff_cmd_move: Can't write to %s !cdiff_cmd_move: No data was moved from %s to %s !cdiff_cmd_move: Can't unlink %s !cdiff_cmd_move: Can't rename %s to %s !cdiff_cmd_xchg: Can't get first argument !cdiff_cmd_xchg: Can't get second argument !cdiff_cmd_xchg: Can't allocate memory for cdiff_node !cdiff_cmd_del: Can't get first argument !cdiff_cmd_del: Can't get second argument !cdiff_cmd_del: Can't allocate memory for cdiff_node !cdiff_cmd_add: Can't get first argument !cdiff_cmd_add: Can't allocate memory for cdiff_node !cdiff_cmd_open: Can't get first argument !cdiff_cmd_open: %s not closed before opening %s !cdiff_cmd_open: Forbidden characters found in database name !cdiff_apply: Can't duplicate descriptor %d !cdiff_apply: Can't allocate memory for 'line' !cdiff_apply: Can't allocate memory for 'lbuf' !cdiff_apply: lseek(desc, %d, SEEK_END) failed !cdiff_apply: Can't read %d bytes !cdiff_apply: No digital signature in cdiff file !cdiff_apply: Can't fstat file !cdiff_apply: compressed data end offset < 0 !cdiff_apply: lseek(desc, 0, SEEK_SET) failed 14783905874077467090262228516557917570254599638376203532031989214105552847269687489771975792123442185817287694951949800908791527542017115600501303394778618535864845235700041590056318230102449612217458549016089313306591388590790796515819654102320725712300822356348724011232654837503241736177907784198700834440681124727060540035754699658105895050096576226753008596881698828185652424901921668758326578462003247906470982092298106789657211905488986281078346361469524484829559560886227198091995498440676639639830463593211386055065360288422394053998134458623712540683294034953818412458362198117811990006021989844180721010947!cdiff_apply: Incorrect digital signature !cdiff_apply: Incorrect file format !cdiff_apply: Can't gzdopen descriptor %d !cdiff_apply: Premature EOF at line %d ^cdiff_apply: Ignoring new buffer size request - invalid size %d !cdiff_apply: Can't resize line buffer to %d bytes !cdiff_apply: Error executing command at line %d !cdiff_apply: fdopen() failed for descriptor %d *cdiff_apply: File %s was not properly closed *cdiff_apply: Parsed %d lines and executed %d commands wbabOPEN/\100002053ClamAV-Diff:%*u:%u:#LSIZE#LSIZE %uADDDELXCHGCLOSEMOVEUNLINK%o%06octx allocation failedengine initialization failedfmap initialization failedfmap failed_vba_project%s/%s_%upowerpoint documentworddocument%s/%scli_gentemp() failedERROR %s !Can't open directory %s. -------------- start of code ------------------ %s -------------- end of code ------------------ !ScanDir -> Can't open directory %s. !hexdump: Can't write to stdout !maxlinelen: Can't open file %s !maxlinelen: Can't read file %s !sha256file: Can't open file %s !getdsig: Can't create socket !getdsig: Can't connect to ClamAV Signing Service at %s !getdsig: Can't write to socket !getdsig: Error generating digital signature !getdsig: Answer from remote server: %s Signature received (length = %lu) !getdsig: Communication error with remote server !compare: Can't get MD5 checksum of %s !compare: Can't allocate memory for 'obuff' !compare: Can't allocate memory for 'nbuff' !compare: Can't allocate memory for 'tbuff' !compare: Can't open file %s for reading !compare: New %s file contains lines terminated with CRLF or CR !diffdirs: Can't open %s for writing !diffdirs: Can't open directory %s !unpack: Couldn't find %s CLD/CVD database in %s !unpack: %s is not a valid CVD !unpack: Can't unpack file %s !listdb: Can't allocate memory for buffer !listdb: Can't generate temporary name !listdb: Can't create temporary directory %s !listdb: Can't unpack CVD file %s !listdb: Can't list directory %s !listdb: Malformed pattern line %u (file %s) !listdir: Can't open directory %s !listdir: Can't allocate memory for dbfile !listdb: Error listing database %s !decodehexstr: Can't allocate memory for decoded !decodehexstr: Unknown wildcard (0x%x@%u) !decodehexspecial: strdup(hex) failed !decodehexspecial: Can't allocate memory for buff !decodehexspecial: Empty block {EXCLUDING_STRING_ALTERNATIVE:!decodehexspecial: Empty string alternative block !decodehexspecial: Invalid string alternative nesting !decodehexspecial: Missing closing parenthesis !pcre without logical trigger !missing regex expression terminator / !cannot allocate memory for trigger string !cannot allocate memory for regex expression !cannot allocate memory for compile flags {WILDCARD_ANY_STRING(LENGTH==%u)}{WILDCARD_ANY_STRING(LENGTH>=%u&&<=%u)}{WILDCARD_ANY_STRING(LENGTH>=%u)}{WILDCARD_ANY_STRING(LENGTH<=%u)}!Can't extract part %u of partial signature !matchsig: Can't create new engine !matchsig: cli_initroots() failed !matchsig: Can't parse signature !matchsig: Can't compile engine !decodesig: Invalid or not supported signature format !decodesig: Broken logical expression !decodesig: Too many subsignatures !decodesig: The number of subsignatures (==%u) doesn't match the IDs in the logical expression (==%u) !decodesig: Invalid or not supported subsignature format !decodesig: Invalid container size range !decodesig: Invalid container size !decodesig: Invalid compressed filesize !decodesig: Invalid uncompressed filesize !decodesig: Invalid encryption flag !decodesig: Invalid file position !decodesig: Invalid cyclic redundancy check sum !decodesig: Invalid target type decodesig: Not supported signature format !--test-sigs requires two arguments !testsigs: Can't open file %s !verifydiff: Invalid diff name !verifydiff: Incorrect info file %s !verifydiff: Incorrect format of %s !verifydiff: Can't generate SHA256 for %s !verifydiff: %s has incorrect checksum !verifydiff: Incorrect file name (no .cdiff/.script extension) !verifydiff: Can't generate temporary name for tempdir !verifydiff: Can't create directory %s !verifydiff: Can't unpack CVD file %s !verifydiff: Can't copy dir %s to %s !verifydiff: Can't open diff file %s !verifydiff: Can't chdir to %s ^verifydiff: Can't chdir to %s Verification: %s correctly applies to %s Verification: %s correctly applies to the previous version Clam AntiVirus: Signature Tool %s By The ClamAV Team: https://www.clamav.net/about.html#credits (C) 2007-2018 Cisco Systems, Inc. --help -h Show this help --version -V Print version number and exit --quiet Be quiet, output only error messages --debug Enable debug messages --stdout Write to stdout instead of stderr --hex-dump Convert data from stdin to a hex string and print it on stdout --md5 [FILES] Generate MD5 checksum from stdin or MD5 sigs for FILES --sha1 [FILES] Generate SHA1 checksum from stdin or SHA1 sigs for FILES --sha256 [FILES] Generate SHA256 checksum from stdin or SHA256 sigs for FILES --mdb [FILES] Generate .mdb (section hash) sigs --imp [FILES] Generate .imp (import table hash) sigs --html-normalise=FILE Create normalised parts of HTML file --ascii-normalise=FILE Create normalised text file from ascii source --utf16-decode=FILE Decode UTF16 encoded files --info=FILE -i FILE Print database information --build=NAME [cvd] -b NAME Build a CVD file --max-bad-sigs=NUMBER Maximum number of mismatched signatures When building a CVD. Default: 3000 --flevel=FLEVEL Specify a custom flevel. Default: %u --cvd-version=NUMBER Specify the version number to use for the build. Default is to use the value+1 from the current CVD in --datadir. If no datafile is found the default behaviour is to prompt for a version number, this switch will prevent the prompt. NOTE: If a CVD is found in the --datadir its version+1 is used and this value is ignored. --no-cdiff Don't generate .cdiff file --unsigned Create unsigned database file (.cud) --hybrid Create a hybrid (standard and bytecode) database file --print-certs=FILE Print Authenticode details from a PE --server=ADDR ClamAV Signing Service address --datadir=DIR Use DIR as default database directory --unpack=FILE -u FILE Unpack a CVD/CLD file --unpack-current=SHORTNAME Unpack local CVD/CLD into cwd --list-sigs[=FILE] -l[FILE] List signature names --find-sigs=REGEX -fREGEX Find signatures matching REGEX --decode-sigs Decode signatures from stdin --test-sigs=DATABASE TARGET_FILE Test signatures from DATABASE against TARGET_FILE --vba=FILE Extract VBA/Word6 macro code --vba-hex=FILE Extract Word6 macro code with hex values --diff=OLD NEW -d OLD NEW Create diff for OLD and NEW CVDs --compare=OLD NEW -c OLD NEW Show diff between OLD and NEW files in cdiff format --run-cdiff=FILE -r FILE Execute update script FILE in cwd --verify-cdiff=DIFF CVD/CLD Verify DIFF against CVD/CLD !hashsig: Can't access file %s !hashpe: Can't create new engine !hashpe: cli_initroots() failed !hashpe: Can't parse signature !hashpe: Can't compile engine !hashpe: fmap_need_off_once failed! !hashpe: unknown classification(%u) for pe hash! *hashpe: CL_VIRUS after cli_genhash_pe()! *hashpe: CL_BREAK after cli_genhash_pe()! !hashpe: Not a valid PE file! !hashpe: Other error %d inside cli_genhash_pe. !hashsig: Can't generate hash for %s !hashsig: Can't generate requested hash for input stream !hashsig: Can't generate hash for input stream !build: --server is required for --build !build: COPYING file not found in current working directory. !build: Can't initialize antivirus engine !build: Can't load database: %s !build: There are no signatures in database files !build: Can't open current directory !build: Memory allocation error !build: dblist2 == NULL (no .cbc files?) ^build: Signatures in %s db files: %u, loaded by libclamav: %u !Bad number of signatures in database files !build: Not a CVD/CLD/CUD file ^build: CAN'T READ CVD HEADER OF CURRENT DATABASE %s (wait 3 s) !build: Can't get builder name !writeinfo: Can't create file %s !writeinfo: Can't write to %s !writeinfo: Can't generate SHA256 for %s !writeinfo: Can't write to info file !writeinfo: Can't get digital signature from remote server !build: Can't generate info file !build: Can't generate temporary name for tarfile !build: Can't open file %s for writing !build: Can't add COPYING to tar archive !build: Can't open file %s for reading !build: Can't generate MD5 checksum for %s !build: Can't get digital signature from remote server !build: Can't create final database %s !build: Can't generate temporary name !build: Can't create temporary directory %s !build: Can't unpack CVD file %s !Generated file is incorrect, removed!Generated file is incorrect, renamed to %s !script2diff: Can't stat file %s !script2cdiff: Unable to allocate memory for file name !script2cdiff: Incorrect file name (no .script extension) !script2cdiff: Incorrect file name syntax !script2cdiff: Can't open %s for writing !script2cdiff: Can't write to %s !script2cdiff: Can't open file %s for reading !script2cdiff: Can't open file %s for appending !script2cdiff: Can't gzwrite to %s !script2cdiff: Can't open %s for reading/writing !script2cdiff: Can't get digital signature from remote server !script2cdiff: Can't open %s for appending !Can't initialize libclamav: %s !Can't parse command line options !htmlnorm: Can't open file %s !asciinorm: Can't open file %s !asciinorm: Can't allocate memory !asciinorm: File size of %zu too large !asciinorm: Can't open file ./normalised_text !asciinorm: Can't write to file ./normalised_text !utf16decode: Can't open file %s !utf16decode: Can't allocate memory !utf16decode: Can't create file %s !utf16decode: Can't write to file %s !cvdinfo: Can't read/parse CVD header of %s Verification: Unsigned container --list-sigs: Can't get status of %s --find-sigs: Can't compile regex !vbadump: Can't generate temporary name !vbadump: Can't create temporary directory %s !makediff: --diff requires two arguments !makediff: Can't read CVD header from %s !makediff: The old CVD must be %u !makediff: Can't generate temporary name for odir !makediff: Can't create directory %s !makediff: Can't unpack CVD file %s !makediff: Can't generate temporary name for ndir !makediff: --compare requires two arguments !dumpcerts: Can't create new engine !dumpcerts: cli_initroots() failed !dumpcerts: Can't parse signature !dumpcerts: Can't compile engine !dumpcerts: Can't open file %s! !dumpcerts: fmap_need_off_once failed! *dumpcerts: CL_CLEAN after cli_checkfp_pe()! *dumpcerts: CL_VIRUS after cli_checkfp_pe()! *dumpcerts: CL_BREAK after cli_checkfp_pe()! !dumpcerts: Not a valid PE file! !dumpcerts: Other error %d inside cli_checkfp_pe. !rundiff: Incorrect file name (no .cdiff/.script extension) !--verify-cdiff requires two arguments --verify-cdiff: Can't get status of %s NOCASEFULLWORDWIDEASCIIUNKNOWN%02xSIGNDPASSPassword: !getdsig: tcgetattr() failed !getdsig: tcsetattr() failed %30s!getdsig: Can't get password socket()connect()ClamSign:%s:%s:ClamSignPSS:%s:%s:ClamSignPSS2:%s:%s:Signature:#LSIZE %u OPEN %s ADD %s DEL %u %s XCHG %u %s %s CLOSE UNLINK %s !diffdirs: getcwd() failed !diffdirs: Can't chdir to %s ^diffdirs: Can't chdir to %s Generated diff file %s %s/%s.cvd%s/%s.cld!listdb: Can't open file %s !listdb: fgets failed ClamAV-VDB:!listdb: Invalid filename %s .db[%s] %s (Clam).crb.hdu.mdb.mdu.hsb.hsu.msb.msu.imp.ndb.ndu.ldb.ldu.sdb.zmd.rmd.cdb.cbc[%s BYTECODE] %s{WILDCARD_IGNORE}{WILDCARD_NIBBLE_HIGH:0x%x}{WILDCARD_NIBBLE_LOW:0x%x}!Decoding failed (1): %s {NOT_BOUNDARY_RIGHT}{BOUNDARY_RIGHT}{NOT_BOUNDARY_LEFT}{NOT_LINE_MARKER_RIGHT}{LINE_MARKER_RIGHT}{NOT_LINE_MARKER_LEFT}{LINE_MARKER_LEFT}{NOT_WORD_MARKER_RIGHT}{WORD_MARKER_RIGHT}{NOT_WORD_MARKER_LEFT}{WORD_MARKER_LEFT}{STRING_ALTERNATIVE:!Decoding failed (3): %s !Decoding failed (4): %s !Decoding failed (2) +-> TRIGGER: %s +-> REGEX: %s +-> CFLAGS: %s !Decoding failed {WILDCARD_ANY_STRING}-*matches at offsetsmatch at offset/CHECK OFFSETSUBSIG: %s testMATCH: ** YES%s ** (%u %s:MATCH: ** NO ** ANYYESNO!decodesig: Invalid input VIRUS NAME: %s .{TDB: %s LOGICAL EXPRESSION: %s * BYTECODE SUBSIG * SUBSIG ID %d +-> OFFSET: %s +-> OFFSET: ANY +-> SIGMOD: +-> SIGMOD: NONE +-> DECODED SUBSIGNATURE: +-> CONTAINER TYPE: %s CONTAINER SIZE: WITHIN RANGE %s to %s FILENAME REGEX: %s UNCOMPRESSED FILESIZE: ENCRYPTION: IGNORED FILE POSITION: CL_TYPE_ZIPCL_TYPE_RARCRC SUM: ANY CRC SUM: %d FILE TYPE NAME: %s FILE SIGNATURE TYPE: %s FILE MAGIC OFFSET: %s FILE MAGIC HEX: %s FILE MAGIC DECODED: FILE TYPE REQUIRED: %s FILE TYPE DETECTED: %s FTM FLEVEL: >=%s FTM FLEVEL: %s..%s TOKENS COUNT: %u FUNCTIONALITY LEVEL: >=%s FUNCTIONALITY LEVEL: %s..%s TARGET TYPE: ANY FILE PE OLE2 HTML MAIL GRAPHICS ELF NORMALIZED ASCII TEXT DISASM DATA MACHO PDF FLASH JAVA CLASS DECODED SIGNATURE: !verifydiff: strdup() failed %s.info!verifydiff: Can't open %s ClamAV-VDBDSIG.cdiff!verifydiff: getcwd() failed !verifydiff: Can't apply %s sigtool [options] hashsig%s:%u:%s deadbeef!hashpe: Can't open file %s! COPYINGlast.hdb%s.%s%s/%s.cudVersion number: !build: scanf() failed Total sigs: %u New sigs: %u C%d %b %Y %H-%M %zSIGNDUSERBuilder name: %32s:%u!writeinfo: Can't unlink %s wb+DSIG:%s wb9fbytecode.info!build: Can't write to %s ^build: Can't unlink %s Created %s Skipping .cdiff creation %s-%u.script%s.brokenClamAV-Diff:%u:%u:ab9f:%s!fmap failed !fmap: Could not map fd %d ./normalised_text%s.asciiFile: %s Build time: %s Version: %u Signatures: %u Functionality level: %u Builder: %s MD5: %s Digital signature: %s !cvdinfo: Verification: %s Verification OK. !vbadump: Can't open file %s !dumpcerts: No filename! !rundiff: Can't open file %s cfgignign2ftmidbsfpgdbpdbwdbj+j>jQjdjwjjjjjjjj;DG84(>H>?@('DxI[L NsO8$V]_@kl4mSoHr sXH(`8x(HxXȶh(P0`hPh80XH8 P  HP x HP h 8 (h   H p ( hX" (#hzRx *zRx $1 FJ w?;*3$"LDȡBBB B(A0A8Jb 8A0A(B BBBH (7Hb F LHBBB B(A0A8G 8A0A(B BBBE Lȩ BBB B(A0A8G  8D0A(B BBBG 4TbBDH A ABF AFBd4BBE B(D0A8N@ 8A0A(B BBBI D 8F0A(B BBBE |BBE B(H0A8J^ 8A0A(B BBBJ J 8D0A(B BBBI v 8G0D(B BBBE t 4eFAJ } CAF DDA<мBBD A(J0h (A ABBG d`BBE B(D0A8RP 8A0A(B BBBH L 8C0A(B BBBA 4eFAJ } CAF DDA,KAD AB\pBBE B(D0A8J,,D,X,C, 8D0A(B BBBA LBBE B(D0A8IGUBW 8C0A(B BBBA n 8C0A(B BBBA U 8A0A(B BBBA l0BBB B(A0A8D@IHKPYHA@| 8A0A(B BBBF  8D0A(B BBBO TdXBBB A(D0D@ 0D(A BBBM k 0A(A BBBE @D{<HAA h ABK  HBK hL,`BBH A(H@/ (F ABBA B (C ABBA D|BAF MX  CABD X  EABH H <@~BAH GM  CABK G CABAL< BBB B(A0A8Dp 8C0A(B BBBJ LOAA q CBA S ABB DABL/BBE B(D0A8DP 8C0A(B BBBA \, BBA A(D0 (C ABBA _ (C ABBI W (C ABBA LBBB B(A0A8D 8C0A(B BBBH <BBC A(O0 (A ABBD L !BBD A(D0 (A BBBD E (H BBBA 4l AAQ | AAG L CAA L BBE A(F0s (F BBBA \ (A BBBA L BBD B(F0A8LB 8C0A(B BBBJ LD BBD B(D0A8RE2 8D0A(B BBBA < BBD A(N0U (A ABBF $ xCAAI nDAL BBD B(A0A8G  8A0A(B BBBA LL `3BBB B(D0A8G 8A0A(B BBBE 4 PBAA G@^  AABA L /BBD B(C0A8J8A0A(B BBB,$ =0BED ABT ( Dl 0BBE A(H0J@0A(A BBBL }1zBBD B(D0A8MP8D0A(B BBBL 4BBE B(D0A8D8C0A(B BBBLT :}BBE B(D0A8L T8C0A(B BBB< ;<BBH A(L(C ABBL BBE B(A0A8NP| 8D0A(B BBBD <4YBBE A(D0 (A BBBD Lt=iBBD B(D0A8D@K8A0A(B BBBL3>BBB B(A0A8G8A0A(B BBBLDBBD B(D0A8Pp8A0A(B BBBdd4KBBD A(D0WvBBHWB_A0A(A BBBLM BBB B(D0A8J 8C0A(B BBB,"Y^AAGRAA<LPYBBA A(G(A ABBD,ZBBB A(A0G@0A(A BBBL\BBE B(H0A8M d8C0A(B BBB$xmK]dD -BBB B(A0A8GBBH[4 8C0A(B BBBJ 4^BBC A(D0(A ABBLY_BBI B(A0A8Gh8D0A(B BBBt4wBBB B(D0A8IeG\B 8D0A(B BBBA BBH[D eBBE B(H0H8M@r8A0A(B BBB  A AP AH A AX A A0 A A8 A A( A A@!A !A!A!!A,!A7!AB!AM!A[Ah`A=A=AzAcA=A=AzAA=A=AzAcA=A=AAV`A=A=A—A`A+=A=AȗA`A)=A=AAv`A:=A=AїA`AX+A=AۗA`A:=A=AA`A=A=AA`A=A=AA`A=A=AA`A:=A=AAd`A=A=AA`A=A=AA`A=A=A)A=A=A3A`A=A=A:Am`A=A=ADA`A=A=AKA`A=A=ARAz`A=A=A֤A`A+A=A[AddA=A=AvAr`A=A=AA`A+A=AAA=A=AAA=A=AA`A=A=AA`A=A=AʘAf=A=AԘAi`A=A=AݘAo`A=A=AA=A=AA=A=AA`A=A=AA=A=AA=A=AZA=A=AA=A=AAA=A=A3A`A =A=AAAAAA `?AAAĠA`A ?AٝA֠AA?AA ?AAAA(AAXAA AAA`A BA(A&A1A 0BA=ALAWA BAcAsAA`A HCA(AAA`A DA(AAA`A EA(AA֡A`A FA(AAA`A GA(AA`AGAٝA AA`A HA(AAA`A IA(A/AHA`A PIAٝAIAWA`A IA=AdAzA`A XJA(AAA`A JA(AâAۢA`A 8MAٝAA AA `MAKAA4AA MAKAIA`A(NA(AcA`ANAٝAAA`A NA(AAA`A OA(AAA`A hPAٝA£AʣA`A PA(AӣAۣA`A QA(AAA`A HRA(AAA`A SA(AAA`A SA(A)A?A`A @TAٝAOA[A`A TAٝAAiAA@ hUAvAAAA VAAA{AA WAA)AAA' YAAAAA ZAAAΤAA [AAAAA \AAAAAP ]AA'A5AA ^ADAGAUAA2 @_AdAhAsAAd x`AAAAA aAAAAAcAӥAAAA cAΥAեAAA eAAA AA fAAA`A hAٝAAXhA/AAA =A=AKAZA`A =A=AjAtA`A=A=AAAl-AAA&AuA8nAAAAcA nAAAЧAnAЧAA8pAqAArA@tAAAptAKAA`AtA(A A`A(uA(A.A`AuA=ADAvARAbA0wAwAtAwAAAAAAA8xAƨAϨAhxAFAAxASAAAA8yA(A AAxyA+A3ABAyA+ASAeAyA+AyAAapzAAAAzAAAA{AAĩA`AP{A(ANA`A`~A(AѩAA`A ~AٝAA=A=AA=A=AA=A=A"A=A=A2A=A=AMA`A=A=A]A`A=A=AuAA`A =A=AA`A=A=AAA=A=AA`A=A=AϪA`A=A=AA`A=A=AA=A=AA=A=AAA=A=A,AAP=A=A?A`A0AٝAXAAdA~AA0AAXA AAA;AAAAA(AAXAAƫA(AѫAXAѫAܫAAAAAAA AA"AٝAhA9AAAAPAdAAxApAAwAA(AAAA8AA`AìAAAìAɬA`AxA(A)A`A=A=AA=A=A/A`A=A=AA`A=A=A5A`A=A=AA=A=AuA`A=A=AAA=A=A)AA=A=AAA=A=A A`A=A=AA`A=A=AA`A=A=AA`A=A=AA`A=A=AA`A=A=AAA=A=A]A=A=ANAA=A=AiA=A=ANA@AP@A @A@A@AP@A0@A\A`AdAiA0AAAAAAAAAAAAAAAAmArAqAuAyA}AAAA2?KXcz% 0@ ( Ax@@H@  b"@h!@ o @ooh@0}b1@1@&1@61@F1@V1@f1@v1@1@1@1@1@1@1@1@1@2@2@&2@62@F2@V2@f2@v2@2@2@2@2@2@2@2@2@3@3@&3@63@F3@V3@f3@v3@3@3@3@3@3@3@3@3@4@4@&4@64@F4@V4@f4@v4@4@4@4@4@4@4@4@4@5@5@&5@65@F5@V5@f5@v5@5@5@5@5@5@5@5@5@6@6@&6@66@F6@V6@f6@v6@6@6@6@6@6@6@6@6@7@7@&7@67@F7@V7@f7@v7@7@7@7@7@7@7@7@7@8@8@&8@68@F8@V8@f8@v8@8@8@8@8@8@8@8@8@9@9@&9@69@F9@V9@f9@v9@9@9@9@9@9@9@9@9@:@:@&:@6:@F:@V:@f:@v:@:@:@:@:@:@d "bGCC: (GNU) 5.3.0GCC: (GNU) 5.5.0.shstrtab.interp.note.ABI-tag.hash.dynsym.dynstr.gnu.version.gnu.version_r.rela.dyn.rela.plt.init.plt.got.text.fini.rodata.eh_frame_hdr.eh_frame.ctors.dtors.jcr.data.rel.ro.dynamic.got.plt.data.bss.comment 8@8T@T !x@x' H@HP/@7oh@h\Do @ Sh!@h!]B"@"g0@0$b0@0 m:@:v:@:G|( A( 8 A8 ADA< b  b  b  b p\ 0}b0}qb8bb*@b* 0*"Lusr/bin/clamdtop0100755000000000000000000054245013365330320012677 0ustar rootrootELF>Q@@@8 @@@@@@88@8@@@ G G 8U8Ub8Ubgm bbTT@T@ PtdBB44QtdRtd8U8Ub8UbZZ/lib64/ld-linux-x86-64.so.2GNU u_rSgc:?bDR';d!UIonML<)YwBT{Gq x]CvA3 ~ ylX@*#.1+/ 62%, W84F=H\aE j`&5-s>^zPm7}fKJ[N"ZeptQ|($i9kOV0hz=Alk R-)  _KikA6CvV6b<K EoX " Yo!r<e{\bXyfWiؼb#aj/yQ HbYa0/3-DؼbP[C Xbx?(b_I83d 02@libncurses.so.5wtouchln_ITM_deregisterTMCloneTableuse_default_colorswattr_onwaddchacs_mapwborder_finiinit_pairwbkgdwrefreshkeypadinitscrsubwinstart_colorwattr_offnonl__gmon_start__delwinhalfdelaystdscrendwinwgetchmvwprintw_Jv_RegisterClassesnoecho_ITM_registerTMCloneTablewmovecurs_setwerasederwinlibssl.so.1X509_STORE_CTX_initEVP_SignFinalEVP_MD_sizeX509_VERIFY_PARAM_newEVP_DigestFinal_exEVP_VerifyFinalBIO_pushBIO_readEVP_PKEY_freeSSL_library_initEVP_DigestInit_exBIO_set_flagsX509_verify_certX509_get_pubkeyX509_STORE_freeEVP_DigestUpdatePEM_read_bio_X509_AUXEVP_MD_CTX_set_flagsEVP_MD_CTX_destroyEVP_get_digestbynameBIO_newBIO_ctrlBIO_freeX509_VERIFY_PARAM_freeEVP_PKEY_sizeX509_STORE_newX509_freeSSL_load_error_stringsEVP_MD_CTX_mdBIO_free_allERR_load_crypto_stringsPEM_read_bio_X509BIO_writeBIO_s_fileBIO_s_memEVP_MD_CTX_createlibcrypto.so.1X509_LOOKUP_filePEM_read_X509X509_STORE_add_lookupBIO_f_base64X509_STORE_CTX_newX509_STORE_CTX_freeX509_LOOKUP_ctrlX509_CRL_freeOPENSSL_add_all_algorithms_noconfOpenSSL_add_all_digestsEVP_cleanupX509_LOOKUP_hash_dirBIO_new_mem_bufX509_VERIFY_PARAM_set_flagsX509_STORE_set_flagsOpenSSL_add_all_ciphersX509_STORE_add_crlPEM_read_PrivateKeyPEM_read_X509_CRLX509_STORE_set1_paramX509_cmp_current_timeEVP_MD_block_sizelibz.so.1libjson-c.so.2libpcre.so.1libpthread.so.0sendrecv__errno_locationconnectlibc.so.6socketsprintfsrandgai_strerrorstrncmpoptindstrrchr__strdupperrorclosedirsignalstrncpyforkputcharreallocclockmemchrlocaltime_rstrtolctime_rfgetscallocstrlengetaddrinfomemsetstrstrmemcmpdup2__fxstat64strptimevsnprintfctimestdoutfputcfputsmemcpyfclosestrtoulsetsockoptmallocstrcasecmp__lxstat64opendir__xstat64__ctype_b_locgetenvsscanfoptargstderroptoptfilenofwritegettimeofdaystrchrreaddir64qsort__ctype_toupper_loc__ctype_tolower_locfreeaddrinfosetsidmemmovefopen64accessopterrstrcmp__libc_start_mainvfprintf__cxa_atexit_edata__bss_start_endGLIBC_2.2.5GLIBC_2.14GLIBC_2.3p ui ii 'ui bbbȯb=ЯbFدbbbb b(b0b8b@bHbPbXb `b hb pb xb bbbbbbbbbȰbаbذbbbbb b!b"b#b$ b&(b'0b(8b)@b*Hb+Pb,Xb-`b.hb/pb0xb1b3b4b5b6b7b8b9b:b;ȱb<бb>رb?b@bAbBbCbDbEbGbH bI(bJ0bK8bL@bMHbNPbOXbP`bQhbRpbSxbTbUbVbWbXbYbZb[b\b]Ȳb^вb_زb`babbbcbebfbgbhbi bj(bk0bl8bm@bnHboPbpXbq`brhbspbtxbubvbwbybzb{b|b}b~bȳbгbسbbbbbbbbb b(b0b8b@bHbPbXb`bhbpbxbbbbbbbbbbȴbдbشbbbbbbbbb bHH}}"HtK 9H5}"%}"@%}"h%}"h%}"h%}"h%}"h%z}"h%r}"h%j}"hp%b}"h`%Z}"h P%R}"h @%J}"h 0%B}"h %:}"h %2}"h%*}"h%"}"h%}"h%}"h% }"h%}"h%|"h%|"h%|"hp%|"h`%|"hP%|"h@%|"h0%|"h %|"h%|"h%|"h%|"h %|"h!%|"h"%|"h#%|"h$%z|"h%%r|"h&%j|"h'p%b|"h(`%Z|"h)P%R|"h*@%J|"h+0%B|"h, %:|"h-%2|"h.%*|"h/%"|"h0%|"h1%|"h2% |"h3%|"h4%{"h5%{"h6%{"h7p%{"h8`%{"h9P%{"h:@%{"h;0%{"h< %{"h=%{"h>%{"h?%{"h@%{"hA%{"hB%{"hC%{"hD%z{"hE%r{"hF%j{"hGp%b{"hH`%Z{"hIP%R{"hJ@%J{"hK0%B{"hL %:{"hM%2{"hN%*{"hO%"{"hP%{"hQ%{"hR% {"hS%{"hT%z"hU%z"hV%z"hWp%z"hX`%z"hYP%z"hZ@%z"h[0%z"h\ %z"h]%z"h^%z"h_%z"h`%z"ha%z"hb%z"hc%z"hd%zz"he%rz"hf%jz"hgp%bz"hh`%Zz"hiP%Rz"hj@%Jz"hk0%Bz"hl %:z"hm%2z"hn%*z"ho%"z"hp%z"hq%z"hr% z"hs%z"ht%y"hu%y"hv%y"hwp%y"hx`%y"hyP%y"hz@%y"h{0%y"h| %y"h}%y"h~%y"h%y"h%y"h%y"h%y"h%y"h%zy"h%ry"h%jy"hp%by"h`%Zy"hP%Ry"h@%Jy"h0%By"h %:y"h%2y"h%*y"h%"y"h%y"h%y"h% y"h%y"h%x"h%x"h%x"hp%x"h`%x"hP%x"h@%x"h0%x"h %x"h%x"h%x"h%x"h%x"h%"s"fAWAVAUATUSH=KHH^.HaR"L%?"Ttx"Hr"H8HD$0H^1]1ډھھ1w1fھUھ Dھ 3D1۽EHD$pHD$`HD$hHD$8H$HD$wHHcӃHD$pH+D$`H=E111H=?"HHH!"L,HHH)HH="?t H5PI}LHAUxIELHIDžH)HHAUxDH="QA|$H;="IaH=z"HtH5v"H <HD$pHT$xHD$`HT$hH=*"1H="H="1Ҿ|Le"H="H v111LH=݀"1ҾyHD$QD$H$H"H9HHL%"AH H"L4t E19-s"Aŋ"x]HHfAf.JE~XE=f.}AMvYuAGHD$KHHD$HǸ,1|$N.AN,HD|NDOH$E1HN/A@fDP D$_D= " HAWA~XAw4$AvHAvA6t$(AFxHPAF|PAFpPAFlPAF^PEN]1EF\vHP~"H H!%tDHJHD@HE H l1I؉L1L|$H=w"L:=H=w"H (1;MHS㥛 LILHIIIHHHA1HIHH=]w"L<Iv"IHIIHH9։E1AH=w"A+B:H=v"H^\$GÉD$6fDH=v"1DotHd"H=v"Hh@HI"5u"AAY@H=yv"1DtHcd"H=\v"HpfDHD$Hused NAH0H/A free fP HpH N/A toHpHtal N/HpfDHD$Hheap NAH0H/A mmap fH HpH N/A unHpHused N/HpfDMeL4$HD$Hl$ E1\$(Lt$HHD$H=u"LL$DEH H=Su"1҉1H=Au"H E޸H=u"H M1uIHL9,$Le L_HItHx IH|$LI$ID$Ƅ$I9sLL)Ƅ Mt=h"MgLD$H=rt"H 1҉1H4$Lt$HHOL9HfRt rH St"Ht)H5?t"11HHDxBH9Hr+s"~fDH,1<Hs"HO)g"WHH9HȺF‰ g"$@1HD$0H8m=s"5DH\$0H;H5BH=Ocr"n4H5<H=N[4H5KH=aH4H5YH=o54H5gH=y"4H5˭H=l4H5H=^3H5H=O3H5HH=P3H5KH=U3H5OH=^3H5٭H=R3H5VH=m3H5ۭH=iw3H5H=[d3H5 H=@Q3H52H=>3H5_H=+3H5tH=3H5H= 3H5H=2H5H=2H5H=2H;H=eq"H=Yq"1ҾH=Fq"H ˲111H=-q"1ҾH=q"-DH;t=H=p"1Ҿet$LRp"H bH=p"113H=p"1Ҿ`iv d"1HY^"H8HD$0gs1Lc"c"H5۲-H5.,f.@1I^HHPTIkAHjAHǠ<@fDH=j"Hj"UH)HHvH]"Ht ]fD]@f.H=j"H5zj"UH)HHHH?HHtHQ]"Ht ]f]@f.=9j"ubUH"H0j"HATSH"L%|"H)HHH9s@HHi"AHi"H9r[A\]i"H=A"H?u .fDH\"HtUH]Ht]USHHHH;Ht H(t,H{Ht HtH[8HuH1[]DHH[]1Ðf.AUATIUSIHHxHHË@(u\S$uDHH{KHHHCHLkC$C 1H[]A\A]fDK$tHHIHtHHID$Ml$HHHB0HuLb0HCC$Hz@HCHHdC 1_HC1H["H5LH81)HZ"H="H2HZ"H="HHZ"H=z"HLAWAVMAUATIUSHIILHHT$4H,HT$HHHBHHML%HHCMLHHCC HkHHvC D$PHC0HC8C$HC@C(D$XC,I$HtXHX8I$1H[]A\A]A^A_MHKMHCXHCC `IEI]I$HC8H1[]A\A]A^A_øH{OH;GH?gDHt]USHHHH;Ht HXt,H{Ht HCtH[8HuH1[]DHH[]1Ðf.HATUISHG@Ht7H8Ht&f.ID$@H<HHuHqI\$0Ht5H{tgH;WH{NH{EHk0H9HHuI<$(I|$I|$I\$8LHtIDH[0[]A\ff.AWAVIAUATEUSEHL$@t$4HT$8L$0HD$hHD$pMtLT$hHD$pL=\"A1D\$ Ƅ$:HD$ HD$h1I7AHD$(3E4Du EtAtMMI7HHۉH,HUHuH}uMD\$LLc\$ cH5LHHD$HD$xD$HD$ Dd$(HD$XH$HD$ HD$dHD$PH$@HD$@MH$@HT$HHHl$xHH!%tDHVHD@HH1H)fHH t X9|HcHHD$ Hl$xHGE<#;H5H t- Hu  HuD\$0EtHU"T$ H5_H81HD$HtHCH|$h1 fHUHtkAIcHHH @E0}t H}(HHDŽHHAHDŽPUXE|$ ~HcL$ }QD$ HcƄ:E0H}(HD$ Ƅ:/fDHHDŽHVLT$D\$HMWE0PHt$0H|$8LM LE(VZYD\$LT$HS"H=?1HH|$hI7D$ @I7T$ @HHZH1ҍpH"IH t 9|HcL$Lj~HHcAt HA~@v(@ t"zfALHxq@v uHuzHAA<$"3LD$hHLLD$HLD$UHcP,EH IHʋS4tIAtDT$(u>Mct$0HH/R"H5L$ H81DD$(HEMYT$0HHQ"H5gL$ H81MH$LD$PHL$@Ht$8|$4HD$d=:;HHDD$LEt8;$XHD$@L$LHP81fDH ;Z9uH Q"H5.H81uMMLD$hHLHLMIHP"H5HH81dMuMu {HsHtUC0H|$ ED$H‰D$HmY8H|$ E111LH|$ D$sD$0C7FMPHt$X1LHD$LD$A8"{HT$xHMtKH=?AH HHLD$hE1M^I\$"HHA|$|IHcD$dHH@HH\"L rHN"H= )1HSH|$hyHH[]A\A]A^A_ÃLD$hH5}LLD$"LD$tA<$1A|$E11HHH@CML 1HE1HcLD$hgD$LD9AL=&HcD$LBƄHD$HHDŽ@HDŽPDŽXDŽHVHM"H=~ *1H"H|$hHL%|LD$h1D$0CHiM"HSH56 H81$H|$uH\$hdH|$tH|${MuH\$hH?L%R"A$9D$4*|$4)ǃHc-HHC@A,$9l$4H|$8HcL,׉fI9l$4)HcI}HHH\$hA$HC@)HcH<uHvL"H=wHeHA"MHH6L"H5H81LD$h|$0 MHK"T$ H5\ HH81L$0&C{HK"HSH5 H81{H5zLLD$1ɅLD$E1HwK"HSH5t H812A<$uCHHh1[]A\A]A^A_HE"H=.HHl$(IqHAA0H\$@L $H߃҃VNL $t)H'E"IQH5TLH81Hl$($Ht$1E11HL $荹H߉3LH5VL $AAK 'H\$H5sL $HL $t;1Y{OHD$HT$H|$(HLL $L $KHD$(Hh[]A\A]A^A_L $tHHD$L $HHt$81H;"L $ HT$8M@,HHD$HDN@u+H|$H2IY(H\$$f.HH|$H|$ 1L $SHD$HL $KH=?HH WH|$H5orL $HD$L $IQH5["HB"H5"LL $H81HD$L $DkkmuH=HLH5!1HD$f.fAWAVIAUATAUSH=:IHH1һ++ >O"H=+O"H-G"HLcEHcHcLMIOLI1H5N"2@u`@HAG"I? N"Hcɀ< tjDE9}DeH[]A\A]A^A_H2@t9ur N"@:yW]tIcHcIT< uAIN"DuDuE9XIcIDH -@+@-Du@HA9H -uztLLD]NHcA9ILDu{LA9~HcITfH2HHru9|HA9uHcMDuDufH[]A\A]A^A_@H@"IUH5H81HcE M"IML4@;fMHcA<2z:8AVL"D9U H E" .1:AD:fDA:A4Fը8:BHcȃA:EfDDBA-tlE(LLD-L"AL"DuHH>AK"DuI1H7!zuADu zADuKTHJA9ܺDuDHc>"IUH5H81: aK"Du:?ff.AWAVAAUATH=USHIHxDL$ HL$LD$HDL$ 1D$ ++HIC"H=J"D;HE9IcH<Ll=H|$ IU -@+@-LEfAHE9H -uztLD$HL$LHDD+E9AIcHt}RAMH~D9~'HcHDfHAHHPA9|HA9ωHcAH|uDzfE_ADE9}$D3DHx[]A\A]A^A_fAHxD[]A\A]A^A_z@-t@ELHDDAfDA$<:D$ A4VՁ<|$ :P3HcʃA< @:@|$ EfDE_H5H"DIEHHH"-:5Iu~Ht$XlHt$X~-@@HD|$8HD$0<=D$gHcljHD=tHuT$gL$`HD$HHHD$PWD$`+D$8LD$PD|$HPH@E1DADfDHcЍHAHcA44@:t-Wu@;t"9uHxLH[D]A\A]A^A_HHcA<4:E͉|$8iH.?"A?E_H5~DIMHUH9"H81OIEHD$XD$8D$` xH>"EA?2HHUH5~H9"H81DE_E9DSHn>"E1|$ : AGd:HHUH5}~T$`H5E"HcHT$XH=Ht$ HT5H5E"H$D`DCHt$D$`1+D$8Ll$(Dt$@D|$"H=j?"H 1҃͹At$0H=I?"H }I11螴H=/?"1Ҿ ˷H=?"HgH[]A\A]A^H,"HT$LH8ٲH[]A\A]A^H5ATUISHr,"H1Ҿ H;5="H;H }M1ҍF="1۳H;1Ҿ HH;H5|[]A\1鄵@USH~H+"="E11ɾH;="H;uE1H>"ϱH="f="MY="H;E1p)5="裱H=":="E1-="H;H}H="=")H=="D@QH;HW="HtW1 H;H;JH<"1 HHH{H<"H{H<"H{H<"~H{H<"H{H<"H[]@AWAVAUATEUSHHEs)DA$1A1AǍAAE)E)L1Ҿ HMt1|HH׭I9u1Ҿ H1Ҿ H褶Mt1D|HH藭L9u1Ҿ H裴Mt1@ HHgL9u] HUEHSD#DBDHMt > HH,)"DH8H[]A\A]A^A_֬t0A$E1E1[ H訬H[]A\A]A^A_1Ҿ Hr1Ҿ H蓳1Ҿ HT1Ҿ HuA$f.>AUATIUSHH1ҾL]t4$IHL]tIEHDpt1ҾL1Ҿ L觴]t2ʮIDHL蔫]tIEHDpu1Ҿ L莲}DH[]A\A]USHHHHމ1H^H[]USH-"t'H=q9"HtH=`9"s蹫11H=9","trHHH)HHg9"8Wv%H5wQHJ9"<肪HH89"Hx(OH(9"H|>EH; 9"HrH=8"#H=8"H=(8" H=8"8"t H[]fDH&"H=YwH رH7"HtH;H5Fz1H7"HtH;H51w1x7"uH3H []QH;H5 w1ϱf.USHH8[Ht4H1 DHx:7HutMHH[]]HHtLH}貫HHHԫHH[]f.H:ӭHH[]1H1蘫fDATUHS4HtG1ۀ}[HIHxH<1H?:uH!LHFH[]A\fD1@AUATIUSIH+LH :LH Ht[HHʮHHtjL H uHHzuMAUHH1藧XZHH[]A\A]HHoHHtL eL1@AWAVAUATUSHHH$HHD$CHII%1ҾtA9Ll$01 HLH1fGH|$2fT$0l߭H5t1HHƄ$nLDSH{H9t;E1HH5Yt~H5}YMIEL8HCMtLWH{1D#y;HL$ AHD$ HD$(;1HĨ[]A\A]A^A_1H覭Ld$01LHHD$8D$0tHHD$HHIC+Lt$H5esHH1LHL$LLL|Lt$MAV AvA~襪AxfH5r1HHJAVIvDʩL H|$HtH{H9HLt$bXH=WMv(MiH\$L貧HH葧~H=Wr贬D蜤f.Lt$H jWH53r1HLpHL$H5JWLLIzH )WHT$H5hIH1*f.fDH=qDf.H=VL躦븉LH5Eum&fDUSHHHt H[]@H5RqHH{(XHC(H( tHHuH5,qHHC(H f.0"S0"+H?tH{H@x"0"[H5s:蕨8HSH5pHH1H5sUSHHH fHX;H.tH[]fAUATIUSH?HfDHMuhHtcA}HH跣H~rH¾ HHOHIt HH)HA}1HH|HuL@EH[]A\A]@H1[]A\A]k8ĥIUH5oHL1|A}H5n,A}cAEH1[]A\A]@f.AWAVAUATIUSHHxT$ W*HGHI|$(H- HI L(HE LHfHLmEBDhtI9E  <-u Ht<-tHUEI9uL BLjLƒ-k u b tHEƒ-uIM)I裡HHC LLH踨/B8HHHh/HܤHIhMI)I}AHHC' LHHVB(A?AIHkH5mHUHD-e-"A=vHkHCAUH9vDH|$PLsP1Lt$`@HT$XI+T$ fHD$PI+D$Ƅ$`CtCpH*HT$XųClC|HD$PD$f(f^ {pH*XH,ȉ S\k<)k%mHL$@HT$8LD$HH5`j1HwD$L$8T$@D$HKlSpCtQD$ Ll$H$1LLU-|$` "HL L肠HtH5iHL1iuH*"H=)"HH4@H)"H>HH)"H)"LHRL|ƝIH)"H)"HRHTH:{D$H4$BH)"HRt1T$lYf.l@H,HL$ WlYf.SlH,H1lYD$(f.+lH,H lYD$0f.lFH,HkYD$8f.kH,HkYD$@f.kH,HD$HkYf.ksSH,HXXHkH{ H1HCHCHHH)8H\*kH,HHH1\kH,HHH1@\jH,HHH1\jH,HHH1\jH,HHH1J\[jH,HHH1\1jH,HHH1i iYD$@f.H,HiYD$Hf.sBH,HHǃcIE1T$@D$HK`SdCh\H,HHH1\H,HHH1aCXfHPL|̘H????@HC覘HXH5^hHCJoH5@hZYE1IHտE1HLH5hHCbH5gjH5giH5glH5gHCDATUISHHtsH=dHtYH軘HHID$(tRH1fH9sH: u Il$(H辘@1H[]A\øH5gfDAUATE1USHAH1jgHAYAZ4H5ibHHD@ ERH5qdHܸx  H5CH¸p t ""H#"HM@H#"H#"H#"H~#"HC1H97PH<HuHT#"1H=\.H=]"H=;]H=_] H=]H=]L-#"LHH""8LHH""RE16@HHAH)H5""Df05yL-""DL9sHHuHE@H<@HзH舖 iH5XH[]A\A]H5h?HHXP1jE1ɹ1AHJHIZYLH5EHݶx u|H5ELȶx HH5ELL-ya襶x tLhHKHiaH1葒HLvHL۶Hh!"HxRHHuH"H=ZHjH5dH5cAH"H=Z#HH5c#H=YH1RH1"詒H H=VH1H= WUH=NWI 迒H=hW3 詒H=WH=WH=WH=6XH=rXH=X W1"H "H=U(HH5b`Hi "H5XHH81%H5nb /H5Xb;H5Bb9G +F HHuHGH+FfH "HH0Δ@f.AWAVIAUATIUSAHLHAL|$PvV@uZ1APv1H[]A\A]A^A_1ɃMHL[H1]A\A]A^A_AfufHLL $–L $.E%=@=|=DfHL $L$ RL $tNEL$ %=tnxtm=@uAtpt{11AMLAх1DteAqDfH=)"@f.H=Y"SIH H$( H$0 H$8 L$@ L$H t@)$P )$` )$p )$ )$ )$ )$ )$ HLibClamAH\$ HL$LҾH{HD$ HV WarninD$2 HD$(g:D$fD$0H$ D$ 0HD$H$ HD$藒H"Ƅ$ LQ"HtHHxHSH޿@AH [1ff.SIH H$( H$0 H$8 L$@ L$H t@)$P )$` )$p )$ )$ )$ )$ )$ HLibClamAH\$ HL$LҾH{HD$ HV Error:D$0 HD$(H$ D$D$ 0HD$H$ HD$qH"Ƅ$ L+"Ht&HHxHSH޿AH [f.1ff.USHH H$0 H$8 L$@ L$H t@)$P )$` )$p )$ )$ )$ )$ )$ HLibClamAH\$ HL$HH{HD$ HV info: D$HD$(H$ D$ 0HD$H$ HD$MHƄ$ H "t!HMxHSH޿ H []D1@SIH H$( H$0 H$8 L$@ L$H t@)$P )$` )$p )$ )$ )$ )$ )$ HLibClamAHL$H|$1LҾH\$ HD$ HV debug:D$0 HD$(H$ D$D$ 0HD$H$ HD$0HY"HƄ$ H06H [f.HGSHH=_ wHt[@HH=n[11[H=^H=[H1^1[f.HFSH=_ w+HGH=_ wHHH` wHt[HH=[11[H=U^H=[H11[ÐHFSHH=_ wːHt[@H=[11[H=^貐H=\H11[f.HFATUSHH=_ wIeHHt-H[]A\DH=[11@H[]A\H=]4H=-\1HMtL@HSt:H袊Ht[H=]]HNJH=`\11[H=\11[@f.USHHv$Hx;HtYH[]f.H=\12HHfb[]@HH5\HRH*D+HH[] CHH[]H=\H`H 9HHDHf.USHHHHHH豍D+HH[]fAUATAUSAHHfD)HHŅtmHDȇtDy=8tH満yH=\H1HHĈ[]A\A]DHĈD)[]A\A]DHĈD[]A\A]AUATAUSAHHfD)HHŅtUHD8y菋8tH満H=|[H1HĈ[]A\A]HĈD[]A\A]Df.ATU1SH1萉t}ź1AHuAtX sHHuUfHD HމDHȇ[D]A\Մ΄[]A\É轄D资AWAVIAUATUSHHL$t$T$\LD$M腇HH~4HD$0HD$lE1HD$(HD$@HD$hHD$HHD$pHD$8D$D$X@HHI4A}.D$hAE<<< D$bD$lL訆IUHHHT$ 蔆H|HHHT$ 1A?//A$H5dYH1MtHt$HAփHHt$LL$(LD$PHL$XHT$Ht$$AXAYD$lHޅHD$0HۋHIHD$0H L|$(1MH (LLMDl$\L1MA.fDH}HtJE1HH(I9pLD$HL$Mt$DHAƋE tH}AE<. A}|$hE1Ʌt t$X)IH|$(LL$PKHHHT$ HHD$(HT$ LL$PHD$(1HDHT$lLHHEH HXIUHPHD$09fH5>WHHL1蹄@u4D$l_D$lKD$l;D$l+LD$L11HD$H[]A\A]A^A_ÐH蘃HIUHt$8IyHHIH$ILH)H)HD11LD$LHD$Ѕ`DLkM9v3HL$(HHH{(IH(߂H{ւM9wH|$(ǂ DLHD$0Ht$p8H={THL111LD$LHD$ЅHD$(HtE1MHzH;IH(8H{/M9uTL$hHLD$HHD$HE|$81HAE4H߁"1T$hH|$8LL$ LD$HHD1HD$H衁LL$ ML苁fDHȋO tHHf.H71HHfAWAVIAUATIUSMLHT$ D$D$uMtgAtMAWtDH.HHD$HHH5!H6!Lt$ L|$PI^HD$ HT$(fDHCI9uH\$H=)E1L0H[HD$HT$!H!H!THItcL{IDH5QL1HI~L9uHt$HcQMLH1{L+~HXH[]A\A]A^A_H~H "8u1HX[]A\A]A^A_IH=O1L61fUSHHHoHHHt1~‰E1t H[]s8~H3H=OH1H;`}HH []f.IH=gPHuHHL>USHH(H1҅u$1E11HH1 kH~H([]AWAVHcAUATHUSHIHXHD$(HRH|$Ht$0T$HHD$HHD$$H u 1H$H|$0 HD$0H\$HHHHL$ -H\$H<$wH|$I4$HH7I$HD$ID$HIHD$@HD$8LIMM9HHOHt$LӃPLt$ MIH\$?fHLAԅx>u" $nIIIII)D$I)M9MuA+yM9LMLt$ w3$IEIIMII)D$IM9MBHLINjD$?HD$0HT$MHLHD$8I)H)L9IO…lHcLHH)<$L :@HHI9NPuLML)I)H)L9IGHc~-HLH)HI@AIHM9ANPuIcH9LIcH9,1I)HLD$HD$0fD<$Hct$LL9HHHH@xQcDD$LMMLt$ H\$0HH\$H9\$@LD,$IH$HH\$@H9\$HshL)LIHIHH9fDLHӅ~9EH8IHUIHEM)L)H9|$sHMuŋEA+MHL|$@HD$@H;$uHX[]A\A]A^A_f.Ht$(LLDHH9HHHHHxHQB@<$HcL$Lt|f.A0HIHHAvPP@H|$AE+=4$H|$8IMHHIEHl$8D$ HL$(fIH0HIHHIvHPH|$0HT$HHHHHH(HIHMD4 HHcIH|$McIHHILAׅLLAׅLl$LLAׅMHMHD$LM4HHD$ LHD$HAׅ`LLAׅLd$LLAׅMIHD$ L4LLHD$HAׅ5HLAׅLt$HLAׅLILLAׅLLAׅLLA׋<$MIM<$Hct$HD$fDA $HHIHHAT$\LML)I)H)L9IGHcHcLH)Ѓ<$Hf.IH0HIHHIvHHIcH91H|$LHHLD$L $H$LD$L $<$HcL$HD$8IfA6HHIH@pAVKMILl$LL$A4$IڋA99f)ƅ39MIM%AׅLLAׅMIMHHHDHHHHHHHOHPLML)I)H)L9IGхHcLH)HLAׅLt$HLAׅLHH|$HcLcL A9MA29>AA)EHIA4$IOA9M4AAA)EINM)E.AA9AA)EEDA)MILI999MIMLLAׅLd$LLAׅMHAׅALl$LLAׅMIM%Ht$(HI $HHIHHHIT$cHL$(HI6HHIHHpIV9AA)LIT$IMAHcT$Ht0f.A $0HIHHAt$HHT$(DI $H0HIHHIt$HHhLd$0HD$LH(II9Ld$~D,$H$LL<$L9|$shMHI)LILI:f.HHAօ~4EHu[HEHHUHL)L)H9|$sMIuȋ+ELLH,$H$H9D$zHX[]A\A]A^A_AHcT$Ht%fA $0HIHHAt$HHT$(I $H0HIHHIt$HHM9A9xRDMMA9)IMIډM)IMI։M9xMILL$AWAVHcAUATHUSHIHhHD$8HRH|$ Ht$@LD$HT$,HD$XHD$ D$H u 1HD$H|$@ HD$@H\$ IILHN4XILl$X|$H\$ IHHIHD$ MD$HHHD$PHD$HLMIL9IMwHT$ HH|$AՃpLLd$0MLd$ INfLLH|$AօxCu%L$xIIUIIEI)D$I)L9MuAA+$yLL9MLd$0Iw2T$HIHII)D$HL9I&LMINjD$FHD$@H|$ HHL HD$HH)H)H9HOƅHcHH)Ѓ|$Lf.HHI9OPuLML)M)H)L9IG…Hc~/HLH)HH@A$IHL9AL$PuHcH9|IcH901I)HLL$ HD$@{@|$Hct$,LLf:HHHH@xJ[DLMMINjD$Ld$0H\$@HH\$ H9\$PLDd$IH\$HH\$PH9\$ skIHL)LMIH<@HLH|$Ӆ~9EMHEIHUIL)M)L9T$ sHIuA+EMHL|$PHD$PH;D$tHh[]A\A]A^A_@Ht$8LLDHH:HHHHHxHJ:@|$HcT$,L|DA $0HIHHAt$HJf.H|$ +3t$H|$HHHHHHl$HD$HT$8@I $H0HIHHIt$HHH\$@H|$ HHHH(L,HHIDMmC$McHJ'HcHHH|$HD$AׅHHt$H|$&AׅHHt$ H|$AׅHH\$ H\$K&ILLd$0MH|$LAׅHLH|$AׅHLH|$MAׅLIHD$0H|$I\L$HLAׅlLHH|$AׅLLH|$LAׅIILHt$H|$ALd$HLLAׅMLt$LHLA׋|$LI6|$HcT$,HD$ +A6HHIH@pANLML)M)H)L9IG…HcHcLH)Ѓ|$Hf.I $H8HIHHI|$HHHcH91LD$H|$ HLHLL$LT$HLL$LT$N|$HcT$,HD$HmA4$HHIH@pAL$HD$ MLHD$kH|$ AMAE79q)…9IIIAׅLt$HLLAׅLHHHLHHHHLGHHLML)M)H)L9IG҅HHcLH)LHH|$AׅLLH|$LAׅIHH\$ IcEH< Ic܋7LA9NAA)ELIAIOA9M$AA $A)EMOT I)A$A9AMAA)EAډA)MIMI99W9LIMIHLH|$AׅhHLH|$AׅIIILAׅHHt$ H|$AׅHI\$ H\$HT$8HI6HHIHHpINHT$8HI4$HHIHHpIL$9lj)LHI|$ IAHcT$,Lt'fAM0HIHHAuHNHT$8fDIMH0HIHHIuHHLd$@HD$ LH(II9Ld$5LDl$IH\$HH\$H9\$ seIHL)LMIH6fHLH|$Ӆ~5EMuWHEIHUIL)M)L9T$ sHIuA+EMHL|$HD$H9D$zHh[]A\A]A^A_AHcT$,Lt%fA $0HIHHAt$HHT$8I $H0HIHHIt$HHQAM99xUMMA 9AA)IMIډMAA)IMIԉM9xLMH|$ f.DAWAVAUATIUSHL/HOI9s)LfDx9tPI$HHBH9rI$uAD$u AD$Hi!I$ID$1H[]A\A]A^A_8]uH9sH-!HL)Ht:L5!Lcf.LLHbuB|=t,II.Huڃt/AT$pAD$bAFH[]A\A]A^A_AEVff.USHcHhtOgHH[]Ðt4cHH[]fDHLcH Lc@LP1IMt fDNH (F HI9uKD H9t f.Hh HH H%H Hf.ATLgUSHHI9vRc11%fHH4H]SL9TrtDH0BDFu΅~[]A\1fEuE HS!HEHE[]A\ff.HHWH9r$OH!H !HGHHHH9v8[ux.uHS.HHHHKH9sHrH9v :.t=DSuCH5!H3Hs[f.Gk@z]uHH[ÐH9w | fUSHHH4HHHtHCHk H[]CuC H!HHCf.AUATUSHH)Lo(t6HHHw HIhHCHK(JH4H,iDHLIMgL9s,8}Lpu8IA~} M9M7uAGuAG fH!I_(IIGIIIW(HپHLH)HEGEM7MgIO(M9sAPրv<A)S;A.qA[A(IG8H@hIG8L`hI  IG(KD@EOEOIIWH9s$HHH9v 8\)\LI  IG(KEGEIIOH9vLHPH9vC8\qAu2Mw(AGH!IIGH1A$L@1Mw(EoHIEGIG8H@IG8@DMw(IIOLeA{ADD`HIHHAOMcFHLHKAGIG8@dIIODH9s%*HpH9v \IIOMw(DID(A\EgEuAGH!IGHHBIDAEA)AwtwDIW(HLIHLL)H6IW(EOL)EHLXLEGMw(E]IIOL11f.A*u#uEWEuAG H!IIGALKIIOH;L$ t(AWMNMO(IG8H@IG8@HI_(H9\$HH[]A\A]A^A_@IG8@$E_Ez1Ҿ(LIIOf.LIIO@EWEAG fDA}Awf.L`LH)Mw(I1IO1LvfDPLIW(L)5E_EuAGHp!IIG@x{IHLIoM'IGI9s A<$,LLIIOH9rcAwuAG I_(H9\$H!IIGXAGuAGH!IIGHH[]A\A]A^A_fDHPH9v 8\H9tz\tIHHH9uIl@:}uH9ZAO^AG QfIT$H9IL$@AT$HL$DPL19ÉAuAG H!IIG@HD$ M'LIOD$<^D$= D$>]IHD$(HL$D$?IG'HL$M'LIO[LpLIIOH96HPH9)fDLhLL@LL8LHD$cHD$Hfx}PMw(H1I1Lx)ERx)HI{1Ҿ L1ҾLf.AWAVAUATAUSAHtO AIHuUHS>Iǿ覱HHŹ tH L$ I9v.H>L$ H[]A\A]A^A_LI9rI)LHH|@H|$0螱HHD$(HD$8tLt$MHl$HLt$Lt$D$ D$@IF@IfHH@PHH9uHHHEHEHExHHEP)HDžpEx1E Dm$E@EDEHHEXE`HEhELHEdDD$ EHT$8AHBHE0AWLD$ HT$8HHRHU8HE(HD$8H|$(H4虰HHET$ HEE1E1E1AHpHHLQHHXtXHp!Hxt1LIIfDHB<u9uAAI됋ELAEЍPAĉULACtjMِA9uJM HEALcmQH~(088u"1fDD<8D8<0u L9uE!AIAupHD$8I9_({ HD$@$~fDID4I%IKHH9ufHD$HHPH9\$"H2H{B HCIG H9SI9_( H94sHp@_I9_(43HpHfI9_(; rfH=pMaH=xH=hIAHI+T$IHHLID$LMLMH(HD$xPLL$0HT$H^_ID$J,0{ HL$A$fAGAGAGI9_({ HL$A$DAGHD$@$@AHO|Ll$A/HDIO%IDH4LxL9LEHMLD$xHLPLL$0yHAXAYI$JH0J%H9uf.ID$8HL$ HH9YHHAD$xLML)HLPLt$0HT$MHAZA[:LMHHD$ @HD$ IT$8MHHHD$ AHI+T$IHLLID$MHLMHhHPD$xPLL$0HT$fHZYID$Jl01f.L\$HMD$xLHLPLL$0HT$HA^Z]L\$AO4;D$pdP6H9\$&fDHl$ MHD$H9Df.AWAVIAUATMUSIHH8HT$LL$ M9 M<$IL|$MIWf.H=DH= RH=(H9\$HIM9KJ4H%H=0SvH9 H9oH9I9_(vU3@ @t$/T$H8Wu0_t+I9_ s%/sHpHL_C1H8[]A\A]A^A_H=`LMM~NLL%H=X'AH=HH=P H=8uEAIcHID$L@ImHI)HT$L\$(HL$L)H9FID$LHLD$H>2&T$pL\$(HL$LD$A@IcI9t@J9MuMLÉT$pH=H9\$8HCHDI9_ >I9_({ HD$@$~fDID4I%IKHH9ufHD$HHPH9\$"H2H{B HCIG H9SI9_( H9k-sHp@_I9_(A-3HpHfI9_(; rfH=pMaH=xH=hIAHI+T$IHHLID$LMLMH(HD$xPLL$0HT$H^_ID$J,0{ HL$A$fAGAGAGI9_({ HL$A$DAGHD$@$@AHO|Ll$A/HDIO%IDH4LxL9LEHMLD$xHLPLL$0yHAXAYI$JH0J%H9uf.ID$8HL$ HH9YHHAD$xLML)HLPLt$0HT$MHAZA[:LMHHD$ @HD$ IT$8MHHHD$ AHI+T$IHLLID$MHLMHhHPD$xPLL$0HT$fHZYID$Jl01f.L\$HMD$xLHLPLL$0HT$HA^Z]L\$AO4;D$pdP6H9\$&fDHl$ MHD$H9Df.AWAAVAUATUSHˉHD$8IH9ALAHL$DɽAL$A~L$M4H LHX?H0t_QHtH H(uA~Tf.HMH9u[]A\A]A^A_fAAL|$ILHH9Bf.|$%HrA0HI8@f.AWAVIAUATMUSHHHHGhH;w HT$(HL$ H_PHD$HG`HD$8FD$HE1HHP(HD$ HAILH}HSHwAZL;}(A[HD$HD$|$ E7|$1E1A H}AtK~IDt$0LD$Lt$ H}HHwEAPLLI_AYuDt$0H}HD$At8|$H|$0L$HH|$0B_t_fuZAt*H|$0WHAH|$0Q!A_\$؃t0H|$0"HH|$0Bf|$_ A${/Ld$HL$H_(Ht$C<,LHIEHL$?L;|$(HLLLd$8ILRHEHt$HHP(=H}HESHT$0MLHwL;}(HD$XZDt$|$ A fDH}G$E1A AtEj1AAt%AABA_AHHwLLD$EAPHT$0H}HD$Y^DEcH}A _DA_G$bAAEAĂ_HAE+@AHD$HH[]A\A]A^A_D$]@AWAVAUATIUSH8L9LD$HIIHEHJHD$JHƁHXHxHHLt$H|$HHH_]HhHXLt IUILLH;LD$HLHHI"I9uLD$ILLLHHLD$LLLHIMH;\$H8L[]A\A]A^A_ÐLD%HHHH9uHLIUILLH{LD$HLHHIbI9uIFH|$H\$HHEHHH8%Mt6fHEI^IHJ%IJIV%H9LDMHLLHI9uHMH\$HJ<2H|$&fH(tH0tHt IDII@%LH+UHHEIH{fHp%LH+UHHEIHPELIUILLHLD$HLHHII9uIFH\$ ML|$(H\$MHD$IH MIHLILLHI9tHLH\$ ML|$(t9LD$HL$HxIMwHxLMAWAVAAUATUSH?etHD[]A\A]A^A_@HGxEHD$uՋ@@AljD$AtAHD$DIIIHx(@vNHD$@$LEAHHHD$HHAHD$8HL$8H9L$IAT@$LEAHHHD$HHAHD$8HL$8H9L$wHD$L@XMHD$HH9{A\$LLd$ Ll$(HIAIL9 E8,$uHL$HL)HcQ`H9|HLuL\$Ld$ Ll$(H9l$8HD$H|$8Ll$hL$HD$pD$Hp8HH0H$$L$HDŽ$HHHD$HL$HHDŽ$HH$HDŽ$H$HDŽ$IHDŽ$HDŽ$IH|$@HL\$xIHD$PH$D$IIHD$`ID$HLALLHD$8L$HMAP[]IHD$($HD$ D$X$@HD$HL$@H9D(L9D$(HD$ HDD$|$ HD$ 11|$A %A@t>~1LLuHUDHD$HtL1H8[]A\A]A^A_H|$uH|$@Ht$HT$,LtLHL$HtYD$,HD$H8[]A\A]A^A_fDHcXHHHD$orHIH1QHD$Gf.AWAVIAUATAUSHHAH9HT$DADl$HLHHtIcHIufHHHtFLHDPHHT$ LHtCMtD$ AHLfDHL1HĨ[]A\A]A^A_L|Ht1AUATAUSHIHHtcHHHtSHǾ1HHt-LDHHHHH[]A\A]fDHH1[]A\A]USHHHHHH[]Lff.IHHHH=sHIHHHH=N(AWAVIAUATHUSIAMHHH HHt}HHHHD$1HHtHHT$LHt4HLDLHuH[]A\A]A^A_@HܐAWAVIAUATDUSAHHHT$1HHHHIHRLc*HHHǾ1LHtPLHH"t>Ht$HLDAHuAHHD[]A\A]A^A_fHAHHAAHAAWAVIAUATMUSIHH(|$`8HL$1LALL$L)HILL$E11LLHߋl$HI0HPHILHHD$HHHǾ1LHjHT$LHLLHjuD$`LHX+LnT$`tL^H6fDH([]A\A]A^A_f.E11LLHHItHMHILLLfDLCLt$`dfLL$`tLH߽k;fDAVAUMATUISHAHt2HHMDLHH߉[]A\A]A^fDfAWAVMAUATIUSH5ƢIAHHtU111HHDHHHt@MDLLH@HfH[]A\A]A^A_Df.AVAUEATUISHAHt2HHEDLHH߉[]A\A]A^fDfAWAVEAUATIUSH5ơIAHHtU111HHDHHHt@EDLLH@HfH[]A\A]A^A_Df.AWAVMAUATAUSHIMHHtIHHLD$HHMMDHPH߉lXZH[]A\A]A^A_ffAWAVMAUATAUSIMHHt$H5Ht`111HHHHHtKHLMD$XMDHPHt$ H߉3XZH[]A\A]A^A_øTf.AWAVIAUATIUSHEH(HT$lHIHHLHcHHH1LHtLHt$HcHtpHT$LHH-tYEu$T$AHeH(H[]A\A]A^A_t$H$HIHtTLLY‰D$뱐H8HH(1[]A\A]A^A_Df.AWAVEAUATIUSH5IIHHtU111HHHHHtAELLLH`HHHH[]A\A]A^A_1@s1Df.AVAUEATUHSIHIHHT$ Ht6HHELHLHH$HH[]A\A]A^@1ff.ATUISHHHDD$ 5DD$ HLHHމ[]A\XUSH5tHHt1111HHHHHHtxHH[]fD1@[1USHHt0H111HHHHH[]f.1ff.USHH"HJHt]HlHHHu'111H)HH^HH[]@HHH1[]1@HATUSHPLgMt=HL{H v,86HHtEttqH9HP1[]A\fDAD$<0tnH5AD$HLHt18Ht$H|$HD$$D$0C HPH[]A\ÐAD$<0t.H5AD$DAD$0AD$9H5AD$0AD$9H5q1f.HtsUSH5HIHHtI111HHH(Ht+HHx HtbxHH[]@HXH1[]1DAWAVIAUATIUSHHH1HI9LHHHML!HIHLzHIHLLHHHuHHSHtsE1HuLMtLUMt$LH[]A\A]A^A_L|H[]A\A]A^A_LH HtE11ҹHdoHHiLkHHtv1HHLSHtlHAMtLMtLLH1EH[]A\A]A^A_E1E1H{LMtL&MtLHqLOLf.AWAVAUATUSH(H|$Ht$IĸM7HD$1E1@LXHx.tHXH59HtL}LJ4.HIH|$HII|HL$ID HHHL$HT$H5мHH1LMHLHXLL$LLHHtQHT$JD 1HeHAtDHH<;HuH.DH([]A\A]A^A_HtfHI<HuLHt$f.HIHcAAtM|@u%IAw@t H'HuHcM<At{E9uMdAfDIAt$A@t HHtA9t>A)A}HcTHHtGIcLHH+HH[]A\A]A^A_1H[]A\A]A^A_I11m1H=&1gP1DEAWAVAAUATIUSHHHL$1E1f.AHHt=HcAAtM|@u$fDIAw@t HHuHcM<EEtkE9uMlAA@IAuA@t HHtA9t0Lt$A)LIcHL[AHL[]A\A]A^A_H1[]A\A]A^A_I111AWAVAUATUSH(A9A}H9D DzE1ҍAHHD$HBE8AE1HD$AE8A)1AA fDD9wCD:|uLlE:Mt!DD9vE1H(L[]A\A]A^A_@HT$H|$HtDL$DT$DT$DL$u뻐2H([]A\A]A^A_HuIHHt%HuHHVHO҈QuHHH=1M1AUATUSHHtaHID1H9Hxt6HDI|HuH9HvfDHH9IDuHH[]A\A]1ff.AWAVAUATAUSH(HM[HRLD$L$Ht$H<$I=H<$L Ht$L$LD$IIHADT HtII9IADT HuI9҃-?+$?0>.A D$HE81II9gE115A0A9@ukI9wfI9uiD9ڽ}_II9tnMC\ut[ffۃ 7A)A"fDH([]A\A]A^A_@뢐MMc۽Mt$tIڅtL9tEt I9sA9uM1fII9s$LcH<$HT$:ItHLCH<$DpHt7MLBDHLt&MTBDPMtHT$MBDPu LLɲ@AEA A fA J /Cf tPfvTf=wUf?ȀAIHtH=)12EH1[]A\A]A^A_ˈf ƒ?fȀ?AʀQfDHxAWAVIAUATIUSIE1HIEI]@,IM9GC,7@\tT@DIMIEHYH9vHI}H9HBÉH}HHIMI]IEHYfINI9vCt7FLD$H$AxtADDE1HH=[]A\A]A^A_:DH=1LD$H$cALD$H$E1 PCREMatchLimit are superfluous. WARNING: setting this limit too high may severely impact performance.This option sets the maximum filesize for which PCRE subsigs will be executed. Files exceeding this limit will not have PCRE subsigs executed unless a subsig is encompassed to a smaller buffer. Negative values are not allowed. Setting this value to zero disables the limit. WARNING: setting this limit too high or disabling it may severely impact performance.This option enables on-access scanning (Linux only)This option specifies a directory or mount point which should be scanned on access. The mount point specified, or the mount point containing the specified directory will be watched, but only notifications will occur. If any directories are specified, this option will preempt the DDD system. It can also be used multiple times.This option specifies a directory (including all files and directories inside it), which should be scanned on access. This option can be used multiple times.This option allows excluding directories from on-access scanning. It can be used multiple times. Only works with DDD system.Use this option to whitelist the root UID (0) and allow any processes run under root to access all watched files without triggering scans.With this option you can whitelist specific UIDs. Processes with these UIDs will be able to access all files. This option can be used multiple times (one per line). Using a value of 0 on any line will disable this option entirely. To whitelist the root UID please enable the OnAccessExcludeRootUID option.Files larger than this value will not be scanned in on access.This option toggles the dynamic directory determination system for on-access scanning (Linux only).This option changes fanotify behavior to prevent access attempts on malicious files instead of simply notifying the user (On Access scan only).Enables extra scanning and notification after catching certain inotify events. Only works with the DDD system enabled.When started by root freshclam will drop privileges and switch to the user defined in this option.This option defined how many times daily freshclam should check for a database update.Use DNS to verify the virus database version. Freshclam uses DNS TXT records to verify the versions of the database and software itself. With this directive you can change the database verification domain. WARNING: Please don't change it unless you're configuring freshclam to use your own database verification domain.DatabaseMirror specifies to which mirror(s) freshclam should connect. You should have at least two entries: db.XY.clamav.net (or db.XY.ipv6.clamav.net for IPv6) and database.clamav.net (in this order). Please replace XY with your country code (see https://www.iana.org/domains/root/db). database.clamav.net is a round-robin record which points to our most reliable mirrors. It's used as a fall back in case db.XY.clamav.net is not working.db.XY.clamav.net database.clamav.netThis option allows you to easily point freshclam to private mirrors. If PrivateMirror is set, freshclam does not attempt to use DNS to determine whether its databases are out-of-date, instead it will use the If-Modified-Since request or directly check the headers of the remote database files. For each database, freshclam first attempts to download the CLD file. If that fails, it tries to download the CVD file. This option overrides DatabaseMirror, DNSDatabaseInfo and Scripted Updates. It can be used multiple times to provide fall-back mirrors.mirror1.mynetwork.com mirror2.mynetwork.comThis option defines how many attempts freshclam should make before giving up.With this option you can control scripted updates. It's highly recommended to keep them enabled.With this option enabled, freshclam will attempt to load new databases into memory to make sure they are properly handled by libclamav before replacing the old ones.By default freshclam will keep the local databases (.cld) uncompressed to make their handling faster. With this option you can enable the compression. The change will take effect with the next database update.Download an additional 3rd party signature database distributed through the ClamAV mirrors. This option can be used multiple times.With this option you can provide custom sources (http:// or file://) for database files. This option can be used multiple times.http://myserver.com/mysigs.ndb file:///mnt/nfs/local.hdbIf you're behind a proxy, please enter its address here.A user name for the HTTP proxy authentication.A password for the HTTP proxy authentication.If your servers are behind a firewall/proxy which does a User-Agent filtering you can use this option to force the use of a different User-Agent header.Send the RELOAD command to clamd after a successful update.Run a command after a successful database update.Run a command when a database update error occurs.Run a command when freshclam reports an outdated version. In the command string %v will be replaced with the new version number.With this option you can provide a client address for the database downloading. Useful for multi-homed systems.Timeout in seconds when connecting to database server.Timeout in seconds when reading from database server.This option enables support for Google Safe Browsing. When activated for the first time, freshclam will download a new database file (safebrowsing.cvd) which will be automatically loaded by clamd and clamscan during the next reload, provided that the heuristic phishing detection is turned on. This database includes information about websites that may be phishing sites or possible sources of malware. When using this option, it's mandatory to run freshclam at least every 30 minutes. Freshclam uses the ClamAV's mirror infrastructure to distribute the database and its updates but all the contents are provided under Google's terms of use. See https://transparencyreport.google.com/safe-browsing/overview and https://www.clamav.net/documents/safebrowsing for more information.This option enables downloading of bytecode.cvd, which includes additional detection mechanisms and improvements to the ClamAV engine.Disable authenticode certificate chain verification in PE files.Initialize a supplementary group access (the process must be started by root).Define the clamd socket to connect to for scanning. This option is mandatory! Syntax: ClamdSocket unix:path ClamdSocket tcp:host:port The first syntax specifies a local unix socket (needs an absolute path) e.g.: ClamdSocket unix:/var/run/clamd/clamd.socket The second syntax specifies a tcp local or remote tcp socket: the host can be a hostname or an ip address; the ":port" field is only required for IPv6 addresses, otherwise it defaults to 3310 ClamdSocket tcp:192.168.0.1 This option can be repeated several times with different sockets or even with the same socket: clamd servers will be selected in a round-robin fashion.Define the interface through which we communicate with sendmail. This option is mandatory! Possible formats are: [[unix|local]:]/path/to/file - to specify a unix domain socket; inet:port@[hostname|ip-address] - to specify an ipv4 socket; inet6:port@[hostname|ip-address] - to specify an ipv6 socket./tmp/clamav-milter.socket inet:7357Define the group ownership for the (unix) milter socket.Sets the permissions on the (unix) milter socket to the specified mode.Messages originating from these hosts/networks will not be scanned This option takes a host(name)/mask pair in CIRD notation and can be repeated several times. If "/mask" is omitted, a host is assumed. To specify a locally originated, non-smtp, email use the keyword "local".local 192.168.0.0/24 1111:2222:3333::/48^(Accept|Reject|Defer|Blackhole|Quarantine)$Action to be performed on clean messages (mostly useful for testing). The following actions are available: Accept: the message is accepted for delivery Reject: immediately refuse delivery (a 5xx error is returned to the peer) Defer: return a temporary failure message (4xx) to the peer Blackhole: like Accept but the message is sent to oblivion Quarantine: like Accept but message is quarantined instead of being deliveredAction to be performed on error conditions (this includes failure to allocate data structures, no scanners available, network timeouts, unknown scanner replies and the like. The following actions are available: Accept: the message is accepted for delivery; Reject: immediately refuse delivery (a 5xx error is returned to the peer); Defer: return a temporary failure message (4xx) to the peer.This option allows you to set a specific rejection reason for infected messages and it's therefore only useful together with "OnInfected Reject" The string "%v", if present, will be replaced with the virus name.If this option is set to "Replace" (or "Yes"), an "X-Virus-Scanned" and an "X-Virus-Status" headers will be attached to each processed message, possibly replacing existing headers. If it is set to Add, the X-Virus headers are added possibly on top of the existing ones. Note that while "Replace" can potentially break DKIM signatures, "Add" may confuse procmail and similar filters.When AddHeader is in use, this option allows you to set the reported hostname. This may be desirable in order to avoid leaking internal names. If unset the real machine name is used.Execute a command when an infected message is processed. The following parameters are passed to the invoked program in this order: virus name, queue id, sender, destination, subject, message id, message date. Note #1: this requires MTA macroes to be available (see LogInfected below) Note #2: the process is invoked in the context of clamav-milter Note #3: clamav-milter will wait for the process to exit. Be quick or fork to avoid unnecessary delays in email delivery/usr/local/bin/my_infected_message_handlerChroot to the specified directory. Chrooting is performed just after reading the config file and before dropping privileges.This option specifies a file which contains a list of basic POSIX regular expressions. Addresses (sent to or from - see below) matching these regexes will not be scanned. Optionally each line can start with the string "From:" or "To:" (note: no whitespace after the colon) indicating if it is, respectively, the sender or recipient that is to be whitelisted. If the field is missing, "To:" is assumed. Lines starting with #, : or ! are ignored.Messages from authenticated SMTP users matching this extended POSIX regular expression (egrep-like) will not be scanned. As an alternative, a file containing a plain (not regex) list of names (one per line) can be specified using the prefix "file:". e.g. SkipAuthenticated file:/etc/good_guys Note: this is the AUTH login name!SkipAuthenticated ^(tom|dick|henry)$This option allows you to tune what is logged when a message is infected. Possible values are Off (the default - nothing is logged), Basic (minimal info logged), Full (verbose info logged) Note: For this to work properly in sendmail, make sure the msg_id, mail_addr, rcpt_addr and i macroes are available in eom. In other words add a line like: Milter.macros.eom={msg_id}, {mail_addr}, {rcpt_addr}, i to your .cf file. Alternatively use the macro: define(`confMILTER_MACROS_EOM', `{msg_id}, {mail_addr}, {rcpt_addr}, i') Postfix should be working fine with the default settings.This option allows you to tune what is logged when no threat is found in a scanned message. See LogInfected for possible values and caveats. Useful in debugging but drastically increases the log size.This option affects the behaviour of LogInfected, LogClean and VirusAction when a message with multiple recipients is scanned: If SupportMultipleRecipients is off (the default) then one single log entry is generated for the message and, in case the message is determined to be malicious, the command indicated by VirusAction is executed just once. In both cases only the last recipient is reported. If SupportMultipleRecipients is on: then one line is logged for each recipient and the command indicated by VirusAction is also executed once for each recipient. Note: although it's probably a good idea to enable this option, the default value is currently set to off for legacy reasons.yesExampleERROR: Unknown option passed footrue^(yes|true|1|no|false|0)$config-file/etc/clamd.conf/etc/freshclam.conf/etc/clamav-milter.confdebuggen-jsondumpcertsquietleave-tempsno-warningsshow-progressstdoutdaemonno-dnslist-mirrorsupdate-dbreloadfdpassstreamallmatchdatabase/usr/share/clamavrecursivegen-mdbfollow-dir-symlinks^[0-9]+$follow-file-symlinksbellno-summaryfile-listinfectedsuppress-ok-resultscopyremoveexcludeexclude-dirinclude-dirstructured-ssn-formathex-dumpmd5sha1sha256impprint-certshtml-normaliseascii-normaliseutf16-decodebuildmax-bad-sigs3000flevelcvd-versionno-cdiffserverunpackunpack-currentinfolist-sigsfind-sigsdecode-sigstest-sigsvbavba-hexcomparerun-cdiffverify-cdiffhybriddefaultcolorsconfig-dir/etcnon-defaultgenerate-configforce-interpretertrust-bytecodeprintsrcPrint source code of bytecodeprintbcirinputtracebytecode trace levelno-trace-showsourcearchive-verbosebytecode-trust-allhttp-proxyproxy-userlog-verboseforcedisable-summarydisable-archiveno-archiveno-peno-elfno-ole2no-pdfno-htmlno-mailno-phishing-sigsno-phishing-scan-urlsno-algorithmicno-phishing-restrictedscanmax-ratiomax-space^[0-9]+[KM]?$unzipunrararjunzoolhajartartgzdebblock-maxPreludeEnableprelude-enableEnable preludePreludeAnalyzerNameprelude-analyzer-name/tmp/clamav.logLogFileUnlockLogFileMaxSizeLogTimeLog time with each message.LogCleanLogSyslogLogFacilityLOG_LOCAL6LOG_MAILLogVerboseEnable verbose logging.LogRotatelog-rotateExtendedDetectionInfoPidFile/var/run/clam.pidTemporaryDirectorytempdir/tmpDatabaseDirectorydatadir/var/lib/clamavOfficialDatabaseOnlyofficial-db-onlynoYaraRulesyara-rulesLocalSocket/tmp/clamd.socketLocalSocketGroupvirusgroupLocalSocketMode660FixStaleSocketTCPSocket3310TCPAddr127.0.0.1MaxConnectionQueueLength30StreamMaxLength25MStreamMinPort1024StreamMaxPort2048MaxThreads120CommandReadTimeoutSendBufTimeout200300MaxQueueIdleTimeout^/proc/ ^/sys/MaxDirectoryRecursionmax-dir-recursion15FollowDirectorySymlinksFollow directory symlinks.FollowFileSymlinksCrossFilesystemscross-fsSelfCheck600DisableCachedisable-cacheVirusEventExitOnOOMAllowAllMatchScanForegroundforegroundDon't fork into background.DebugLeaveTemporaryFilesUserBytecodeBytecodeSecurity^(TrustSigned|Paranoid)$TrustSignedBytecodeTimeoutbytecode-timeout5000BytecodeUnsignedbytecode-unsignedBytecodeModebytecode-modeAutoStatisticsstatisticsNoneDetectPUAdetect-puaExcludePUAexclude-puaNetTool PWToolIncludePUAinclude-puaSpy Scanner RATAlgorithmicDetectionalgorithmic-detectionScanPEscan-peScanELFscan-elfDetectBrokenExecutablesdetect-brokenScanMailscan-mailScanPartialMessagesPhishingSignaturesPhishingScanURLsPhishingAlwaysBlockCloakphishing-cloakphishing-sslPartitionIntersectionpartition-intersectionHeuristicScanPrecedenceheuristic-scan-precedenceStructuredDataDetectiondetect-structuredStructuredMinCreditCardCountstructured-cc-countStructuredMinSSNCountstructured-ssn-countStructuredSSNFormatNormalStructuredSSNFormatStrippedScanHTMLscan-htmlScanOLE2scan-ole2OLE2BlockMacrosblock-macrosScanPDFscan-pdfScanSWFscan-swfScanXMLDOCSscan-xmldocsScanHWP3scan-hwp3ScanArchivescan-archiveArchiveBlockEncryptedblock-encryptedForceToDiskforce-to-diskmax-scansize100Mmax-recursion16max-files10000MaxEmbeddedPEmax-embeddedpe10MMaxHTMLNormalizemax-htmlnormalizeMaxHTMLNoTagsmax-htmlnotags2MMaxScriptNormalizemax-scriptnormalizeMaxZipTypeRcgmax-ziptypercg1MMaxPartitionsmax-partitions128MaxIconsPEmax-iconspe100MaxRecHWP3max-rechwp3TimeLimittimelimitPCREMatchLimitpcre-match-limit100000PCRERecMatchLimitpcre-recmatch-limitPCREMaxFileSizepcre-max-filesizeOnAccessMountPath/ /home/userOnAccessIncludePathon-access-include/home /studentsOnAccessExcludePath/home/bofh /rootOnAccessExcludeRootUIDOnAccessExcludeUIDOnAccessMaxFileSizeOnAccessDisableDDDdisable-dddOnAccessPreventionOnAccessExtraScanningDevACOnlydev-ac-onlyDevACDepthdev-ac-depthDevPerformancedev-performanceDevLiblogdev-liblogUpdateLogFile/var/log/freshclam.logDatabaseOwnerCheckschecksDNSDatabaseInfocurrent.cvd.clamav.netDatabaseMirrorPrivateMirrorMaxAttemptsScriptedUpdatesTestDatabasesCompressLocalDatabaseExtraDatabasedbname1 dbname2DatabaseCustomURLHTTPProxyServeryour-proxyHTTPProxyPortHTTP proxy's port8080HTTPProxyUsernameusernameHTTPProxyPasswordHTTPUserAgentNotifyClamddaemon-notifyOnUpdateExecuteon-update-executecommandOnErrorExecuteon-error-executeOnOutdatedExecuteon-outdated-executeLocalIPAddresslocal-addressaaa.bbb.ccc.dddConnectTimeoutReceiveTimeoutSafeBrowsingDisableCertChecknocertsMailMaxRecursionArchiveMaxScanSizeArchiveMaxRecursionArchiveMaxFilesArchiveMaxCompressionRatioArchiveBlockMaxArchiveLimitMemoryUsageMailFollowURLsmail-follow-urlsClamukoScanOnAccessClamukoScannerCountClamukoScanOnOpenClamukoScanOnCloseClamukoScanOnExecClamukoIncludePathClamukoExcludePathClamukoExcludeUIDClamukoMaxFileSizeAllowSupplementaryGroupsClamdSockettcp:scanner.mydomain:7357MilterSocketMilterSocketGroupMilterSocketModeLocalNetOnCleanAcceptOnInfectedQuarantineOnFail^(Accept|Reject|Defer)$DeferRejectMsgMTA specificAddHeader^(No|Replace|Yes|Add)$ReplaceReportHostnamemy.mail.server.nameVirusActionChroot/newrootWhitelist/etc/whitelisted_addressesSkipAuthenticatedLogInfectedBasicSupportMultipleRecipientsPOSIXLY_CORRECT%s: illegal option -- %c %s: unrecognized option `%s' %s: option `%s' is ambiguous %s: option requires an argument -- %c %s: option `--%s' doesn't allow an argument %s: option `--%s' requires an argument 0.100.2/dev/nullCan't open /dev/null dup2(%d, %d) failed %s/ERROR: --file-list: Can't open file %s Invalid command-line argumentsUnable to connect to all clamdsFailed to reconnect to clamd after connection was lost # COMMAND QUEUEDSINCE FILE COMMAND QUEUEDSINCE FILENO CONNTIME LIV IDL QUEUE MAXQ MEM HOST ENGINE DBVER DBTIMECould not look up %s:%s, getaddrinfo returned: %s heap %lfM mmap %lfM used %lfM free %lfM releasable %lfM pools %u pools_used %lfM pools_total %lfM heap N/A mmap N/A used N/A free N/A releasable N/A pools %u pools_used %lfM pools_total %lfMERROR: Can't parse command line options Clam AntiVirus: Monitoring Tool %s By The ClamAV Team: https://www.clamav.net/about.html#credits (C) 2008-2018 Cisco Systems, Inc. clamdtop [-hVc] [host[:port] /path/to/clamd.socket ...] --help -h Show this help --version -V Show version --config-file=FILE -c FILE Read clamd's configuration files from FILE --defaultcolors -d Use default terminal colors host[:port] Connect to clamd on host at port (default 3310) /path/to/clamd.socket Connect to clamd over a local socketClam AntiVirus Monitoring Tool %s Can't parse clamd configuration file %s Can't strdup LocalSocket value Can't find how to connect to clamd __ ____ _____/ /___ _____ ___ ____/ / /_____ ____ / ___/ / __ `/ __ `__ \/ __ / __/ __ \/ __ \/ /__/ / /_/ / / / / / / /_/ / /_/ /_/ / /_/ /\___/_/\__,_/_/ /_/ /_/\__,_/\__/\____/ .___/ /_/Maximum number of items observed in queueTotal memory usage (if available)Which clamd, local means unix socketThreadpool used to receive commandsExecuting commands, or scanningWaiting for commands, will exit after idle_timeoutMaximum number of threads configured for this poolTasks queued for processing, but not yet picked up by a threadCommand this thread is executingHow long this task is executingWhich file it is processing (if applicable)Used/free memory reported by libcMemory usage reported by libclamav's pool%2u %02u:%02u:%02u %3u %3u %5u %5u %5s %-14s %-6s %5s %s%2u %02u:%02u:%02u N/A N/A N/A N/A N/A %-14s %-6s %5s %sheap %4luM mmap %4luM unused %3luMused %4luM free %4luM total %4luMcount %4u used %4luM total %4luM*** %u more task(s) not shown ***Out of memoryUser interruptUnknown%-15s %sH - helpQ - quitR - reset maximums^ - previous clamdv - next clamdnEND Abnormal program termination in %s at line %u[%s%s%s:%sConnecting to: %s connectLooking up: %s:%s nIDSESSION nVERSION nSESSION nVERSION Unable to reconnect to %s: %slocal%a %b %d %H:%M:%S %Y%lfMEMSTATSUNKNOWN COMMANDStatePRIMARY live %u idle %u max %uUNKNOWN COMMAND localhost%lldUnique clamd numberNOHow long it is connectedCONNTIMETotal number of live threadsLIVTotal number of idle threadsIDLNumber of items in queueQUEUEMAXQMEMHOSTEngine versionENGINEDatabase versionDBVERDatabase publish timeDBTIMEPrimary threadsThreadpool used for multiscanMultiscan poolliveidleQUEUEDSINCEFILEMemory usage reported by libcMemLibcPoolPress any key to exit help ClamdTOP version %s nSTATS %7.3f%04u-%02u-%02u %02uhDetails for Clamd version: %sPrimary threads: live %3u idle %3u max %3uQueue:%6u items %6u maxMem: Libc: Pool: %2u %s%10.03fs{zzzzzreconnectoutput_queueoutput_statsparse_queueparse_statsresizeread_versionprint_con_infomake_connection_realsigintsetup_connections.A@@C8@P?cli_malloc(): Attempt to allocate %lu bytes. Please report to https://bugzilla.clamav.net cli_malloc(): Can't allocate memory (%lu bytes). cli_calloc(): Attempt to allocate %lu bytes. Please report to https://bugzilla.clamav.net cli_calloc(): Can't allocate memory (%lu bytes). cli_realloc(): Attempt to allocate %lu bytes. Please report to https://bugzilla.clamav.net cli_realloc(): Can't re-allocate memory to %lu bytes. cli_realloc2(): Attempt to allocate %lu bytes. Please report to https://bugzilla.clamav.net cli_realloc2(): Can't re-allocate memory to %lu bytes. cli_strdup(): s == NULL. Please report to https://bugzilla.clamav.net cli_strdup(): Can't allocate memory (%u bytes). Unable to readdir() directory %s: %s cli_gentemp('%s'): out of memory cli_gentempfd: Can't create temporary file %s: %s malloc_problemcalloc_problemrealloc_problemstrdup_problembuffer too small for ctime invalid timestampTMPDIRcli_readn: read error: %s cli_writen: write error: %s %s/%s%02x%s/clamav-%s.tmp(?i)>0xHx(((`P[:<:]][:>:]]NULSOHSTXETXEOTENQACKBELalertBSbackspaceHTnewlineVTvertical-tabFFform-feedCRcarriage-returnSOSIDLEDC1DC2DC3DC4NAKSYNETBCANSUBESCIS4FSIS3GSIS2RSIS1USexclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stopzerotwothreefourfivesixseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketbackslashreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-brackettildeDELalnumalphablank cntrl0123456789graphlowerabcdefghijklmnopqrstuvwxyzprintpunct upperABCDEFGHIJKLMNOPQRSTUVWXYZxdigit0123456789ABCDEFabcdefABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ !"#$%&'()*+,-./:;<=>?@[\]^_`{|}~%y%m%d%H%M%S%Y%m%d%H%M%S.crtcli_hex2ui(): Malformed hexstring: %s (length: %u) cli_hex2str(): Malformed hexstring: %s (length: %u) cli_hex2num(): Malformed hexstring: %s (length: %d) cli_xtoi(): cli_malloc fails. cli_strtok: Unable to allocate memory for buffer cli_unescape: Unable to allocate memory for string utf16 length is not multiple of two: %lu UTF16 surrogate encountered at wrong pos cli_utf16toascii: length < 2 cli_strrcpy: NULL argument PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP`PPPPPPPPPPPPP@PPPP0PPPPPPpP  ;4 %`:P;0<> ?@@pPPV@ZH```a bP bh `d 0e @e eX ep f Pg g h i kp l m o8 px p pr 0s sP Pt 0x xPy8y`z(P`Pp0H` 00X`@Д0H0p 0`@p8pp(P `(@P @ h @80 P`0    ( 0!P `!h p! P# P$8!$!%!0%!P%!&0"0'"@)")#@*`#*#@+#+H$p,$-%P.X%.%/%`/&/0&00h&P1&1&04p'P6'6'6(07@(P7X(7p(8( 9(9(0:):8)@;)<)<)< *@=@*>*?@+@+A+A,DX,F,pG,G,JH-L- M-O8.PP.Ph.@R. S/SX/Sp/zRx 5*zRx $X0 FJ w?;*3$"4D6eFAJ } CAF DDA<|H6BBD A(J0h (A ABBG d7BBE B(D0A8RP 8A0A(B BBBH L 8C0A(B BBBA 4$9eFAJ } CAF DDA,\89KAD AB\9BBE B(D0A8J,,D,X,C, 8D0A(B BBBA IBBE B(D0A8IGUBW 8C0A(B BBBA n 8C0A(B BBBA U 8A0A(B BBBA d|N4BBE B(D0A8N@ 8A0A(B BBBI D 8F0A(B BBBE |QBBE B(H0A8J^ 8A0A(B BBBJ J 8D0A(B BBBI v 8G0D(B BBBE dX|W W<WHAA h ABK  HBK HYL@YBBH A(H@/ (F ABBA B (C ABBA DTZBAF MX  CABD X  EABH ([ < [~BAH GM  CABK G CAB`["$ x[AAF AA4\DL\Dd ]K,|(]IAA s ABG \^BBE A(D0Gk 0A(A BBBH ^ 0A(A BBBA , 8`lBAD [AB,<x`lAAF aAAdlaBBB B(D0A8G@l 8A0A(B BBBF t 8A0A(B BBBA <pcKBD A(G0(A ABB$ d)AAL XAA4<(dAAD  AAG k FAF DteAAD A DAD p DAK T DAA ,f\BAD G ABG D8fBBD A(G0P8L@N8A0G (A ABBH L4fBBB B(A0A8MG 8A0A(B BBBH ,@jAAJ M AAE jGx A $k.AAJ _AA\kBBD A(D0 (F ABBE D (C ABBD I(C ABBd\ k BBB B(D0A8J . 8A0A(B BBBA b L B F U 4 pvBAD Gs  AABA \ vBBD A(WDJB (A ABBA TD_A\ X2BBB B(A0A8SDKCFHEEEFU 8C0A(B BBBH L]BSMDGCFULBES z4 zdL zBBE B(D0A8MPh 8A0A(B BBBA O 8D0I(B BBBL  `| X| P|$ H|$AJA AA $$ P}$AJA  AK ,L X~ AAJA AAF $| 8AJAA$ VEV E T A `$ XoEo D U A `$ SEV E Q A `4 ؀|FAA _ ABF T ABI $T RDP A g D QL| XAAD ] AAK R HAE _ DAD KDA #KW$ .AAJ \DA\ BBD A(OW (F ABBF G (F ABBF G(D ABBLlBBD A(OU (F ABBH G(D ABB<XBAC z DBE H FBA \Ȃ BBE B(A0A8GVGaBP 8A0A(B BBBB \x.\tvBBE B(D0A8OBXAW 8A0A(B BBBB 4yBAA F0k  AABW d ~BBB B(D0A8D 8D0A(B BBBA Z 8A0A(B BBBA 4tAAJ v AAD sFAh($IAAL@vCAd BBE B(E0A8J 8A0A(B BBBK  8A0A(B BBBH dT1 BBE B(E0A8J 8A0A(B BBBE U 8A0A(B BBBA dȢBBB B(D0A8D@] 8A0A(B BBBH  8A0A(B BBBA 4$JAAI a AAB WAA\Xt4BEA W CBA kAB$PIL[N,fQAR Z AAH 4(WBBA A(D0C(D ABB,TPbAAJ0d AAF ,MAD |AB|BBI B(D0A8QPt 8A0A(B BBBE h 8A0A(B BBBF b 8D0A(B BBBI |4 BBB B(D0A8DPy 8A0A(B BBBD  8I0A(B BBBM  8O0A(B BBBL LBBA A(I@I (A ABBB J (A ABBH d" BBF B(D0A8I 8A0A(B BBBF  8A0A(B BBBA dlHBBE B(A0A8D 8A0A(B BBBE  8A0A(B BBBG LBDB B(D0A8S[ 8C0A(B BBBA $@QBBE B(D0A8Op7 8A0A(B BBBH xbSxApxQOxBpMx^WxBpUxdSxApjxQTxApQBBE B(D0A8Op7 8A0A(B BBBH xbSxApxQOxBpMx^WxBpUxdSxApjxQTxApDTBHB B(A0A8 0A(B BBBJ xBBE B(D0A8D\JYGQAHQD 8A0A(B BBBA L$BBE B(A0A8D`' 8D0A(B BBBK DtBBE B(A0A8 0A(B BBBE BBE B(D0A8GMXKF{IRBFD^AQTA 8A0A(B BBBA LT`BBB B(D0A8Dp0 8D0A(B BBBB BBH B(A0A8GO 8D0A(B BBBE fdFAHSEJQASHNDHZBEHUBAzAIRADYAVQKA HYADHZA$uQS D H)DddBBE B(A0A8Gp  8A0A(B BBBH O 8A0A(B BBBG L`BBE B(D0A8J 8A0A(B BBBA LBBD A(J0U (D ABBG L(C ABB$$P$AAJ IGALXd`L|hBBE B(D0A8MP 8C0A(B BBBE L BBE B(D0A8JP 8D0A(B BBBC L BBE B(D0A8L`- 8C0A(B BBBK <lhWBBE A(D0t (A BBBG LBBE B(D0A8Q@O 8A0A(B BBBF <WBBE A(D0t (A BBBG L<BBE B(D0A8Q@O 8A0A(B BBBF THwBBE B(D0A8M@NHZPPHA@F 8A0A(B BBBJ TpBBE B(D0A8JP{XT`UXAPF 8A0A(B BBBA d<1BBE B(D0A8J` 8D0A(B BBBD D8C0A(B BBBLBBE B(D0A8Q@Q 8A0A(B BBBD DdBBE A(D0M@x 0A(A BBBE ,<  8BAD J0S LAB,l ( YAAK r AAG , X DAAD m AAK 4 x |AAG P AAE L CAH L! KAA DpJ  CABG O  DABB P4T! {FAK D DAE LCA|! SBBE B(D0A8G@ 8A0A(B BBBA L 8F0A(B BBBI  8A0A(B BBBD L " BBB B(A0A8D`[ 8A0A(B BBBA 4\"aAAD  DAF IFA".NN,"?AAD j CAD ""Z #84$#BAD x DBK V DBD \#Xv4t#BAD  ABG T CBG $#jAJ A C A YL#`BBA A(G0] (A ABBH D (D ABBE ,$$AAR0 AAA 4T$@AAD Z AAF ^CA,$>BAD qCB$iFZ$=MBE B(D0A8G@ 8D0A(B BBBA F 8A0A(B BBBA LC@td%)OBE B(D0A8GP 8D0A(B BBBA D 8C0A(B BBBA Id%hBBB B(A0A8D` 8D0A(B BBBE y 8A0A(B BBBH D&@Di A <d&0tBBA A(D0\ (D ABBA L&pBBB B(D0A8D`x 8A0A(B BBBE L&BBB B(D0A8D` 8A0A(B BBBA D'0\'<Ar E Cd|'JBBE B(A0A8DPe 8A0A(B BBBH z 8C0A(B BBBA l'KBE B(D0A8JPk 8A0A(B BBBH CPT(Fdl(HBBB B(A0E8GP 8A0A(B BBBG ` 8H0A(B BBBE (!((":d)P"tBBE B(D0A8JPr 8D0A(B BBBG  8A0A(B BBBH <l)h#BBD A(G@ (A ABBG D)$eBBE B(H0H8M@r8A0A(B BBB)0$ *($)vBh;A%B%BUAcaA%B%BUAqA%B%BUAcA%B%BBV;A%B%BA;A+%B%BA;A)%B%BAv;A:%B%BA;A8sA%BA;A:%B%BA;A%B%BA;A%B%BA;A%B%BA;A:%B%BAd;A%B%BA;A%B%BA;A%B%BA%B%BA;A%B%BBm;A%B%BA;A%B%BA;A%B%B#Az;A%B%BA;A`sA%B,Ad5A%B%BGAr;A%B%BQA;AsA%BYAmA%B%BvAmA%B%BA;A%B%BA;A%B%BAf%B%BAi;A%B%BAo;A%B%BA%B%BA%B%BA;A%B%BA%B%BA%B%BHA%B%BA%B%BAmA%B%BA;A %B%B A;A %B%BA;A %B%BA;A %B%BUA;A %B%BA;A %B%B!A %B%B-A %B%BAAPA`A AtAA;AAAAmA0AAAAPhAAAA;AAAA;AAAA;AAA AA;A %B%B!A,AmA %B%B9AHA;A %B%BXAbA;A%B%BmAAluA{AAAuAAAAAcmA AAAAضAAAAйAAA AAmAPA9AA;AAAA;AAAA;AA%B2AA@APAAAbAؿArA}AmAAAAAAAHAAAxA-AAAaAAAAAXAA!A0AAAAASAAAgAvAaPAAAmAAvAAmAAvAA;A0AAARAAXA^AAeAnAAxAAAAA@AAAAAA;AXAAA;A%B%BwA%B%BA;A%B%BA;A%B%B#A;A%B%BA%B%BcA;A%B%BAA%B%BAmA%B%BAmA%B%BA;A%B%BA;A%B%BmA;A%B%BA;A%B%BA;A%B%BA;A%B%ByAA%B%BKA%B%B B?, B@: B[N B\X B\h B]} B^ B^ B_ B_ B` B{ B{ B| B} B}B~ BBB%BBB%BB#B%B&B(B%BB,B%B7BPB%B=BCB%B^BB%BdBB%BAjB%BqBwB%BBB%B%BGCC: (GNU) 5.3.0GCC: (GNU) 5.5.0.shstrtab.interp.note.ABI-tag.hash.dynsym.dynstr.gnu.version.gnu.version_r.rela.dyn.rela.plt.init.plt.got.text.fini.rodata.eh_frame_hdr.eh_frame.ctors.dtors.jcr.data.rel.ro.dynamic.got.plt.data.bss.comment 8@8T@T !x@x' `@`/@@@17or @r hDo!@!`S@"@@"]B#@#0g02@02$b`2@`20 m<@<v<@<.|kAkkAk B4BT*8Ub8UHUbHUXUbXU`Ub`UPX bqb@b(@b@ bؼh 0ؼ"usr/bin/clambc0100755000000000000000000026576013365330320012323 0ustar rootrootELF>,@@d@8 @@@@@@88@8@@@ll aa^Pc P]P]aP]appTT@T@ Ptd@@QtdRtdaa([([/lib64/ld-linux-x86-64.so.2GNU C[/TBNQY>8UX2V<@ )=4 ZD& -7G3J+#A:W'IOS"CF?!%$ 1(,. 90K5;M*LPRHE6_|Zm3Y h .T0x^@8{caG ~M R@ba& ca:Lj(ha?l&3,mXcasbacaed @libclamav.so.7cli_bytecode_debug_printsrccli_bytecode_debugcli_bytecode_printversion__gmon_start___Jv_RegisterClassescl_initcli_bytecode_describecl_engine_new_ITM_deregisterTMCloneTablecli_bytecode_context_setparam_intcl_engine_compile_ITM_registerTMCloneTablecli_calloccli_bytecode_context_destroycli_bytecode_donecl_retdbdircli_bytecode_initcli_bytetype_describecli_bytefunc_describefmapcl_cvdheadcl_strerrorcli_regexeccli_bytecode_destroycl_retflevelcl_engine_freecl_cvdfreecl_debugcli_regfreecli_bytevalue_describecli_filecopycli_bytecode_context_set_tracecli_bytecode_context_alloccli_bytecode_runcl_cleanup_cryptocli_bytecode_prepare2cli_bytecode_loadcli_bytecode_context_setfuncidcli_bytecode_context_setfilecli_regcompcli_bytecode_context_getresult_intlibxml2.so.2_finiliblzma.so.5libbz2.so.1libltdl.so.7libdl.so.2libssl.so.1libcrypto.so.1libz.so.1libjson-c.so.2libpcre.so.1libm.so.6libclammspack.so.0libpthread.so.0__errno_locationlibc.so.6exitsprintf_IO_putcstrncmpoptindstrrchr__strdupstrncpyputsforkputcharstrtolfgetsstrlenfseekdup2ctimestdoutfclosestrtoulmallocstrcasecmpgetenvoptargstderroptoptfwritefreadstrchrfprintfsetsidfopen64accessopterrstrcmp__libc_start_mainsnprintf_edata__bss_start_endGLIBC_2.2.5CLAMAV_PUBLICCLAMAV_PRIVATE ui  ui Ӈ_ (E6_a _a_a_a$_aH_aX`a `a(`a0`a8`a@`aH`aP`aX`a ``a h`a p`a x`a`a`a`a`a`a`a`a`a`a`a`a`a`a`a `a!`a"aa#aa%aa&aa' aa((aa)0aa*8aa+@aa,Haa-Paa.Xaa/`aa0haa1paa2xaa3aa5aa6aa7aa8aa9aa;aa<aa=aa>aa?aa@aaAaaBaaCaaEaaFbaGbaIbaJbaK baL(baM0baN8baO@baPHbaQPbaSXbaT`baUhbaYHH-D!HtBH5RD!%TD!@%RD!h%JD!h%BD!h%:D!h%2D!h%*D!h%"D!h%D!hp%D!h`% D!h P%D!h @%C!h 0%C!h %C!h %C!h%C!h%C!h%C!h%C!h%C!h%C!h%C!h%C!h%C!hp%C!h`%C!hP%C!h@%zC!h0%rC!h %jC!h%bC!h%ZC!h%RC!h %JC!h!%BC!h"%:C!h#%2C!h$%*C!h%%"C!h&%C!h'p%C!h(`% C!h)P%C!h*@%B!h+0%B!h, %B!h-%B!h.%B!h/%B!h0%B!h1%B!h2%B!h3%B!h4%B!h5%B!h6%B!h7p%B!h8`%B!h9P%B!h:@%zB!h;0%rB!h< %jB!h=%bB!h>%ZB!h?%RB!h@%JB!hA%BB!hB%:B!hC%2B!hD%*B!hE%"B!hF%B!hGp%B!hH`% B!hIP%B!hJ@%J?!fAWAVAUATUSHH(6H HE1ɉj1AHHHAZA[ H5HNDH E H5-H2D@ E HC@Hu H8H5ҵHI, HHH5:Hx R1vHs@H~HFtf.HHxu-H5H~p HD$ H5HHl$D$E1KH Iąt*AI|$H5wMd$0EDMuH5.HH 1ELH%L5Uh=E!H57H@ tXHHH|$MHH=6E!t H=1H(1[]A\A]A^A_H5HPx HC@H5L LHH$L$ E1MG@H $LLD$epALD$1fHD9~4A< AuAA~A<SAHD9fD=uH5ͱHq x  L$ Iƹ,1LMLHt$LH4$=C!FHILL$@AFHpHH$HC!1 H5/HHHHrC! x H5HoC!v HpL 6L7H 7H67L~HC@HxHt 1ADHL =B!HC@HxHxHAHC@AUIHHw6!IWH5H8138IWHH5RH5zHH6!H=NHHH5!H=H1H5}HH5IHH5!H=HvHz5!HUH5H81HH  !'H=H1kH=H=` H=z H=H={H=oH=cH=dWH=KH=?H=3H=T'H=H=H=H=d -1&H=H1p1)H1H4!H=W(Hf.1I^HHPTI0^@H]@Hǀ @fDH=i7!Hi7!UH)HHvH~3!Ht ]fD]@f.H=)7!H5"7!UH)HHHH?HHtH93!Ht ]f]@f.=6!ubUH H6!HATSH L% H)HHH9s@HH6!AH6!H9r[A\]u6!H= H?u .fDHy2!HtUH]Ht]USHHHH;Ht Hht,H{Ht HStH[8HuH1[]DHH[]1Ðf.AUATIUSIHHxHHË@(u\S$uDHH{kHSHHCHLkC$C 1H[]A\A]fDK$tHHIHtHHID$Ml$HHHB0HuLb0HCC$Hz@HCHHdC 1_HC1H0!H5/LH81)H0!H=/"HH0!H=/"HHi0!H=B/"H`LAWAVMAUATIUSHIILHHT$$H,HT$HHHHHMLeHHCMLGHHCC HkHHvC D$PHC0HC8C$HC@C(D$XC,I$HtXHX8I$1H[]A\A]A^A_MHKMHCXHCC `IEI]I$HC8H1[]A\A]A^A_øH{oH;gH_gDHt]USHHHH;Ht Ht,H{Ht HtH[8HuH1[]DHH[]1Ðf.HATUISHG@Ht7H8Ht&f.ID$@H<HHuHI\$0Ht5H{tgH;wH{nH{eHk0HYHHuI<$HI|$>I|$4I\$8L'HtIDH[0[]A\ff.AWAVIAUATEUSEHL$@t$4HT$8L$0HD$hHD$pMtLT$hHD$pL=/!A1D\$ Ƅ$:HD$ HD$h1I7AHD$(3E4Du EtAtMMI7HHۉH,HUHuH}uMD\$LLc\$ cH5LLHHD$HD$xD$HD$ Dd$(HD$XH$HD$ HD$dHD$PH$@HD$@MH$@HT$HUHHl$xHH!%tDHVHD@HH1H)fHH t X9|HcHHD$ Hl$xHGE<#;H5`H t- Hu  HuD\$0EtH*!T$ H5'+H815HD$HtHsH|$h1 fHUHtkAIcHHH @E0}t H}(HHDŽHHAHDŽPUXE|$ ~HcL$ }QD$ HcƄ:E0H}(HD$ Ƅ:/fDHHDŽHVLT$D\$HMWE0PHt$0H|$8LM LE(VZYD\$LT$H{)!H=(?1HpH|$hI7D$ @I7T$ @HHZH1ҍpH"IH t 9|HcL$L~HHcAt HA~@v(@ t"zfALHxq@v uHuzHAA<$"3LD$hHLLD$HLD$UHcP,EH IHʋS4tIAtDT$(u>Mct$0HH(!H5)L$ H81JDD$(H MYT$0HH'!H5/*L$ H81MH$LD$PHL$@Ht$8|$4HD$d=:;HHDD$LEt8;$XHD$@L$LHP81fDH ;Z9uH&!H5'H81)uMMLD$hHLHLMIH&!H5(HH81MuMu {HsHtUC0H|$ ED$H‰D$H 8H|$ E111LH|$ D$3D$0C7MPHt$X1LHD$#LD$A8"{HT$xHMtKH=?AH HHLD$hE1M^I\$"HHA|$|IHcD$dHH@HH(!L rH$!H=G$)1HH|$hyHH[]A\A]A^A_ÃLD$hH5LLD$RLD$tA<$1A|$E11HHH@CML 1E1HcLD$hgD$LD9AL=&HcD$LBƄHD$HHDŽ@HDŽPDŽXDŽHVH#!H=F#*1HH|$hHL%LD$h1D$0CHI#!HSH5%H81H|$uH\$hdH|$tH|$MuH\$hH?L%%!A$9D$4*|$4)ǃHc=HHC@A,$9l$4H|$8HcL,׉fI9l$4)HcI}H HH\$hA$HC@)HcH<uHV"!H=?(HMeHA"MHH"!H5G'H81ULD$h|$0 MH!!T$ H5$#HH81L$0&C{H!!HSH5U#H81H5LLD$B1ɅLD$E1HW!!HSH5<$H81A<$uCH!!HSH5%H81WfLc(1kqmuH=HHgMIH !H5?%HH81\$0H !H5 LH81Hr !H=C!3HioHM !H=bHDJH( !HSH5"H81c~H !IRH5T"H81BH!IH5"IRHH81MIlH!H5#HH81DL$0EH!L$ H5" HH81DT$0EmHK!L$ H5HH81IH'!HSH5d#H81b(ABH!IRH5#H811H!H=11HH|$hpH!H=m$1HH|$h?CtrHh!HSH5#H81IABtNH;!IRH5!H81vHh1[]A\A]A^A_Hf!H=o!.H]Hl$(IqHAA0H\$@L $H߃҃L $t)H!IQH5LH81?Hl$($Ht$1E11HL $=H߉LH5L $AAK 'H\$H5L $H?L $t;1Y{OHD$HT$H|$(HLL $L $KHD$(Hh[]A\A]A^A_L $HHD$L $HHt$81HJ;"L $ HT$8M@,HHD$HDN@u+H|$H2IY(H\$$f.HH|$H|$ 1L $HD$HL $KH=?HH WH|$H57L $HD$L $IQH5#"H!H5LL $H81HD$L $DkkmuH=HLH51HD$f.fAWAVIAUATAUSH=IHH1һ++ !H=!H-!HLcEHcHcLMIOLI1H5!2@u`@Ha!I? j!Hcɀ< tjDE9}DeH[]A\A]A^A_H2@t9ur !@:yW]tIcHcIT< uA!DuDuE9XIcIDH -@+@-Du@HA9H -uztLLD]NHcA9ILDu{LA9~HcITfH2HHru9|HA9uHcMDuDufH[]A\A]A^A_@H!IUH5H81:HcE !IML4@;fMHcA<2z:8AVs!D9U H <! .1:AD:fDA:A4Fը8:BHcȃA:EfDDBA-tlE(LLD!A!DuHH>A!DuI1H7!zuADu zADuKTHJA9ܺDuDHC!IUH5H81~: !Du:?ff.AWAVAAUATH=֛USHIHxDL$ HL$LD$HDL$ 1D$ ++Hi!H=v!D;HE9IcH<Ll=H|$ IU -@+@-LEfAHE9H -uztLD$HL$LHDD+E9AIcHt}RAMH~D9~'HcHDfHAHHPA9|HA9ωHcAH|uDzfE_ADE9}$D3DHx[]A\A]A^A_fAHxD[]A\A]A^A_z@-t@ELHDDAfDA$<:D$ A4VՁ<|$ :P3HcʃA< @:@|$ EfDE_H5!DIEHHr!-:5Iu~Ht$XlHt$X~-@@HD|$8HD$0<=D$gHcljHD=tHuT$gL$`HD$HHHD$PWD$`+D$8LD$PD|$HPH@E1DADfDHcЍHAHcA44@:t-Wu@;t"9uHxLH[D]A\A]A^A_HHcA<4:E͉|$8iHN!A?E_H5DIMHUHi!H81IEHD$XD$8D$` xH!EA?2HHUH5zH!H81ADE_E9DSH!E1|$ : AGd:HHUH5UT$`H5m!HcHT$XH=Ht$ HT5H5I!H$D`DCHt$D$`1+D$8Ll$(Dt$@D|$ PCREMatchLimit are superfluous. WARNING: setting this limit too high may severely impact performance.This option sets the maximum filesize for which PCRE subsigs will be executed. Files exceeding this limit will not have PCRE subsigs executed unless a subsig is encompassed to a smaller buffer. Negative values are not allowed. Setting this value to zero disables the limit. WARNING: setting this limit too high or disabling it may severely impact performance.This option enables on-access scanning (Linux only)This option specifies a directory or mount point which should be scanned on access. The mount point specified, or the mount point containing the specified directory will be watched, but only notifications will occur. If any directories are specified, this option will preempt the DDD system. It can also be used multiple times.This option specifies a directory (including all files and directories inside it), which should be scanned on access. This option can be used multiple times.This option allows excluding directories from on-access scanning. It can be used multiple times. Only works with DDD system.Use this option to whitelist the root UID (0) and allow any processes run under root to access all watched files without triggering scans.With this option you can whitelist specific UIDs. Processes with these UIDs will be able to access all files. This option can be used multiple times (one per line). Using a value of 0 on any line will disable this option entirely. To whitelist the root UID please enable the OnAccessExcludeRootUID option.Files larger than this value will not be scanned in on access.This option toggles the dynamic directory determination system for on-access scanning (Linux only).This option changes fanotify behavior to prevent access attempts on malicious files instead of simply notifying the user (On Access scan only).Enables extra scanning and notification after catching certain inotify events. Only works with the DDD system enabled.When started by root freshclam will drop privileges and switch to the user defined in this option.This option defined how many times daily freshclam should check for a database update.Use DNS to verify the virus database version. Freshclam uses DNS TXT records to verify the versions of the database and software itself. With this directive you can change the database verification domain. WARNING: Please don't change it unless you're configuring freshclam to use your own database verification domain.DatabaseMirror specifies to which mirror(s) freshclam should connect. You should have at least two entries: db.XY.clamav.net (or db.XY.ipv6.clamav.net for IPv6) and database.clamav.net (in this order). Please replace XY with your country code (see https://www.iana.org/domains/root/db). database.clamav.net is a round-robin record which points to our most reliable mirrors. It's used as a fall back in case db.XY.clamav.net is not working.db.XY.clamav.net database.clamav.netThis option allows you to easily point freshclam to private mirrors. If PrivateMirror is set, freshclam does not attempt to use DNS to determine whether its databases are out-of-date, instead it will use the If-Modified-Since request or directly check the headers of the remote database files. For each database, freshclam first attempts to download the CLD file. If that fails, it tries to download the CVD file. This option overrides DatabaseMirror, DNSDatabaseInfo and Scripted Updates. It can be used multiple times to provide fall-back mirrors.mirror1.mynetwork.com mirror2.mynetwork.comThis option defines how many attempts freshclam should make before giving up.With this option you can control scripted updates. It's highly recommended to keep them enabled.With this option enabled, freshclam will attempt to load new databases into memory to make sure they are properly handled by libclamav before replacing the old ones.By default freshclam will keep the local databases (.cld) uncompressed to make their handling faster. With this option you can enable the compression. The change will take effect with the next database update.Download an additional 3rd party signature database distributed through the ClamAV mirrors. This option can be used multiple times.With this option you can provide custom sources (http:// or file://) for database files. This option can be used multiple times.http://myserver.com/mysigs.ndb file:///mnt/nfs/local.hdbIf you're behind a proxy, please enter its address here.A user name for the HTTP proxy authentication.A password for the HTTP proxy authentication.If your servers are behind a firewall/proxy which does a User-Agent filtering you can use this option to force the use of a different User-Agent header.Send the RELOAD command to clamd after a successful update.Run a command after a successful database update.Run a command when a database update error occurs.Run a command when freshclam reports an outdated version. In the command string %v will be replaced with the new version number.With this option you can provide a client address for the database downloading. Useful for multi-homed systems.Timeout in seconds when connecting to database server.Timeout in seconds when reading from database server.This option enables support for Google Safe Browsing. When activated for the first time, freshclam will download a new database file (safebrowsing.cvd) which will be automatically loaded by clamd and clamscan during the next reload, provided that the heuristic phishing detection is turned on. This database includes information about websites that may be phishing sites or possible sources of malware. When using this option, it's mandatory to run freshclam at least every 30 minutes. Freshclam uses the ClamAV's mirror infrastructure to distribute the database and its updates but all the contents are provided under Google's terms of use. See https://transparencyreport.google.com/safe-browsing/overview and https://www.clamav.net/documents/safebrowsing for more information.This option enables downloading of bytecode.cvd, which includes additional detection mechanisms and improvements to the ClamAV engine.Disable authenticode certificate chain verification in PE files.Initialize a supplementary group access (the process must be started by root).Define the clamd socket to connect to for scanning. This option is mandatory! Syntax: ClamdSocket unix:path ClamdSocket tcp:host:port The first syntax specifies a local unix socket (needs an absolute path) e.g.: ClamdSocket unix:/var/run/clamd/clamd.socket The second syntax specifies a tcp local or remote tcp socket: the host can be a hostname or an ip address; the ":port" field is only required for IPv6 addresses, otherwise it defaults to 3310 ClamdSocket tcp:192.168.0.1 This option can be repeated several times with different sockets or even with the same socket: clamd servers will be selected in a round-robin fashion.Define the interface through which we communicate with sendmail. This option is mandatory! Possible formats are: [[unix|local]:]/path/to/file - to specify a unix domain socket; inet:port@[hostname|ip-address] - to specify an ipv4 socket; inet6:port@[hostname|ip-address] - to specify an ipv6 socket./tmp/clamav-milter.socket inet:7357Define the group ownership for the (unix) milter socket.Sets the permissions on the (unix) milter socket to the specified mode.Messages originating from these hosts/networks will not be scanned This option takes a host(name)/mask pair in CIRD notation and can be repeated several times. If "/mask" is omitted, a host is assumed. To specify a locally originated, non-smtp, email use the keyword "local".local 192.168.0.0/24 1111:2222:3333::/48^(Accept|Reject|Defer|Blackhole|Quarantine)$Action to be performed on clean messages (mostly useful for testing). The following actions are available: Accept: the message is accepted for delivery Reject: immediately refuse delivery (a 5xx error is returned to the peer) Defer: return a temporary failure message (4xx) to the peer Blackhole: like Accept but the message is sent to oblivion Quarantine: like Accept but message is quarantined instead of being deliveredAction to be performed on error conditions (this includes failure to allocate data structures, no scanners available, network timeouts, unknown scanner replies and the like. The following actions are available: Accept: the message is accepted for delivery; Reject: immediately refuse delivery (a 5xx error is returned to the peer); Defer: return a temporary failure message (4xx) to the peer.This option allows you to set a specific rejection reason for infected messages and it's therefore only useful together with "OnInfected Reject" The string "%v", if present, will be replaced with the virus name.If this option is set to "Replace" (or "Yes"), an "X-Virus-Scanned" and an "X-Virus-Status" headers will be attached to each processed message, possibly replacing existing headers. If it is set to Add, the X-Virus headers are added possibly on top of the existing ones. Note that while "Replace" can potentially break DKIM signatures, "Add" may confuse procmail and similar filters.When AddHeader is in use, this option allows you to set the reported hostname. This may be desirable in order to avoid leaking internal names. If unset the real machine name is used.Execute a command when an infected message is processed. The following parameters are passed to the invoked program in this order: virus name, queue id, sender, destination, subject, message id, message date. Note #1: this requires MTA macroes to be available (see LogInfected below) Note #2: the process is invoked in the context of clamav-milter Note #3: clamav-milter will wait for the process to exit. Be quick or fork to avoid unnecessary delays in email delivery/usr/local/bin/my_infected_message_handlerChroot to the specified directory. Chrooting is performed just after reading the config file and before dropping privileges.This option specifies a file which contains a list of basic POSIX regular expressions. Addresses (sent to or from - see below) matching these regexes will not be scanned. Optionally each line can start with the string "From:" or "To:" (note: no whitespace after the colon) indicating if it is, respectively, the sender or recipient that is to be whitelisted. If the field is missing, "To:" is assumed. Lines starting with #, : or ! are ignored.Messages from authenticated SMTP users matching this extended POSIX regular expression (egrep-like) will not be scanned. As an alternative, a file containing a plain (not regex) list of names (one per line) can be specified using the prefix "file:". e.g. SkipAuthenticated file:/etc/good_guys Note: this is the AUTH login name!SkipAuthenticated ^(tom|dick|henry)$This option allows you to tune what is logged when a message is infected. Possible values are Off (the default - nothing is logged), Basic (minimal info logged), Full (verbose info logged) Note: For this to work properly in sendmail, make sure the msg_id, mail_addr, rcpt_addr and i macroes are available in eom. In other words add a line like: Milter.macros.eom={msg_id}, {mail_addr}, {rcpt_addr}, i to your .cf file. Alternatively use the macro: define(`confMILTER_MACROS_EOM', `{msg_id}, {mail_addr}, {rcpt_addr}, i') Postfix should be working fine with the default settings.This option allows you to tune what is logged when no threat is found in a scanned message. See LogInfected for possible values and caveats. Useful in debugging but drastically increases the log size.This option affects the behaviour of LogInfected, LogClean and VirusAction when a message with multiple recipients is scanned: If SupportMultipleRecipients is off (the default) then one single log entry is generated for the message and, in case the message is determined to be malicious, the command indicated by VirusAction is executed just once. In both cases only the last recipient is reported. If SupportMultipleRecipients is on: then one line is logged for each recipient and the command indicated by VirusAction is also executed once for each recipient. Note: although it's probably a good idea to enable this option, the default value is currently set to off for legacy reasons.yesExampleERROR: Unknown option passed footruehelp^(yes|true|1|no|false|0)$config-file/etc/clamd.conf/etc/freshclam.conf/etc/clamav-milter.confdebuggen-jsondumpcertsquietleave-tempsno-warningsshow-progressstdoutdaemonno-dnslist-mirrorsupdate-dbreloadmultiscanfdpassstreamallmatchdatabase/usr/share/clamavrecursivegen-mdbfollow-dir-symlinks^[0-9]+$follow-file-symlinksbellno-summaryfile-listinfectedsuppress-ok-resultscopyremoveexcludeexclude-dirinclude-dirstructured-ssn-formathex-dumpmd5sha1sha256impprint-certshtml-normaliseascii-normaliseutf16-decodebuildmax-bad-sigs3000flevelcvd-versionno-cdiffserverunpackunpack-currentinfolist-sigsfind-sigsdecode-sigstest-sigsvbavba-hexcomparerun-cdiffverify-cdiffhybriddefaultcolorsconfig-dir/etcnon-defaultgenerate-configforce-interpretertrust-bytecodeprintsrcPrint source code of bytecodeprintbcirinputtracebytecode trace levelno-trace-showsourcearchive-verbosebytecode-trust-allhttp-proxyproxy-userlog-verboseforcedisable-summarydisable-archiveno-archiveno-peno-elfno-ole2no-pdfno-htmlno-mailno-phishing-sigsno-phishing-scan-urlsno-algorithmicno-phishing-restrictedscanmax-ratiomax-space^[0-9]+[KM]?$unzipunrararjunzoolhajartartgzdebblock-maxPreludeEnableprelude-enableEnable preludePreludeAnalyzerNameprelude-analyzer-name/tmp/clamav.logLogFileUnlockLogFileMaxSizeLogTimeLog time with each message.LogCleanLogSyslogLogFacilityLOG_LOCAL6LOG_MAILLogVerboseEnable verbose logging.LogRotatelog-rotateExtendedDetectionInfoPidFile/var/run/clam.pidTemporaryDirectorytempdir/tmpDatabaseDirectorydatadir/var/lib/clamavOfficialDatabaseOnlyofficial-db-onlynoYaraRulesyara-rulesLocalSocket/tmp/clamd.socketLocalSocketGroupvirusgroupLocalSocketMode660FixStaleSocketTCPSocket3310TCPAddr127.0.0.1MaxConnectionQueueLength30StreamMaxLength25MStreamMinPort1024StreamMaxPort2048MaxThreads120CommandReadTimeoutSendBufTimeout200300MaxQueueIdleTimeout^/proc/ ^/sys/MaxDirectoryRecursionmax-dir-recursion15FollowDirectorySymlinksFollow directory symlinks.FollowFileSymlinksCrossFilesystemscross-fsSelfCheck600DisableCachedisable-cacheVirusEventExitOnOOMAllowAllMatchScanForegroundforegroundDon't fork into background.DebugLeaveTemporaryFilesUserBytecodeBytecodeSecurity^(TrustSigned|Paranoid)$TrustSignedBytecodeTimeoutbytecode-timeout5000BytecodeUnsignedbytecode-unsignedBytecodeModebytecode-modeAutoStatisticsstatisticsNoneDetectPUAdetect-puaExcludePUAexclude-puaNetTool PWToolIncludePUAinclude-puaSpy Scanner RATAlgorithmicDetectionalgorithmic-detectionScanPEscan-peScanELFscan-elfDetectBrokenExecutablesdetect-brokenScanMailscan-mailScanPartialMessagesPhishingSignaturesPhishingScanURLsPhishingAlwaysBlockCloakphishing-cloakphishing-sslPartitionIntersectionpartition-intersectionHeuristicScanPrecedenceheuristic-scan-precedenceStructuredDataDetectiondetect-structuredStructuredMinCreditCardCountstructured-cc-countStructuredMinSSNCountstructured-ssn-countStructuredSSNFormatNormalStructuredSSNFormatStrippedScanHTMLscan-htmlScanOLE2scan-ole2OLE2BlockMacrosblock-macrosScanPDFscan-pdfScanSWFscan-swfScanXMLDOCSscan-xmldocsScanHWP3scan-hwp3ScanArchivescan-archiveArchiveBlockEncryptedblock-encryptedForceToDiskforce-to-diskmax-scansize100Mmax-recursion16max-files10000MaxEmbeddedPEmax-embeddedpe10MMaxHTMLNormalizemax-htmlnormalizeMaxHTMLNoTagsmax-htmlnotags2MMaxScriptNormalizemax-scriptnormalizeMaxZipTypeRcgmax-ziptypercg1MMaxPartitionsmax-partitions128MaxIconsPEmax-iconspe100MaxRecHWP3max-rechwp3TimeLimittimelimitPCREMatchLimitpcre-match-limit100000PCRERecMatchLimitpcre-recmatch-limitPCREMaxFileSizepcre-max-filesizeOnAccessMountPath/ /home/userOnAccessIncludePathon-access-include/home /studentsOnAccessExcludePath/home/bofh /rootOnAccessExcludeRootUIDOnAccessExcludeUIDOnAccessMaxFileSizeOnAccessDisableDDDdisable-dddOnAccessPreventionOnAccessExtraScanningDevACOnlydev-ac-onlyDevACDepthdev-ac-depthDevPerformancedev-performanceDevLiblogdev-liblogUpdateLogFile/var/log/freshclam.logDatabaseOwnerCheckschecksDNSDatabaseInfocurrent.cvd.clamav.netDatabaseMirrorPrivateMirrorMaxAttemptsScriptedUpdatesTestDatabasesCompressLocalDatabaseExtraDatabasedbname1 dbname2DatabaseCustomURLHTTPProxyServeryour-proxyHTTPProxyPortHTTP proxy's port8080HTTPProxyUsernameusernameHTTPProxyPasswordHTTPUserAgentNotifyClamddaemon-notifyOnUpdateExecuteon-update-executecommandOnErrorExecuteon-error-executeOnOutdatedExecuteon-outdated-executeLocalIPAddresslocal-addressaaa.bbb.ccc.dddConnectTimeoutReceiveTimeoutSafeBrowsingDisableCertChecknocertsMailMaxRecursionArchiveMaxScanSizeArchiveMaxRecursionArchiveMaxFilesArchiveMaxCompressionRatioArchiveBlockMaxArchiveLimitMemoryUsageMailFollowURLsmail-follow-urlsClamukoScanOnAccessClamukoScannerCountClamukoScanOnOpenClamukoScanOnCloseClamukoScanOnExecClamukoIncludePathClamukoExcludePathClamukoExcludeUIDClamukoMaxFileSizeAllowSupplementaryGroupsClamdSockettcp:scanner.mydomain:7357MilterSocketMilterSocketGroupMilterSocketModeLocalNetOnCleanAcceptOnInfectedQuarantineOnFail^(Accept|Reject|Defer)$DeferRejectMsgMTA specificAddHeader^(No|Replace|Yes|Add)$ReplaceReportHostnamemy.mail.server.nameVirusActionChroot/newrootWhitelist/etc/whitelisted_addressesSkipAuthenticatedLogInfectedBasicSupportMultipleRecipientsPOSIXLY_CORRECT%s: illegal option -- %c %s: unrecognized option `%s' %s: option `%s' is ambiguous %s: option requires an argument -- %c %s: option `--%s' doesn't allow an argument %s: option `--%s' requires an argument 0.100.2%s/daily.cvd%s/daily.cldClamAV %s ClamAV %s/%u/%s/dev/nullCan't open /dev/null dup2(%d, %d) failed %s/Unable to allocate memory for db directory... ERROR: This tool requires libclamav with functionality level %u or higher (current f-level: %u) ERROR: --file-list: Can't open file %s [trace] %p [trace] %s = %u [trace] %s [trace] function parameter: [trace] %s:%u:%u -> %s:%u:%u [trace] %s:%u:%u Unable to load %s Out of memory Unable to init libclamav: %s Unable to load bytecode: %s bytecode load skipped [clambc] Bytecode loadedUnable to reopen %s [clambc] Source code:Unable to create engine Unable to compile engine: %s [clambc] Bytecode preparedUnable to set param %u: %s Unable to map input file %s Unable to set file %s: %s Unable to run bytecode: %s [clambc] Exiting[trace] %s:%u:%u -> %s:%u:%u Entered function %s ERROR: Can't parse command line options Clam AntiVirus Bytecode Testing Tool %s Clam AntiVirus: Bytecode Testing Tool %s By The ClamAV Team: https://www.clamav.net/about.html#credits (C) 2009-2018 Cisco Systems, Inc. clambc [function] [param1 ...] --help -h Show this help --version -V Show version --debug Show debug --force-interpreter -f Force using the interpreter instead of the JIT --trust-bytecode -t Trust loaded bytecode (default yes) --info -i Print information about bytecode --printsrc -p Print bytecode source --printbcir -c Print IR of bytecode signature --input -c Input file to run the bytecode on --trace -T Set bytecode trace level 0..7 (default 7) --no-trace-showsource -s Don't show source line during tracing --statistics=bytecode Collect and print bytecode execution statistics file File to testUnable to init bytecode engine: %s Unable to prepare bytecode: %s [clambc] Running bytecode function :%u Unable to open input file %s: %s [clambc] Bytecode run finished[clambc] Bytecode returned: 0x%llx pjjk(kPjPj;)Hh.9H;p;=?P?h@OUYX`h`x``bHddxff8h`iiiii0iHkl8zRx 8*zRx $H(FJ w?;*3$"4D9eFAJ } CAF DDA<|:BBD A(J0h (A ABBG d;BBE B(D0A8RP 8A0A(B BBBH L 8C0A(B BBBA 4$@r(@@@H@(@xf@@P@d@@@m@d@@@@(@@@@(@@@@f@@@i(@@@@o(@@@@@@@@@@(@@@@@@@@@?@@@@@@@d@@@@(@ @@@(@ @@@(@ @@ @(@ @@L@(@ @@@(@ @@@ @@$@ @@3@ @@C@ @@P@b @@V@d@ f@c@h@d@] g@@o@d@ g@@@(@ @@{@(@ @@@ @@@u @@@ @@@i @@@l,@ @@@f,@ @@@(@ @@@ @@@ @@@ @@@d @@@c @@@r @@@ @@@(@ Hg@@@d(@@@@c@@@@ @n(@@@@,@g@@@<@f(@g@@N@t(@g@@@i(@g@@]@p(@f@@@c(@h@@@r0h@@@Td@@@@s(@Xh@@@a(@@@@t(@@@@@@@@@@@@@(@@@@(@@@@(@@@.@(@@@9@(@@@?@(@@@F@(@@@N@(@@@U@(@@@]@(@@@e@(@@@v@(@@@@(@@@@(@@@@d@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@9@@(@ @@ @@(@)@8@L@h@j@@lh@b@r@(@h@@@@Pi@@@(@@@@(@i@@@(@i@@@@ j@@@(@@@ @@(@pj@@@(@j@@4@J@p0k@<@N@a@-Pk@i@n@@,@#k@@@@(@ @l@@@@l@@@0m@@@hm@@@m@ @$@(@m@@3@d@n@=@B@8n@J@T@d@n@m@p@@o@@@d@o@@@d@p@@@d@ 8p@@@d@xpp@@@d@p@0@@d@xq@@@d@xr@@@d@dHr@@@d@s@!@@0t@@@@d@ t@/@2@(@J@@e@(@t@@x@@(@ u@@@d@X@u@@@@(@ u@@@u@v@@(@w@@@(@Pw@@@@F(@@@@(@xw@@@(@w@@.@w@@3@{@(@ (x@@<@M@f@x@f@r@@d@ (z@@@@(@ Pz@@@@z@@ z@@@@{@ |@@@@(@ |@@ @@ |@"@1@<@ }@H@X@m@(@ ~@@@@(@ ~@@@@(@ h@@@@(@ X@@@@(@ ؁@@@(@x@@@h@(@ p@@@y@(@ Ѓ@@@-@(@ @@@<@(@ @@I@_@(@ @@v@@(@ h@@@@(@ @@@@d@ (@0@@@d@ @0@.@(@@@H@(@P@@d@m@(@ @@w@@(@ `@@@@(@ 0@@@@(@ @@@@(@ h@@@@(@ @@@@(@ ȍ@@@@(@ `@@@$@(@ @@4@@@(@ P@@@N@@@ 0@[@@@@ P@@@`@d@ @n@@q@d@' @{@@@@ Ȕ@@@@@ Е@@@@@ Ж@@@@@P @@ @@@ @)@,@:@d@2 @I@M@X@d@d @@d@h@s@d@ `@n@@@d@ȝ@@@@d@ P@@@@d@ ȟ@@@@@ @@@(@@@@ @@!@5@h@G@W@@k@|@(@@@@d@@@@@PP@@@@(@@@@(@@@@(@@@@ @(@ @@@#@d@ @@0@?@(@ @@O@Y@(@@@d@@lh@r@@@u@@@@@cd@ h@@@@@@@@@@@@@d@8@0@@(@@@@(@@@@(@@@)@p@7@G@@@Y@@i@t@d@@@@@@@0@@@`@$@@@N@@@@@@@@@'@x@@8@J@@@^@m@a8@{@@d@@m@@d@@m@@(@@@3@(@(@@@@(@ @@@@@@@@@@@@@@@@@2@(@@@B@(@@@Z@i@(@ @@z@(@@@@d@@@@(@@@@(@@@@(@@@@@@@@@@d@@@@@P@@$@(@@@=@H@I@c@ȼ@@p@ @@@`@ @@@@@@@ @@@@@ @@@@@@@@X@@@@@0@@&@@5@I@h@@@U@p@\@e@@o@@@@@(@@@p@@@(@@@@@(@@@n@@@@(@@@@(@@@@(@@@@@@Z@(@@@@@@@@d@@@@d@@@@(@@@@(@@@d@(@@@@(@@@w@(@@@@(@@@p@@@@B@@@3@d@@@N@@@#6CO\gs @ x^@x@ @@ E `a@@ o@oo@P]a@@@@@@&@6@F@V@f@v@@@@@@@@@@@&@6@F@V@f@v@@@@@@@@@@@&@6@F@V@f@v@@@@@@@@@@@&@6@F@V@f@v@@@@@@@@@ @ @& @6 @F @V @f @aﾭﾭﾭﾭﾭﾭﾭﾭﾭﾭﾭﾭﾭﾭﾭﾭﾭﾭﾭﾭﾭﾭﾭﾭﾭﾭﾭﾭﾭﾭﾭﾭﾭﾭﾭﾭﾭﾭﾭﾭﾭﾭﾭﾭﾭﾭﾭﾭﾭﾭﾭﾭﾭﾭﾭﾭﾭﾭﾭﾭﾭGCC: (GNU) 5.3.0GCC: (GNU) 5.5.0.shstrtab.interp.note.ABI-tag.hash.dynsym.dynstr.gnu.version.gnu.version_r.rela.dyn.rela.plt.init.plt.got.text.fini.rodata.eh_frame_hdr.eh_frame.ctors.dtors.jcr.data.rel.ro.dynamic.got.plt.data.bss.comment 8@8T@T !x@x' @/ @ E7o@Do@pS@]B@g@$b@mp @p v @ =|x^@x^^@^@@TaaaaPX P]aP]pq_a_0`a`pbab  cac 0c"cusr/bin/clamav-config0100755000000000000000000000222613365330317013600 0ustar rootroot#! /bin/sh # Originally from libxml, Copyright (C) Daniel Veillard prefix=/usr exec_prefix=${prefix} includedir=${prefix}/include libdir=/usr/lib64 usage() { cat <0h@@8@RR YY;Y;p ``;`;Ptd11QtdRtdYY;Y; "V$:mVF|y?A;rdRxlR= W4a^PEGc g!M # h Y6`MvzIl(*\g>($L,T}1<t7.0}O@fDy! qo! KhB1n2. 9d&5p,|N+s + FOS Ie7rw=%/{CS Jjn[c5L/')#ovHU;fJieE[mP_X a38z^0 C GQ\ D  u-t~N:>-sb6j<YQ&kXHq'w4Z3"BTK9]UZ?kbWpu8"~A%@*)i]`2x{_ K : E3 `u p>x\ P o  5 #@ q`Y  s >U0   " `Z  @ 1 p?u 0 i  o 0 H Tc %  0  V} pG E\T ^ p^ m=8  PjH [b p  ` `  U S  ( 0   K 0 ^ Pah йw  @j<t B %8 CY p0 $   C$R   t A \ I ; e    [ >W 1 F $ Pl r, 8 4 B > H1 p> P CX 9' E 4 L1  `  `f|T % a `^XL s !S L  P`yX O d y 0+ N ^  D1| U= P s  c n+. 5 0DD 6  0&q : ?s = 1 u   E M F{  0fI p|2 1  P|z  `  eO {Z, @VH @w  p,  p P p^#  0 kY So P   @E x  @   C UG <  PF"   ` s %t xG ^ 1  &*P  , q p. @ %l )p , I\ i UR I  i3 ^  V @9 Ji ?W)  ZC   $ `R0f  L D|Q>  UA/  `!) x s/ <  0E D  KaFc 0t P p pSV  #tb *J ^`% @ I ( Q; PC 8d 3t p6~  B  85 ,0 !tUS: P(U 6),H 0R   # `   _{  ' ~  N pO @A1yg H- @ 4 P*<{ P4"  ` & x BD  ^v `W  b  D 0 P0  $   b  B= 7 %jj  C puTd  0^I : ] @ (  <i ^  A ]v7  W? E H Cdi @v C8  [ }#  Bd PB  x   B @TS 06F  pnA g  $ u  V# )!7! ND K? ?( p P >=j   @W   `!  n  c    p=}  PE' @s!  , .w   ^c< p%= (   W  9 U c( FSv ^\9  0v j  q0 : . P7|  P OUM D j A   s , @6= | F "  kb K. C   9$__gmon_start___ITM_deregisterTMCloneTable_ITM_registerTMCloneTable__cxa_finalize_Jv_RegisterClassesmemcmpcli_malloccli_errmsgmpool_free__ctype_b_loc__ctype_toupper_locmpool_callocstrlencli_strlcat__ctype_tolower_loccli_ac_buildtriecli_debug_flagcli_dbgmsg_internalcli_ac_initcli_ac_freecli_ac_chklsigstrchrcli_ac_initdatacli_calloccli_ac_freedatalsig_sub_matchedcli_realloccli_ac_scanbuffmemsetcli_strdupcli_hex2uicli_strtokcli_warnmsgcli_bm_initcli_bm_freecli_bm_scanbuffmemcpycli_scanbuffcl_engine_get_numcli_pcre_scanbufcli_isnumberstrtolstrncmpsprintfcl_sha256cli_checkfp_pecl_sha1cli_fmap_scandesccl_hash_initcl_hash_destroycli_hashset_destroycli_pcre_recaloffcli_pcre_freeoffcl_update_hashcl_finish_hashcli_regexeccl_debugcl_always_gen_section_hashcl_retflevelcl_strerrorcl_initgetpidcl_initialize_cryptolt_dlinitgettimeofdayclocksrandxmlInitParserlt_dlerrorlt_dladdsearchdirlt_dlgetsearchpathlt_dlopenlt_dlgetinfolt_dlsymhave_rarcl_engine_newmpool_createcli_dconf_initpthread_mutex_initcli_pcre_initmpool_destroycl_retvercl_engine_set_numcl_engine_set_strcl_engine_get_strcl_engine_settings_copy__strdupcl_engine_settings_applycl_engine_settings_freecli_hashstreamfreadcli_hashfilefopen64fclosecli_unlink__errno_locationcli_strerrorjson_object_object_get_exjson_object_new_arrayjson_object_object_addjson_object_new_stringjson_object_array_addcli_rmdirschmodopendir__xstat64rmdirreaddir64__lxstat64rewinddirclosedircl_engine_set_clcb_pre_cachecl_engine_set_clcb_pre_scancl_engine_set_clcb_post_scancl_engine_set_clcb_virus_foundcl_engine_set_clcb_sigloadcl_engine_set_clcb_hashcl_engine_set_clcb_metacl_engine_set_clcb_file_propsfgetsstrstrcl_hash_datacli_strtokenizestrcmpstrncpycli_strbcasestrcl_cvdheadcl_cvdfreecli_parse_addstrrchrstrcatcli_sigopts_handlercli_ldbtokenizecli_initrootsgzreadmemmovegzgetsferrorcli_chompstrcpystrtoulcli_regcompcli_regfreecli_hex2straccesscli_bytecode_loadcli_bytecode_destroycl_cvdparseload_regex_matchercli_versig2init_whitelistinit_domainlistfilenofmapcl_loadcli_bytecode_initphishing_initcl_retdbdircl_statchkdircl_statfreecl_statinidircl_engine_freepthread_mutex_lockpthread_mutex_destroypthread_mutex_unlockcli_bytecode_donephishing_donecl_engine_compilecli_pcre_buildcli_build_regex_listcli_bytecode_prepare2cl_engine_addrefcl_countsigsgzclosegzdopenfwrite__fxstat64cli_readnlseek64ftellfseekfdopengzseek64cli_versigcl_cvdverifycli_cvdunpackcli_str2hexcl_fmap_open_memorycli_gentempmkdirtext_normalize_initcli_gentempfdtext_normalize_maptext_normalize_resettimessysconfhtml_normalise_mapuniq_getcli_vba_readdircli_vba_inflatecli_writencli_ppt_vba_readcli_wm_readdircli_wm_decrypt_macroinflateInit2_inflateEndinflateResetBZ2_bzDecompressInitBZ2_bzDecompressEndBZ2_bzDecompressjson_object_new_objectcli_utf16toasciicli_ole2_extractuniq_freehtml_screnc_decodecl_fmap_closejson_object_to_json_stringcli_bytecode_context_alloccli_bytecode_context_destroyjson_object_putjson_object_get_typejson_object_get_stringcl_scandesc_callbackcl_scandesccl_scanmap_callbackcl_scanfile_callbackcl_scanfilecli_memstrtableCreatetableInserttableDestroytableFindblobCreateblobDestroyblobAddDatafflushstrcasecmpcli_strtokbufxmlReaderForMemoryxmlTextReaderClosexmlFreeTextReadercli_gettmpdirfputs_IO_putc__rawmemchrhtml_normalise_memhtml_tag_arg_freephishingScanmessageCreatemessageDestroy__strtok_rstrncasecmpstrcasestrhtmlReadMemoryhtmlGetMetaEncodingxmlGetDocCompressModexmlReaderWalkerxmlFreeDocjson_object_array_lengthjson_object_array_get_idxbase64FlushdecodeLinecli_strrcpytableUpdatetableRemovetableIteratestrncatuniq_addinflateInit_uniq_init__strndupcli_ctimejson_object_new_intjson_object_new_booleancli_genhash_pesqrtpowcli_disasm_onestpcpydisasmbufcli_js_process_buffercli_js_parse_donecli_js_outputcli_js_destroycli_js_initvsnprintfstderrmspack_create_cab_decompressormspack_destroy_cab_decompressormspack_create_chm_decompressormspack_destroy_chm_decompressorcrc32xmlReaderForFdxmlTextReaderReadxmlTextReaderConstLocalNamexmlTextReaderHasAttributesxmlTextReaderMoveToNextAttributexmlTextReaderConstValuexmlStrcmpxmlStrlenadler32fprintffputcget_fpu_endiancl_base64_encodeiconv_openiconviconv_closeuncompresscli_url_canonregex_list_matchinit_regex_listis_regex_okregex_list_doneregex_list_add_patterncli_regex2suffixpthread_getspecificpthread_setspecificpthread_key_deletepthread_key_createpthread_oncecli_textbuffer_append_normalizestrtodabortcli_unescapemmap64munmapmpool_getstatsstrnlenpread64cl_fmap_open_handlemadviseputcharhave_clamjitcli_bytecode_context_clearcli_bytecode_context_setfuncidcli_bytecode_context_setparam_intcli_bytecode_context_setparam_ptrcli_sigperf_printcli_sigperf_events_destroycli_bytecode_runcli_bytecode_context_getresult_intcli_detect_environmentcli_bytecode_context_setfileftruncate64cli_bytecode_describecli_bytetype_describecli_bytevalue_describecli_byteinst_describecli_bytefunc_describecli_bytecode_context_set_traceinflateSynclogexpsincosjson_object_get_booleanjson_object_get_intunamefscanfxmlTextReaderNodeTypexmlTextReaderDepthxmlTextReaderLocalNamexmlFreexmlTextReaderValuexmlTextReaderIsEmptyElementxmlTextReaderGetAttributexmlStrcasecmpxmlStrdupxmlStrEqualxmlTextReaderReadInnerXmlxmlTextReaderNextcl_base64_decodejson_object_new_string_lenjson_object_new_doublejson_object_is_typejson_object_getjson_object_array_put_idxjson_object_object_delcli_utf16_to_utf8mktimecl_engine_set_clcb_stats_submitcl_engine_set_stats_set_cbdatacl_engine_set_clcb_stats_add_samplecl_engine_set_clcb_stats_remove_samplecl_engine_set_clcb_stats_decrement_countcl_engine_set_clcb_stats_flushcl_engine_set_clcb_stats_get_numcl_engine_set_clcb_stats_get_sizecl_engine_set_clcb_stats_get_hostidcl_engine_stats_enablegetaddrinfofcntlconnectsocketfreeaddrinfoselectgetsockoptsendrecvcli_pcre_perf_printcli_pcre_perf_events_destroypcre_mallocpcre_freepcre_stack_mallocpcre_stack_freepcre_compilepcre_studypcre_execpcre_fullinfoxmlReaderForIOxmlTextReaderLocatorLineNumberxmlTextReaderLocatorBaseURIxmlTextReaderMoveToElementxmlTextReaderMoveToFirstAttributexmlTextReaderSetErrorHandler__assert_faildifftimecli_strlcpyisattylongjmpstdoutstdin__isoc99_sscanf_IO_getcclearerr_setjmpcli_bytecode_debugcli_bytecode_debug_printsrccli_bytecode_printversioncli_printcxxverBIO_f_base64BIO_newBIO_new_mem_bufBIO_pushBIO_readBIO_free_allBIO_freeBIO_set_flagsBIO_s_memBIO_writeBIO_ctrlSSL_load_error_stringsSSL_library_initOpenSSL_add_all_digestsOPENSSL_add_all_algorithms_noconfOpenSSL_add_all_ciphersERR_load_crypto_stringscl_cleanup_cryptoEVP_cleanupEVP_get_digestbynameEVP_MD_sizeEVP_MD_CTX_createEVP_MD_CTX_set_flagsEVP_DigestInit_exEVP_DigestUpdateEVP_MD_block_sizeEVP_MD_CTX_destroyEVP_DigestFinal_excl_hash_file_fd_ctxEVP_MD_CTX_mdcl_hash_file_fdcl_hash_file_fpcl_verify_signature_hashEVP_VerifyFinalcl_verify_signature_fdcl_verify_signaturecl_verify_signature_hash_x509X509_get_pubkeyEVP_PKEY_freecl_verify_signature_hash_x509_keyfilePEM_read_X509X509_freecl_verify_signature_fd_x509cl_verify_signature_fd_x509_keyfilecl_verify_signature_x509cl_verify_signature_x509_keyfilecl_sign_dataEVP_PKEY_sizeEVP_SignFinalcl_sign_data_keyfilePEM_read_PrivateKeycl_sign_file_fdcl_sign_file_fpcl_get_pkey_filecl_get_x509_from_memPEM_read_bio_X509cl_load_certBIO_s_filePEM_read_bio_X509_AUXcl_ASN1_GetTimeTstrptimelocaltime_rcl_load_crlPEM_read_X509_CRLX509_cmp_current_timeX509_CRL_freecl_validate_certificate_chainX509_STORE_newX509_STORE_set_flagsX509_LOOKUP_fileX509_STORE_add_lookupX509_STORE_add_crlX509_VERIFY_PARAM_newX509_VERIFY_PARAM_set_flagsX509_STORE_set1_paramX509_LOOKUP_ctrlX509_STORE_freeX509_VERIFY_PARAM_freeX509_LOOKUP_hash_dirX509_STORE_CTX_newX509_STORE_CTX_initX509_verify_certX509_STORE_CTX_freecl_validate_certificate_chain_ts_dircl_set_clcb_msgperrorctime_rgetenvcli_filecopycli_ftwcli_rndnumlibxml2.so.2liblzma.so.5libbz2.so.1libltdl.so.7libdl.so.2libssl.so.1libcrypto.so.1libz.so.1libjson-c.so.2libpcre.so.1libpthread.so.0libm.so.6libclammspack.so.0libc.so.6__cxa_atexitlibclamav.so.7CLAMAV_PUBLICCLAMAV_PRIVATEZLIB_1.2.3.3GLIBC_2.2.5LIBXML2_2.5.2LIBXML2_2.5.0LIBXML2_2.6.0LIBXML2_2.5.7LIBXML2_2.4.30GLIBC_2.14GLIBC_2.3GLIBC_2.7                !Ӈ_ )!E7!  3 F!  ui S!W ` _! m! {!!L!  ui S!!!ii !ii !ui S!(Z;@Z;XZ;pZ;бZ;ܯZ;9Z;Z;(Z;[;[;0[;H[;`[;Hx[;8[;[;[;[;б\;ܯ \;98\;P\;(h\;\;\;\;\;\;H\;8 ];(];a0];g8];k@];OH];PP];PPX];P`];Ph];Pp];(Qx];Q];Q]; R];PR];xR];R];R];0S];pS];S];S];T];@T];T];T];U];0U^;pU^;U^;U^;V ^;PV(^;V0^;V8^;V@^; WH^;`WP^;WX^;W`^;Xh^;@Xp^;Xx^;X^;Y^;PY^;Y^;Y^;Z^;@Z^;hZ^;Z^;Z^;H[^;x[^;[^;[^;\^;X\^;\_;\_;]_;H]_;] _;](_;]0_;(^8_;`^@_;^H_;^P_;^X_;0_`_;h_h_;_p_;_x_; `_;h`_;`_;`_;a_;@a_;xa_;a_;a_; b_;Pb_;b_;b_;b_;0c_;c_;c`; d`;hd`;d`;d `;e(`;e0`;f8`;f@`; gH`;XgP`;gX`;g``;hh`;hhp`;hx`;h`;Xi`;i`;i`;j`;Xj`;j`;k`;Xk`;k`;k`;@l`;xl`;l`;m`;@m`;xma;ma;(na;hna;n a;o(a;@o0a;o8a;o@a;pHa;8pPa;ppXa;p`a;qha;@qpa;qxa;qa;@ra;ra;ra;sa;Xsa;sa;sa;(ta;pta;ta; ua;ua;ua;`va;va;pwb;wb;8xb;xxb;x b;0y(b;y0b;8zHb;`b;xb;b;бb;ܯb;9b;b;(c; c;8c;Pc;hc;c;Hc;8c;c;c; d;(d;@d;/Xd;pd;ZSd;'d;+d;:Yd;9d;Be;I e;R8e;ݬPe;he;e;e;e;e; e;e;#f;0(f;=@f;PXf;dpf;xf;f;f;f;f;g;έg; g;0g;@g; Pg;`g;&pg;;g;Mg;]g;ng;g;g;g;g;h;Įh;Ю h;ܮ0h;@h;Ph;`h;ph;"h;1h;Bh;Oh;^h;kh;{h;h;i;i; i;ǯ0i;ԯ@i;Pi;`i;pi; i;i;)i;8i;Gi;[i;fi;ti;j;j; j;0j;@j;Pj;Ͱ`j;ٰpj;j;j; j;j;/j;@j;Qj;]j;nk;}k; k;0k;@k;Pk;DZk;Vk;kk;~k;k;k;k;k;k;k;k;l;l;l;(l;0l;@l;Hl;Xl; `l;pl;%xl;/l;7l;?l;El;Rl;]l;tl;l;l;l;m;m;m; m;@m;˟Hm;Xm;`m;pm;xm;m; m;m;m;m;}m;m;m;n;#n;* n;30n;;@n;W`n;pn;tAn;Fn;Ln;Rn;Zn;yn;zn;do;o;o o;˟0o;x@o;Po;`o;po;o;o;o;o;o;o;o;o;p;p; p;@p;Pp;`p;p;k5p;p;0p;p;11p;p;q;q; q;0q;@q;Pq;`q;pq;q;8q;q;q;q;Nq;Nq;Nq;Nr;Nr;Nr;Nr;N r;N(r;N0r;N8r;N@r;gHr;NPr;Xr;N`r; Khr;9pr;Nxr;Nr;mr;Qr;nr;Nr;r;r;r;r;Qr;B@r;Nr;Nr;Nr;Nr;Nr;Os; Os;Os;#Os;'O s;+O(s;/O0s;3O8s;>O@s;IOHs;MOPs;QOXs;WO`s;]Ohs;cOps;iOxs;oOs;uOs;{Os; s;Os;Os;Os;Os;Os;Os;Os;Os;Os;Os;Ot;Ot;vt;Ot; t;O(t;O0t;O8t;O@t;OHt;OPt;OXt;O`t;Oht;Rpt;Oxt;Ot;Ot;Ot;Ot;t;Pt;Pt; Pt;Pt;Pt;Pt;#Pt;*Pt;0Pt;St;7Pt;=Pu;CPu;JPu;PPu;WP u;]P(u;dP0u;kP8u;qP@u;uPHu;{PPu;PXu;P`u;Phu;Ppu;Pxu;Pu;Pu;Su;Ru;Pu;Pu;%Tu;7Tu;Pu;u;Pu;Pu;Pu;u;Pu;Pu;Sv;Pv;Pv;Pv;P v;P(v;P0v;P8v;P@v;PHv;PPv;Xv;P`v;Phv;Qpv;Qxv;Qv; Qv;Qv;Qv;Qv;gv;v;$v;Qv; Qv;$Qv;(Qv;.Qv;3Qv;8Qv;98v;=Qw;CQw;IQw;OQw;TQ w;ZQ(w;aQ0w;gQ8w;kQ@w;oQHw;sQPw;wQXw;}Q`w;Qhw;Qpw;Qxw;Tw;Qw;Tw;mw;$w;Qw;Qw;Qw;Qw;Qw;Qw;Qw;Qw;Qw;Qw;Qw;Qx;Qx;Qx;Qx;Q x;Q(x;Q0x;Q8x;R@x;RHx; RPx;RXx;7`x;Rhx;Rpx;Rxx;#Rx;'Rx;-Rx;3Rx;9Rx;>Rx;DRx;IRx;ORx;TRx;ZRx;`Rx;!x;eRx;kRx;pRx;vRy;{Ry;Ry;Ry;R y;R(y;R0y;R8y;R@y;RHy;RPy;RXy;R`y;Rhy;-py;Rxy;Ry;Ry;Uy;Ry;Ry;Ry;Ry;Ry;Ry;Ry;Ry;Ry;Sy; Sy;Py;Sy;Sz;Sz;'Sz;4Sz;ES z;RS(z;]S0z;cS8z;hS@z;mSHz;sSPz;xSXz;~S`z;Shz;Spz;Sxz;Sz;Sz;Sz;Sz;Sz;Sz;Sz;Sz;Sz;Sz;Sz;Sz;Sz;Sz;Sz;Sz;T{; T{;T{;T{;T {;$T({;*T0{;1T8{;6T@{;U|;EU|;MU|;TU|;\U|;aU|;fU|;nU|;tU|;|;|;|;};p};};@};` };0(};P@};H};X};`};~p};x};};M};};};};};};>k};~;~;~;M ~;0~;8~;H~;P~;`~;h~;x~; ~;~;~;8~;'~;~;~;~;~;~;6~;?;H;Q ;Z(;h8;@;vP;0X;h;p;;;;_;t;';/;;;;;;;;(;0;@;H;'X;9`;?p;9x;G;U;];e;m;};Ѐ;؀;;G;R;;; ;0;8;H;P;`;h;x;;;;;;; ȁ; Ё; ؁; ;?I;BI;&; ; ;EI;HI; ; (; 0;KI8;3@;PH; P; X;NI`;qh; p; x; ;J; ; ;AJ;  ;s(; 0; 8;DJ@;GJH;JJP; X; `; h; p;MJx; ; ; ; ;; ; ;;A; Ȍ; Ќ;PJ،;:P; ; ; ; ; ; ;SJ;  ; (; 0;VJ8;O@;YJH; P;\JX; `;_Jh; p;bJx; ;eJ;<;hJ; ;kJ;nJ; ; ; ȍ;qJЍ; ؍; ; ; ; ;'<;/; ; ;Q ; (; 0; 8; @;tJH; P;7X; `; h;wJp; x; ; ; ; ; ; ; ; ; ; Ȏ; Ў; ؎; ; ;zJ; ; ; ; ; ;  ; (; 0; 8; @; H; P; X; `; h;';p; x; ; ; ; ; ; ; ; ; ; ȏ; Џ;}J؏; ; ; ; ; ;S; ; ;  ; (; 0; 8; @;kH; P; X; `; h; p; x; ; ; ; ;S; ; ; ; ; Ȑ;WА; ؐ; ;EI; ;f; ;WI;NI; ;K ; (;cI0; 8; @;IH; P;lIX; `; h;Jp; x;P; ; ;[g; ;I; ;J;S; ȑ;IБ;Sؑ;J;; ;7;; ; ;$; ;P ; (; 0; 8; @;H; P; X;O`; h;Jp; x; ;HI; ;TI; ;J;q; ;R;~Ȓ; В; ؒ; ;I; ; ; ; ;i; ;  ;8J(; 0;8; @;JH;RP; X;2J`;J@; H; P;JX; `; h; p; x;SJ; ; ; ; ;I; ;uI; ; Ț;JК; ؚ;I; ; ;&J; ;O; ; ;_r ; (;I0; 8; @;c&H; P;<X; `;Jh;Np; x;ZS; ; ;fI; ; ; ; ;; ț;]IЛ; ؛; ;xI; ;h; ; ;I; ; ;J(; 0;E8; @;SH; P; X; R`; h;-kp; x; ; ; ;I; ; ;Ս;J;w; Ȝ; М; ؜;J;OK; ; ; ;J;J; ;  ; (; 0;8; @; H; P; X;J`; h; p;kx; ;O;R; ;$; ;J; ; ;7ȝ; Н; ؝; ; ;I; ;I; ; ;Q;  ;I(;<0; 8;I@;JH;IP; X; `;kJh; p;:x; ; ; ; ;VJ; ; ;Ik; ;RȞ; О; ؞; ; ;R; ; ;6R; ;R;  ; (;I0; 8;r@; H; P; X; `;h;Kp; x;I; ;`I; ; ;I; ;K; ; ȟ;IП;K؟;u; ; ;S; ;5J; ; ;mR ; (;T0; 8; @;}JH; P;PX; `; h;Op; x;I;K; ;tJ; ;I; ; ;I; Ƞ;rР; ؠ; ;I; ;+Q; ; ;; ;G: ;P(; 0; 8; @;)H; P; X;DJ`; h;=mp; x; ;I; ;~I; ; ;';; ;; ȡ; С;$Rء; ;OB; ; ; ; ;oI; ;  ; P(; 0;8; @; H; P; X;+`; h; p;'x; ;m; ; ;I; ;PJ; ; ;JȢ; Т;Iآ; ; ; ; ;;J; ; ;;  ;2K(; 0; 8; @; H;IP;?KX; `; h; p;x;;;AJ; ;N'; ; ; ; ;ȣ; У; أ; ; ;I; ; ; ; ;/J;  ; (; 0; 8;MJ@; H; P;YJX; `;Ih; p; x;I; ; ; ; ; ; ;:P; ; Ȥ;hJФ; ؤ; ; ; ; ; ;;;RK; ;  ; (; 0; 8; @; H; P; X; `; h; p; x;q; ; ; ; ;JJ; ; ; ; ȥ;AХ; إ; ; ; ; ; ; ; ; ;$ ; (; 0; 8; @; H; P; X; `; h;Op; x; ; J; ;P; ; ;,J; ; ; Ȧ; Ц; ئ; ;Sl; ; ; ; ; ; ;  ; (; 0;8; @; H;JP; X; `; h; p; x; ; ; ; ; ; ; J; ; ; ȧ; Ч;#Jا; ; ; ; ; ; ; ; ;  ; (; 0; 8; @; H; P; X; `; h; p; x; ; ; ; ;\J; ; ; ; ;iȨ; Ш; ب; ; ; ; ; ; ; ;I;  ; (; 0; 8; @; H; P; X; `; h; p; x; ; ;_J; ; ; ; ; ; ; ȩ; Щ; ة;yi; ; ; ; ; ; ; ;  ; (; 0; 8; @; H; P; X; `; h; p; x; ; ; ; ; ; ; ; ;wJ; Ȫ; Ъ; ت; ; ; ; ; ; ; ; ;nJ ; (; 0; 8; @;eJH; P; X; `; h; p; x; ; ; ; ; ;VK; ; ;; ȫ; Ы; ث; ; ; ; ; ; ; ; ;  ; (; 0; 8; @; H; P; X; `; h; p; x; ; ; ; ; ; ; ; ; ; Ȭ; Ь;qJج; ; ; ; ; ; ; ; ;  ; (; 0; 8; @; H; P; X; `; h; p; x; ; ; ; ; ; ; ; ; ; ȭ; Э; ح; ; ; ; ; ; ; ; ;  ; (; 0; 8; @; H; P; X; `; h; p; x; ; ;; ; ; ; ; ; ; Ȯ; Ю; خ; ; ; ; ; ; ; ; ;  ; (; 0; 8; @; H; P; X; `; h; p; x;)J;@<;@<;ȯ;|د;;|;;|;;| ;(;|8;@;9P;X; 9h;p;|;;|;;|;;|Ȱ;а;|;;};;08;;}(;0;}@;H;}X;`;}p;x;#};;-};; б;N{ر;|;N{;:};N{;4};N{ ;9}0;N{8;خH;N{P;`;N{h;x;N{;;N{;;N{;Y;N{Ȳ;>}ز;N{;W;N{;4;N{;3 ;N{(;@8;N{@;C}P;N{X;K}h;N{p;;N{;;N{;հ;N{;ȳ;N{г;;N{;P};N{;;N{;(;N{0;ɰ@;V{H;бX;V{`;ïp;V{x;;V{;z;V{;W};V{;c}д;V{ش;|;V{;j};V{;p};V{ ;0;ܯ8;v}H;ܯP;f`;8h;x;8;*;8;J;8;{};8ȵ;sص;8;};8;};8;} ;8(;}8;8@;}P;8X;h;_{p;};_{;};h{;};h{;}ȶ;h{ж;};h{;};q{;};q{;}(;w{0;}@;w{H;}X;w{`;~; ; ; з;;; ;; ;0;A5@;&P;$`;p;+;4;>; ;D;?и;;I; ;O; ;W0;a@; P;r`;gp;p;;; ;u;yй;~;ۉ; ; ; ;0; @;P;`;p;;; ; ;vr;к;;; ;ƍ;ˍ ;э0; @; P;O`; p;؍; ; ;ߍ; ;л; ; ;!;; ;0;@;P; `; p; ; ; ;; ; м; ; ; ; ;  ; 0; @; P; `; p; ; ;; ; ; н; ; ;; ; 0;@;)P;(`; p; ; ;.;-;,; о;D;G;*; ;  ; 0;2@;1P; `; p;;;%; ; ; п;5;; ; ;8 ;"0;2~@; P; `; p;;:; ; ;[;=;g; ; ; ;( ; 0; @; P;A`;@p; ; ; ; ;C;F; ; ;K;J;D ; 0; @; P;M`; p; ; ;*; ; ; ; ; ; ; ;  ; 0;Q@;PP; `; p; ; ; ; ; ; ;'; ; ; ;  ; 0; @; P; `; p;; ; ; ; ; ; ; ; ; ;  ; 0; @; P; `; p; ; ; ; ;p;;;;(;@;X;p;;;;;;; ;p0;v@;P;{`;p;;;;;;;;;;;  ;0;"@;)P;/`;>p;J;V;b;n;z;;;;;; ;0; @;#P;;`;Qp;k;|;;;;;;;;; ;/r0;@;P;`;p;;;2;A;I;T;a;l;u;; ;0;@;P;`;p;;;#;3;G;V;f;u;;; ;0;@;P;`;p;; ; ;' ;1 ;@ ;U ;d ;t ; ;  ; 0; @; P; h;<;<;|<;@<;<;<(;<H;<h;<;<;<;<;<;<(;<H;<h;<;<;r<;l<;`<;T<(;R<H;@<h;<<;6<;4<;(<;$<;"<(; <@; X;!p;!;+!;=!;bx;jx;xx;x;x;x ;x0;x@;xP;x`;yp;y;y;,y;?y;Oy;^y;ly;y;y;y;y ;y0;y@;yP; z`;!zp;2z;Dz;Rz;^z;oz;z;z;z;z;z;z ;z0;{@;{P;,{`;;{p;P{;e{;r{;{;{;{;{;{;{;{;{ ; |0; |@;/|P;C|`;O|p;c|;t|;|;|;|;|;|;|;|;};} ;}0;'}@;6}P;G}`;]}p;s};};};};};};};v;z;~; ;(;0;8;@;H;P;X;'`;Yh;9p;x;Ѕ;;9;;f';m';t';{'(;'8;'H;'X;'h;';';';';';';';';';'(;'8;'H;'h;(x;(8;hH;qX;(h;(x;((;5(;B(;O(;\(;i(;v(;(;(;g;f;(;(;(;(;((;(8;(H;(X;(h;(x;(;(;(;(;(;(;)8; )X;)h;)x;%);0);;);F);Q);\);g);r);});)8;)H;)X;)h;););)(;)X;););f ;(;8;D@;7P;X;h;Xp;k;;;;;;;;;;;;;;(;0;@;H;X;9`;?p;7x;7;_;t;;;7;7;7;7;;;B;x?;$B ;k0;M8;H;P;`;+h;x;/B;;:B;FB;RB;[B;dB;qB;~B;B;B;B;B;B ;B(;B8;B@;BP; CX;Ch;!Cp;4C;;;FC;UC;;;gC;rC;C;C;C;C ;g(;50;g8;g@;gH;hP; hX;h`;hh;/hp;(hx;8 <G8 <P8 <`8 <s8 <8 <8 <8 <8 <8 <8 <u <8 <9 <w9 <;( <;0 < <8 <8@ <8H <8P <8X <9` < 9h <;p <B<x <9 <$9 <,9 <69 <<9 <L9 <_9 <n9 <~9 <9 <9 <9 <9 <9 <9 <9 <9<9<9<:< : <:(<:0<%:8<.:@<6:H<B:P<J:X<T:`<\:h<d:p<m:x<~:<:<:<:<:<:<:<:<:<:<:<:<:<;< ;<;<#;<*;</;<6;<:; <B;(<M;0<X;8<^;@<h;H<p;P<z;X<;`<;h<;p<;x<;<;<;<;<;<;<<<<<<<#<<*<<2<<;<<J<<R<<\<<<<a<<l<<r<<w<<f<h0<fH<fx<f<q<f<f <ƭP<fh<f<\<fX<fp<f<g<f<<f< g0<gH<f`<g<.g<;g@<Bg<Ig0<Mgx<Tg<Zg <^gP<dg<jg<YS<rg@<xg<g<o<q<g<pH<g`<gx<gP<g<g<g<g<g@<g<!t<g<g0<gH<g`<g<g<g8<kqP<o<g<g<g<g(<Yq@<g<h<h <Dqx < h <h !<j8!<h!< h("<$h@"<*h"<1h"<7hx#<=h#<Ch $<Ghh$<Nh$<Th$<R$<s$<vnp%<Zh&<_h'<S'<fh'<&n'<mhX(<sh(<zh(<h(<h)<o)<h)<h)<h)<h(+<hp+<h+<J8<8<i9<i9<i9<i@:<k;<i;<i0;<ix;<i;<h;<i <<i8<<ih<<i<<i<<j<<j<<j=<j@=<p=<=<j=< j><k><%j ?<)j?<-j?<3jp@<m@<9j@<>j@<Ej@<Lj@<RjA<i&A<XjHA<^j`A<djhB<HhB<jjB<!nB<pjB<tj(C<{jXC<jpC<jC<jHD<j`D<jE<j8E<jPE<jE<jF<jpF<jF<jhH<llH<jH<jH<jH<jI<qI<jI<@qI<jI<jJ<j0J<jHJ<j`J<jxJ<kJ< kJ<kJ<kJ<kK<$k8K<)kPK<0kK<kK<7k@L<>kXL<IL<L<EkM<LkM<Sk N<$PN<ZkhN<qN<^kN<bkN<ikpO<okO<$O<vkO<zkP<kP<k0P<kHP<k`P<kP<kQ<k8Q<kQ<kQ<kQ<n(R<k@R<kpR<kS<rS<kHS<kxS<kS<kS<kS<qT<k8T<khT<kT<kT<k(U<lXU<lpU<11U< lU<lU<lU<lV<$lV<)lV<1l W<5lPW<;lhW<@lW<ElW<IlW<Ll@X<RlX<VlX<[lX<_lY<dlY<kl0Y<ql`Y<wlxY<}lY<lZ<l Z<lPZ<lhZ<lZ<lZ<lZ<Ot\<lx\<l\<h\<l\<lP]<lh]<l]<]<l]<l]<l]<l^<l@^<lX^<tp^<k^<l_<l`_<l_<m_<m`<`< m(a<mpa<ma<m`b<#mxb<)mb</mb<5mhc<jc<:m@d<@mXd<Gmd<md<KmHe<Qm`e<Xmxe<_me<le<emhf<of<jm(g<omXg<Ohpg<umh<|m0h<mHh<m`h<mxh<mh<ti<m i<mj<h(j<mpj<mj<mj<mj<mj<mk<2`k<nk<mk<ll<ml<m(m<mm<mn<m0n<h`n<mxn<mn<mn<no<np< nq<n0q<nq<nq<%nq<*nq<0nr<ir<7n(s<>n@s<CnXs<Ins<Pns<Uns<\ns<bnt<=qt<hnt<ont<tnu<zn8u<nPu<nu<nu<n(v<nXv<nHw<nw<nw<nx<nhx<nx<gx<nx<nx<n(y<n@y<npy<Asy<ny<n`z<nz<nz<n{<n{<n{<n|<n|<o|<s}< o}<o}<qP~<VJ~<o<o(<oX<h<#oH<*o`<1ox<6o<r<Dr <Ir8<tP<Nrȫ<Ur@<\rX<br<<ir<orЬ<rr<xrH<Ypح<}rh<rȮ<r<S<r<rH<rx<r<r <mP<h<r<rX<rp<pв<r<r0<r<r<r8<rP<rh<r<r<s<r <r8<rh<sȷ<rX<s<B&<s<s<s`<s<s<"s<)s<.s<4s<o<;s<@s0<Gs <Ls8<SsP<Ys<_s(<fq@<fsо<ms0<ts <ys<s<s<s<s<s<s<s0<s`<s<sP<sh<s<s<s<s<s<s<s0<sH<s<s<s<P<t<8<t< t<_g<t<tx<t< t<'t<.t <2t<9t(<eop< H<= P<> X<= `<> h<= <܊<<<<*< <8<P<.h<3<;<x<l<l<</<T<}<l<l<</ <T(<Ah@<H<P<X<`<h<p<x<<< <<!<+<4<><J<U<`<m<w<<<<<<<< <(<0<8<$@<1H<CP<RX<]`<hh<sp<~x<<<<<<<<<<<<"<3<A<O<\<h<z<[<[<<<<<C<C(<C8<CH<C`<<`L<<<<<•<ƕ<}<7{ <ʕ0<Е@<ӕP<ݕ`<p<<<<<<<<<<X< <0<@<!P<%`<)p<-<1<5<r<<9<=<A<D<H<K <O0<R@<P<ו`<Vp<g<v<<<<<<<Ӗ<ܖ<m <k0<@<(qP<`<kp<<<<<jo<< <<<<  <'i0<%@</P<>`<Jp<\<j<x<<<<<Ɨ<ؗ<< <0<@<P<%`<1p<o<E<I<Ș< <<< </m<y< <O<@< <<L< <7 <h(< 0<U8<[@< H<vP<șX< `<|h<(p< x<ו<< <<< <<< < <R<^<|<< <0<ɚ8<ԚH<P<`<h<x<8<C<_<j<<<<<ț<ӛ<<<<H <(<8</@<pP<:X<h< p<;2;@;A;M;N;];_ ;(;0;8;@;H;`;5h;\;;;;;;;;; ;(;0;8;@; H; P; X; `;h;p;x;;;;;;;;;;;;;;;; ;!;";#;$;& ;'(;(0;)8;+@;,H;-P;.X;/`;0h;1p;4x;6;7;8;;;<;=;>;?;B;C;D;E;F;G;H;I;J;K;O;P;Q ;R(;S0;T8;U@;VH;XP;YX;Z`;\h;^p;`x;b;d;e;f;g;h;i;k;l;m;n;o;p;q;r;s;t;u;v;w;y ;z(;{0;|8;}@;~H;P;X;`;h;p;x;;;;;;;;;;;;;;;;;;;;; ;(;0;8;@;H;P;X;`;h;p;x;;;;;;;;;;;;;;;;;;;;; ;(;0;8;@;H;P;X;`;h;p;x;;;;;;;;;;;;;;;;;;;;; ;(;0;8;@;H;P;X;`;h;p;x;;;;;;;; ; ; ; ;;;;;;;;;; ;(;0;8;@;H;P; X;!`;"h;#p;%x;&;';(;);+;,;-;/;0;1;2;3;4;6;7;8;9;:;<;=;> ;?(;A0;B8;C@;DH;EP;GX;H`;Ih;Jp;Kx;L;M;N;O;P;Q;R;S;T;U;V;W;X;Y;Z;[;];^;`;a;b ;c(;d0;e8;f@;hH;jP;kX;l`;mh;np;ox;p;q;r;s;t;u;v;x;z;};~;;;;;;;;;; ;(;0;8;@;H;P;X;`;h;p;x;;;;;;;;;;;;;;;;;;;;; ;(;0;8;@;H;P;X;`;h;p;x;;;;;;;;;;;;;;;;;;;;; ;(;0;8;@;H;P;X;`;h;p;x;;;;;;;;;;;;;;;;;;;;; ;(;0;8;@;H;P; X; `; h; p; x;;;;;;;;;;;;;;;; HH9Ht.詚H59%9@%9h%9h%9h%ڣ9h%ң9h%ʣ9h%£9h%9hp%9h`%9h P%9h @%9h 0%9h %9h %9h%z9h%r9h%j9h%b9h%Z9h%R9h%J9h%B9h%:9hp%29h`%*9hP%"9h@%9h0%9h % 9h%9h%9h%9h %9h!%9h"%ڢ9h#%Ң9h$%ʢ9h%%¢9h&%9h'p%9h(`%9h)P%9h*@%9h+0%9h, %9h-%9h.%z9h/%r9h0%j9h1%b9h2%Z9h3%R9h4%J9h5%B9h6%:9h7p%29h8`%*9h9P%"9h:@%9h;0%9h< % 9h=%9h>%9h?%9h@%9hA%9hB%ڡ9hC%ҡ9hD%ʡ9hE%¡9hF%9hGp%9hH`%9hIP%9hJ@%9hK0%9hL %9hM%9hN%z9hO%r9hP%j9hQ%b9hR%Z9hS%R9hT%J9hU%B9hV%:9hWp%29hX`%*9hYP%"9hZ@%9h[0%9h\ % 9h]%9h^%9h_%9h`%9ha%9hb%ڠ9hc%Ҡ9hd%ʠ9he% 9hf%9hgp%9hh`%9hiP%9hj@%9hk0%9hl %9hm%9hn%z9ho%r9hp%j9hq%b9hr%Z9hs%R9ht%J9hu%B9hv%:9hwp%29hx`%*9hyP%"9hz@%9h{0%9h| % 9h}%9h~%9h%9h%9h%9h%ڟ9h%ҟ9h%ʟ9h%Ÿ9h%9hp%9h`%9hP%9h@%9h0%9h %9h%9h%z9h%r9h%j9h%b9h%Z9h%R9h%J9h%B9h%:9hp%29h`%*9hP%"9h@%9h0%9h % 9h%9h%9h%9h%9h%9h%ڞ9h%Ҟ9h%ʞ9h%ž9h%9hp%9h`%9hP%9h@%9h0%9h %9h%9h%z9h%r9h%j9h%b9h%Z9h%R9h%J9h%B9h%:9hp%29h`%*9hP%"9h@%9h0%9h % 9h%9h%9h%9h%9h%9h%ڝ9h%ҝ9h%ʝ9h%9h%9hp%9h`%9hP%9h@%9h0%9h %9h%9h%z9h%r9h%j9h%b9h%Z9h%R9h%J9h%B9h%:9hp%29h`%*9hP%"9h@%9h0%9h % 9h%9h%9h%9h%9h%9h%ڜ9h%Ҝ9h%ʜ9h%œ9h%9hp%9h`%9hP%9h@%9h0%9h %9h%9h%z9h%r9h%j9h%b9h%Z9h%R9h%J9h%B9h%:9hp%29h`%*9hP%"9h@%9h0%9h % 9h%9h%9h%9h%9h%9h%ڛ9h%қ9h%ʛ9h%›9h%9hp%9h`%9h P%9h @%9h 0%9h  %9h %9h%z9h%r9h%j9h%b9h%Z9h%R9h%J9h%B9h%:9hp%29h`%*9hP%"9h@%9h0%9h % 9h%9h%9h%9h %9h!%9h"%ښ9h#%Қ9h$%ʚ9h%%š9h&%9h'p%9h(`%9h)P%9h*@%9h+0%9h, %9h-%9h.%z9h/%r9h0%j9h1%b9h2%Z9h3%R9h4%J9h5%B9h6%:9h7p%29h8`%*9h9P%"9h:@%9h;0%9h< % 9h=%9h>%9h?%9h@%9hA%9hB%ڙ9hC%ҙ9hD%ʙ9hE%™9hF%9hGp%9hH`%9hIP%9hJ@%9hK0%9hL %9hM%9hN%z9hO%r9hP%j9hQ%b9hR%Z9hS%R9hT%J9hU%B9hV%:9hWp%29hX`%*9hYP%"9hZ@%9h[0%9h\ % 9h]%9h^%9h_%9h`%9ha%9hb%ژ9hc%Ҙ9hd%ʘ9he%˜9hf%9hgp%9hh`%9hiP%9hj@%9hk0%9hl %9hm%9hn%z9ho%r9hp%j9hq%b9hr%Z9hs%R9ht%J9hu%B9hv%:9hwp%29hx`%*9hyP%"9hz@%9h{0%9h| % 9h}%9h~%9h%9h%9h%9h%ڗ9h%җ9h%ʗ9h%—9h%9hp%9h`%9hP%9h@%9h0%9h %9h%9h%z9h%r9h%j9h%b9h%Z9h%R9h%J9h%B9h%:9hp%29h`%*9hP%"9h@%9h0%9h % 9h%9h%9h%9h%9h%9h%ږ9h%Җ9h%ʖ9h%–9h%9hp%9h`%9hP%9h@%9h0%9h %9h%9h%z9h%r9h%j9h%b9h%Z9h%R9h%J9h%B9h%:9hp%29h`%*9hP%"9h@%9h0%9f%9f%9f% 9f%"9f%"9f%*9f%B9f%9fAWAVEAUATAUSHӺDMH(H$t$L$;HHD$YDT$H=h1EHL$L$uHHuaHT$L^tH$hLLHE$hXt$H$pYH$p1FH(HtHT$H0LH=҃@Ѕt(H598tH=L1AM11HLE11AHLIt 1uH=1aEpD}u"9|=H=1D3D9tH=1D]A@~H= 1?HD$pH|$p"HH$HD$1H|$LetAMH$HHCXL,кHHH=1]$tHt$pH$a$tHt$xH$E$tH$H$&H$Ht H$ 8@HL HHEuH=G$$`AED$8tA`AIPAHHp H$`tA`AH=11$tHt$pH$5$tHt$xH$$tH$H$H$Ht H$HH$`]A1H,IHD$@D$HD$ HD$8HD$IcHD$(HD$HL$ E1:\$*u~tRI t@Ht$@HT$0H=1HI7HL IG8IG0H|$H?*ut 1HIGXIGPH|$P?*uuIGHIG@ 1HIGHIG@H|$X?*utBߤAGlu5HI7HLAt]IRH|$h?*u t 1CAGhAGdHD$IGxL51 HtL6EuH=1+)tH=!1D1Mt D$A1HĈ []A\A]A^A_AWAVAUATIUSH H|$(H@HT$LD$0.HŸHIu6HD$H$D$@@E1HD$HD$P\$DHD$8F [HHD$uH==IHNvAĀ$#u#HL$0HT$( H|$NHu!H|$JItHt$H|$AHL$8H|$:xtH=D1H|$h1HHtH=DqIHuI(Hu^HT$Ht$P胬$I0T$DH=Ht$PЅt(Ht98Ht$PH=X1Lt$h|L肴tH=_D1AANȃt tH=_D1AIL$LAM~A@DD$HLLH\AA0HsLL$ PHiV HdLL$ HCL$LDD$HAq0HHiAQ0H0IvD)H{AAW AO ʁxAWAO 9‰W ^AWAO 9ЉWDIHI9uLC,I~,V N ʁA$VN 9AP  VN 9APHIH9uLCPIV>w AOw 9AH Ow 9AHHIH9uLCtINP2z A0rz 9Ap rz 9Ap|HIH9uLIVb1y A0qy 9Ap Wqy 9Ap>HIH9uHMFt r Jr 9ȉO Jr 9ȉOHHL9u1ANtA~u ωANvAFw AFxAVy ЉAVzAv{ gdIHt$Pa HHtlHD$XUE1HD$ A9Es&HEH|$ T$HJ47IOT$H^A9AVIHuH HHE8It H|$EuH=1tH= 1DH|$t HD$\$@I1H=D1PwH=DD15\H=aD1AH=D1&H=D1 H=D1H=D1IlIHt$XDL< HIED3HD$`E1UHD$ A9Es"HEH|$ T$HJ4iIOT$HuA9uSIAVHuIH) HHE3IHt$`DL< HIEDs}vH= 1}wD$@HĈ []A\A]A^A_AWAVAAUATUSHHHB t$ L$H<$H@XLLxL0A0AA&<A0ALl$0AALtL8t$ H<$LL$ 1A HLd$ Ll$(Z1HSht$ H<$HHT$HD$HT$HHShH:E11LLHZu C2 uuE11LLHZHSh$HHRXHD$HShH$L$[LS$u1C2 =H[]A\A]A^A_Hal9ATIUS8tH=1ID$ Hx HøHt]Ht H= 1HH,LHID$ x(uHHO[]A\ATUISHG HHx yHøHtjHt,Hk98tH=x H1H-HLHamID$ x(uHtH=1]HuHE Hx 蛷HIuUI1HDTHuHE x(uLLAAǻHat)A>tH=L1ĽLzHW:HL$ LDHHL$AaHL$D$EHHHHD$A>tH=1VE011D`HuA>tH=x1' ARjE111AHDa_A[A\H5UH1~HHr@H9H)HD$XH W:LH|$tùDً|$dhoLt$PH\$0AHQ98HsHKEjC HE1PDC$HH_ȋE0^_{$HQ98tH=N1Pj11E1AHDD^ZYH57Hx}}EtHU:D$dLH|$AtøEnHU HB8Ht-HM(H9|HD$ DHx(MH|$ C4HB@HD$Xf11?HuHP9 8tH=1|$dH?o|$dA裯HE x(t A@H|$T\H;P98tHFH=<H1蕺D$E2 ~H<$ H$C 9ttL1LKMtL1IK$S H=0HsPC(P1/AXAY AADAuAD1DH|$HHLl$(AnȸH|$ DH T:HE x(uL7LMtI}MeLMHO98tH=11tE2 t6|$t/(AA MEA9Hx[]A\A]A^A_AWAVAUATUSHH L%N9HGhA<$L0tH=1Ll$01HLpL'A<$tH=1褸HChH8 y sD$$xH5q荶HIu|$$HC HT$$Ht$(Hx 諽t-A<$tH=1 L(|$$ϬWL$E1 LL~AH=E11IcHM{t LѮb|$$L9t|$$aL詮MHC HT$$Ht$(Hx uH$HD$1HD$vA<$tH=1HL D$PHL$H=)E1HH)H1H HHD$zAoD$8LH)WM~PL9xAF I)HLL9LF1LAV`HHD$0LD|$8HD$1LD$P HD$HAD$ +T$PHt$|$$蠿L0|$$H|$(ͪH|$(/3pA<$tH=HDL|$$跪H|$(}H|$( |$O|$P uA<$t:H=n1觵*A<$#H=1茵Et|$t InP|$P{L:|$$HiucA<$tHzH=6H1'|$$ީHC x(uH|$(蚩tH|$( DH|$(3|$$蛩HC x(uH|$(W EH|$(HĨ []A\A]A^A_AWAV1AUATUSH11Hh Ld$Lt$`LLLt$(D$0 茿t*HI9:H=\13HE HT$Ht$Hx 臹u 1E1HI98tH=<1Lշ?HEhHL@PL9skI)ع HI MHLC1LP`HLDLMHD$Dl$t0L足AuAD$0t_AtY|$tE11HH98H=1@HH98H=AD1¹ |$H)Ѻ L)I5T$0 HH)H9t[HcH98tH=1ȲL谶|$wHE x(uH|$3H|$H=E11LHuuALt$(D$0 L=|$HfuhHG98tHwH=yH1|$̦HE x(uH|$舦tH|$ BH|$ܿ1|$艦HE x(uH|$E EH|$詿Hh []A\A]A^A_AWAVAUATUSHH臿HuH=1lLd$ Hù1LLH$pHDŽ$ t"H=1H^HE HT$Ht$Hx UAt&H=1L HȾDH9F98tHt$H=1虰E1E1H$xuxHEhHL@PM9s2M)LIMHLC1LP`HLDE11MMH$hL$xuH=r1A%(LH At7uH5dHqAH=[1AܴH$Ht A|$HH)IHL$ҸHL$HH9tH='1A肴H=E11LHrtH=L1AH$pHDŽ$|$HecAu%HD98tHtH=H1L |$藣HE x(uH|$SEu DEH|$豼H詼DHĘ[]A\A]A^A_AWAVAUATIUSHHHL5C9A>tH=1]HD$ AH$H<$1ID$ Hx 胧HHH蚻At*A>tH=&H1HAzID$hH$HHH8uE1D$ID$ x(uH)HA覻A>%MH=MH1|L$T$LD$jjDL$DD$0Ht$ `PZYtoL$T$H=E1LptH|$Ht%H4$HHD$舓tA>7豰H=:H1AD$2 uHAEHźIAcH4$HtA>tNH=H1}|$$11舴HuA>tH=-1O|$$L`|$$D$ |$ uNA>tLqH=H1AD$2 uH|$Ht8HD$(1AH|$HtڹHD$ID$ x(uH.H讹H|$Ht蟹EEA>tH=1vDEHHD[]A\A]A^A_AWAVAUATIUSLHHG t$@HL$(HD$`@Ht;G4w#n IEhIL8 @HL$`L|$@Et$@D@RSE11Iž Y^? I1Ҿ E1D HD$XAE4Lt$`D$XﾭHD$0HD$\HD$8D$@-D$DM AvIWPLE1pIvH AF=0sw_=+@w&=='= /=-`=.k=/R =7w,=2t=3=4G =9=:=< E1AE0 IE`@ H>98tH=K1%LE1ʼn AE1@ IE`@ Hy>98tH=!1ިLE1d ʼn AE3{ IE`@m H2>98tCH=>1藨3AE3F IE`@8 H=98tH=1bLE1ʼn AE3 IE`E1@ H=98tH=1LE1}=ʼn |$@ H=98 E1AE0 IE`@  LHD$h IWPI+VLD$\mL%!=9A<$tAvH=g1耧|$\uBIE HL$8HT$hLHp t"A<$tH=S1DAIVHL$0L|$\E1H|$h|$\țIE x(u H|$h脛 EAąEEH|$hܴ|$@}AE0rIE`@ dIWPLH)tlH<98tAvH=1vIvLE1E1|$@  AE0IE`@ IWPLH) lH;98tAvH=s1IvLE18E1|$@AE0IE`@ IWPLH)kH1;98tAvH=)1蒥IvLE18|$@*AE0IE`@IWPLH)!kH:98tAvH=1#IvLE1贍AE0IE`E1@IWPLH)3jH^:98tAvH=1迤IvLE1& e|$@GAE0<IE`@ .H$IWPLH)0DjH998tAFH=p1CIFLE1HpAE0|$@IE`E1@ IWPLH)1iHl998tAvH=e1ͣIFLE1Hp:ooAE0T|$@FIE`@ HIWPLH)1XiH898tAvH=Q1ZIFLE1Hp跡 E1AE0IE`@H898tH=1 LE1, AE01Lc =5ugIE`E1@HL89;tH=1豢IWP5Lh;tAvH=Z1艢1LE1} 1E1&IU`ABH798tAvH='1;1LE1d |$@AE1@IE`@IWPLH)gHm798tAvH=1ΡIvLE1tAE0 i|$DtE1|$@QIE`E18AIE IWPH;v#H698 H=1V H)L!gHD$pH$HDH4$LIFD$x'TH698tAvH=`1H|$pHtH<$H(EIFHD$ IEhHHD$IE Hx HHXHǺ1B賠$y)H=H1A腥H߻ pHD$HD$H@PH+D$ HD$HD$D` L;d$LGd$EMcHt$ Ht$1LLD$HHP`HLD$Hu:<$軔IE x(uHyQHA ֭LD$H=L)D$HT$E11LHD$H!cupLL$H<$DLʨA9:H598tH=.1g<$IE x(uHݓHA:AE4<$LEe@AE@bSEe@uXH498tLdH=H1<$蝓IE x(u H[u7HA輬nAM4<$fIE x(u!H$tHA 腬7HA1s%H=z1E1֦E1 AtAuM6A(t )tVLd=1tAE0tx|$@t |$@udIE`@tZHD$(L([ABIWP)LcAE0t*|$@u IE`@tHD$(L)[AI1Ҿ D AM4H|$`HtHHD$`Tu%H298tLbH=QH1H[]A\A]A^A_USHH|HtVHT$H5*HHu!臠HHD$t,H5*HHkH3Ht H|$H聟H[]ATUSH5 Z IH@$HU$H5Y L9p$H5f_ L1$Ef=$$H~HcHH57_H#H50_H#H5+_H#H5'_H#H5%_H#H5_ H#HVariantID$nitH$r#H5^ H\#HVariantCD$opyH$A#H5^H+#H5^H#H5^H"H5^H"HSafeArraH$HyCreateHD$"H5^H"HSafeArraH$HyGetDimHD$"H5^Hy"H5^Hc"H5^HM"H5^H7"HSafeArraH$HyUnlockHD$"H5V^H!H5T^H!H5T^H!H5R^H!H5P^H!H5H^ H!H5?^H{!H5;^ He!H50^HO!H5-^H9!H5)^H#!H5(^H !HGetActivH$HeObjectHD$ H5^H H5^H H5^H H5^H H5^H} H5^Hg H5^HQ H5^H; H5^H% H5^H H5^HH5^HH5] HHVarI2FroD$mI4H$HVarI2FroD$mR4H$HVarI2FroD$mR8H$|HVarI2FroD$mCyH$aH5]HKH5] H5H5y]HH5q]H HSafeArraH$HySetIIDHD$H5G] HHVarI4FroD$mI2H$HVarI4FroD$mR4H$HVarI4FroD$mR8H$HVarI4FroD$mCyH$eH5\HOH5\ H9H5\H#H5\H HSafeArraH$HyGetIIDHD$H5\ HHVarR4FroD$mI2H$HVarR4FroD$mI4H$HVarR4FroD$mR8H$HVarR4FroD$mCyH$iH5\HSH5\ H=H5 \H'H5\HH5[HH5[ HHVarR8FroD$mI2H$HVarR8FroD$mI4H$HVarR8FroD$mR4H$HVarR8FroD$mCyH$yH5[HcH5z[ HMH5q[H7H5i[H!HVarFormafD$tH$H5G[HH5@[HH58[HH50[HH5([HH5 [HH5[HmHVarDateFH$HromDispHD$KHVarDateFH$HromBoolHD$)H5ZHH5Z HHVarCyFroD$mI2H$HVarCyFroD$mI4H$HVarCyFroD$mR4H$HVarCyFroD$mR8H$H5TZH{H5LZ HeH5CZHOH5;ZH9HVarFormaH$HtNumberHD$H5ZHH5 ZHH5ZHH5YHH5YHH5YHHVarBstrFH$HromDateHD$qHVarBstrFH$HromDispHD$OHVarBstrFH$HromBoolHD$-H5|YHH5wYHH5pYHH5hYHH5`YHH5XYHHVarBoolFH$HromDateHD$H5.YHqH5&YH[HVarBoolFH$HromDispHD$9H5XH#H5XH H5X HH5X HH5X HH5X HH5X HH5X HH5XHsH5XH]H5XHGH5XH1H5XHH5XHH5XHH5XHH5XHHDllCanUnH$HloadNowHD$H5PXHH5LX HuH5CXH_H5AXHIH5?XH3H5:XHH5:XHH56XHHVarIdivH$H5XHH5XHH5WH$VarOfD$rH5WHsH5WH]H5WHGHLoadTypeD$LibH$,H5WHHRegisterH$HTypeLibHD$H5jWHH5jWHH5fWHH5cWHH5TWHH5EWHpH56WHZH5/WHDH5'WH.H5WHH5 WHHVarRoundD$H$H5VHHVarDecAdfD$dH$HVarDecDifD$vH$HVarDecMufD$lH$H5W\HpHVarDecSufD$bH$VHVarDecAbfD$sH$<H5;VH&H53VHH55VHH57VHHVarDecFifD$xH$HVarDecInfD$tH$HVarDecNefD$gH$H5UHH5U HjH5U HTH5U H>H5U H(H5UHH5U HH5UHH5UHH5UHH5U HH5U HHCreateErH$HrorInfoHD$lHVarDecRoD$undH$QHVarDecCmfD$pH$7HVarI2FroD$mI1H$H5U HH5U HH5T HHVarI4FroD$mI1H$H5T HH5T HH5T H}HVarR4FroD$mI1H$bH5T HLH5T H6H5T H HVarR8FroD$mI1H$H5mT HH5dT HH5[T HH5RTHH5JTHH5CTHH5uH50HwCfAŃ$E$ H88tH= 1eLsHD$@H|$hHQ8L|$Lt$88H= 1eH8L|$ Lt$88uH= 1qebH8L|$Lt$88CH= 1?e0HD$@D$(LD$HL$XT$pHt$0xAHD$`HHt>H5i: a HHD$u1Hd88H= 1dHD$$0HD$ H$DLQ$BAxkD$(LD$HL$XT$pHt$0CH\$HpLH)HHG1HAV`Ht8HHnHI-LSHIE11Lq,LHIZH|$ u=.LFfHHMH59HVhL)Hl$ 1HLHHHX*LH88tH= 1cLqH$DL~H$HAHD$(LD$HL$XT$pHt$0~$H\$HpLH)HHG1HAV`HHHlHIH88EH=m 1.b21+L|$Lt$81 L|$Lt$8AVHt$PLAWxL$1I4,H,H{jHu;H|$ .LgdHHtRH5+7H{ft0H57HcftH5HKfu L)Hl$ 1HLHHHHD$ 1HLHHHXt6Lu(H881H=i1`HD$ H|^HHu(HZ88H=U1`1҃|$(u,Ht1H9L$ tHH$H$H$gH$HH$H$I< HHT$ 1H.H9t9H$H$fH$HH$I4D HH|$t|$(H|$HH1T E11HHHJ LL$(HHQcmLL$(IIuȈHHHD$xH1HHmD$(H54HAdH5H%d1HLHHHHD$ HD$ H|\HHu(H88H=1^1҃|$(u,Ht1H9L$ tHH$H$H$?eH$HH$H$I< HHT$ 1H.H9t9H$H$dH$HH$I4D HH|$t|$(H|$HH1R E11HHHJ LL$(HHQkLL$(IIuȈHHHD$xH1HHkD$(E11}H[]A\A]A^A_AVAUATUSH HT$ L$D$D$D$D$XIHMVHH>H5L~HfHHu.HQH88H=IH1\D$ H=)HHD$D$ D$P6D$T$fHu;HdH QHjH 88H=H1j\yH|$Hٺ.fHtH=*OHٺ fHtH|$ HٺeHkH|$HٺeHKH|$HٺeH+H|$HٺeH H|$HٺteHH=yNHٺReHD$D`D;d$s(D$ Hٺ4AHcI<eHuHbD;d$sHO%AH88tH=aGHL1ZHhH []A\A]A^AWAVAUAT1USHH\$0|$Hl$PLd$pL$L$H{ LU HT$ M|$ M] HL$(H|$I~ HL$(HT$ (A B H$8B(H$@B0H$HT$H$HHT$ A A H$0 A H$P A H$X  H$` HL$T HH Bk|$LME1ME1II11CCD+A+|$(Ht$ LD$LL$*dH,|$(LL$LD$Ht$ 9w-HT$C + 1)у3k<1ҹd)9BHHuIAI`HD1[]A\A]A^A_AWAVAAUATIUSIHEHhH-J8DD$}tH= HS}tH= L9ALd$PI} 1ɾLQ}tH=n L LL^I}(1ɾLBQ1H$tH$1HHHqH Ht$0t}H=1Wǃ eHHCxuH=\-H$Ht$0E1A LHW}<HsxH=!AG*ADCpAEA!DD$DDL$ATDHHT$^HIHhMV DD$DL$LHHT$L׹LMVDEL$HshLHD$AN@Lt CDDLd$ H=E1LLcLdAA(tX$ADF$EADA2HD$HT$H=JE1LLDL$cADL$uADD'dHHCxHL}tH=L芾}tHsxH=nADdHt$H|$0Lt$PHsxLd$0DL LLc }tH= L  LL \}t-H=1-U}H=1UK H|$HDL$HD$i H|$L L$HD$)}tSpHshH=Z}tH=L@LL@[E1LAwbE%}H==1NTDCpAP DD$HHT$[HIHHt$H@ L$HshHT$E1HH=LLTaHD$0HsxDDHHD$HL$PHHHL$6 H|$L HD$1A9Hsx@@2<@<HHh[]A\A]A^A_USHAP@1LcIЃ#TA8H@4w@@ t{w@t{@ HcɃ @,tj@2tr@*)@t8w@t&@t|@@v @tJIgHAVLHcɃ* >14HcɃ2 &Hcɀ< u˃xHcDÀ< HcD DuDDÃDɃ DDÃDɃ H88t9@H=1Q%$uz$t!Hj88tH=}1QEZ[]AVAUATUHSLnH.LPHu&H88H=:L1}QHpHI1HHуA|$ED$H'CHh Av(u MfInwH$HHIE1E;V(sIDLH4] AH$HtOH u8Av(L$LHL# Ht$Lpt Lt I~I~ Av(uAv(u%IFgH$HIFuH$HHIF1A;F((ININݾ L' Ht$`L- I~ $u$1AF,H$Hk8HIFu=A;^,sHk8I~IIGH HIGIHPI8 H$D$0L4$HD$@H$L$0;H,;H$Ht$ LLXe $ \$0Hk8Lۅs u H1H$HHHu;$sHH;HLE1IE1D$8HA HHnHuHZ} IL4$IL4$nHCHHHHCHJH D*LH9H)HAHCHA  ExDuDeD$8D$8;$s}l$8HCHI/HtXHHCHHPHD(1D@@H9HKHt"HLL$HHKH LAL BL IL4$HELIAEDc$u HCdH$DHHHHCE1MLkLL7IuL#IL9uE9iDD)k(u HC&H$HHHCFu1E18A9HGyHC(^HCLJ4IÅu?D9w@} A Ht$@HHDŽ$I߅D$0 LIE1E;f,sjDHk8I^HFH{uAH$HHHC1E1D9vHCLJ4H Av,HL$MHLHDŽ$HDŽ$uH$H$1-H$LAT$H$LAT$ZA;V,s͉Hk8D7INDA,4q0L'L4$9vHk8H $HD4HD$(HHt$ L H$H u=E1D9vHt$L\IÅ>Ik8$H $DHPHvHtLUtHD$(H8HD$H8H$H8HD$uL,$1D$0MAH$H4HL$(HHu HD$H$0HHL$HHtHD$H$H4H$HHpAD$4uD$0I8D;l$0u1H$ AuCL\$(DT1D9t2Ht$L~IH$H H$HD$(LAZHJ4Ht$8MDHt$8H)HlH$ Dt1Ht$H$Ht$ LthHL$;sHHH$D$81H,9tHu8uL$8H8Hk8H$Lt$0H,$HD$PHl$@1H$H t$8L$LHL$HT$PHDŽ$HDŽ$j2L4$E1DALAH;\$@ s4u{,uHcALIHD$D90w#Hi88H=g1=HL$DAHH$s0H4HD$D90wDH88t*H=g1LD$xt$tHT$hk=HT$ht$tLD$xHIL9u:H$DA@<HL$H @<H$B<H$H <H8DDH$H$WH$H$Wt$Lt$0AHu Lt$0Lou!Ht$ L :Lt$0(@YHE1ȃ HH UEE@H$H$H}B- H$HM1H9t(HSHHHSHHzH;HL\$(LHMLH:LHHDŽ$H$HCH9SH)HHCHĸ[]A\A]A^A_ÉATUHk(SAH H\H8H 8tH== 1;Hu1_1HHH v HD!D= uH ׉HDDHH9tH= 1?H []A\ÉAWAVAUATIHk(USIAHh HHALiHi H$H8I 8tH=| LHD1D:HH\$1HH4$HIHHP`HHD$uH=n D~BoLt$`HHl$HD$0 1Lt$(R tH=_ 1@B1H螾 AuZH|$0 LDB= t H=u 1>H H Lt$(HD$0 u +L$0t2LD $D$ nBHc $DD$ 9uHLt$(HD$0 AtXH88tH= DDH18H? SI9H= 1AAH -H H+88tH= LHD181Hh []A\A]A^A_ÉAWAVAUATIUHSHk(AH HHALyLq HD$H88tH= 1#81MH\$LLHIEHHP`HHD$uH= ^@Dt$H5hL$pHD$0 Lt$(=tH= 1@lL|$E1I |$M9s H= 1?H8E01HDEAuW|$0u LDf@= t H= 1!ÅATIUSHx)%1HtDI$x(t1.H$tH8 8tH=XH1&0H&>[]A\Åt t8AWAVAUATIUSHHGhLl$@$`H$XHt$HLH@HHD$" ID$ L,$9F1E1Hl$D$HD$PE1AHD$ HD$$D1.H5LEAŸDDAD$2 uEu$dAHL,$DL,$L ED+H8L,$8tH=#1%.L} H[]A\A]A^A_AWAVHcAUATHUSE1E111H8E1E1H|$Ht$(H|$D$ D$$D$ HT$(H9T$0E'HD$<.tow <+t<-t8:H=f1'H{D$(;v*H8:DH=J1a'H{D$$;v'HƼ8:H=61%'Js D$ @Zt%H88H=)1&LI$HD$HE1Hh[]A\A]AWAVIAUATIUSA0HHHH6Hl$ H AbD$$Ht$(AHH߉D$HD$0I$HD$HHD$} AT$$Bt.Hǻ88t$ H=J1A&HK0Ht$(HC`HuKH)H)H+s@1HHu)Hn88ZH=>1A%Dl$$Au*H|$(H5$c,AA Ld$(H5 L,,tH5 L,u AH5 L+H8u ;H=A %H5 L+u;teH=A$H5o L}+u;t1H=A$qH!88tH=D1$ALHT$HuE1E1H u)|$t%Hչ88tH=1A4$AHHD[]A\A]A^A_AUAT?USA?APHG0DFIHDLG`HuGH)H)H+w@1HAHu!HY88t0H=1# H߹1HDkLHH1Z[]A\A]ATUISHG0H͉LG`HuGH)H)H+w@1HAHu!H۸88t(H=21;#1HHL1gHÉ[]A\ATUISHG0H͉LG`HuGH)H)H+w@1HAHu!Hh88t0H=1" H=E1HHL10HÉ[]A\AWAVIAUATIUSHHff=Nt f=Hs HH#HLHfA?H\A;H9tHt$u4fftzLHAHD$A9IUDL4AVft1fu1fA~ t!@IHH4AV 9rI6HfDIHz@H3L{HaHHLSMuOfIuHH[]A\A]A^A_&fDAWAVIAUATIUSHxfD9HT$ HD$DDHHHbAuXAHHD$ID4PEDJL0ML0HxKLLL[]A\A]A^A_ffDHL$6IHKt-HL$Ht$F4jADPt<IHEHL$DJcHL0MvKL0LLLvHD$HHIF4h-Hh:HH~L8A$I$I$hHA$ HA$I$H,HD$L(MHE1Hl$IM#GLI]ME1HM@IEHKHMIMHH#CL9uՋE49C4u͋E|9C|uSHuH;HL$HuHL$uSHuH{HL$ HSD$HL$ zCTffD$.f}T]MIHl$AWRf;SRMMLmIEZID$IE}H=Q1"D$D$Hx[]A\A]A^A_URf9SRIEHH0f;VRsLHH#SML9MHl$MIFD$HEInfHH#SL9HpD$MHhHt$HHHFsH=1'D$Hf;QRv IIEHuHEImI$hDD$THIbDD$AP9t)I$h!HIFDD$DA$I$I$hDD$HA$j HDD$A$I$H|$L4I8HD$H@HHH#CL97Hl$MA{49}4HD$HHEHD$D$H(A$H=I$hHD$uI$hDD$ LT$ HILT$DD$ AP9t8I$hDD$ LT$ HIFLT$DD$ A$I$I$hDD$ LT$HA$ HLT$DD$ A$I$L4IBhIHcHD$H@HD$.f;ETiHCXH8HD$0HEXHD$8Hp f;w Apf9w31H\$hLd$XLt$@Ll$HL|$`AHl$PU@ffAAf9D$.pH|$0Ht$8AHENAQD9rD)fEɉ|$,sI>DL$0DdD,fffH9%D'D@fvfbfoT$L$EH|$t$HH|$T$HA47D;$tMvM>E11ۅHD$A}DT$DT$HARAPtABA<MEH=!1DE2$AUH9fDDL$0A~ $$ID$HLPD$TPDD$TL$HT$Dt$LH A3DE2$AWH=A1f.E8$#A2KHA;A2@HL$E,D$ HQXHDzfzDJHHc HA8FEDT$DT$HARAPwkDl$,\$0Dt$HEEB`u E1fAEf.HٗEEB< tAf tf Eu9l$4vA<, uE1fEj@L*MD$ EDl$D$ AFD$,Mm@MEuAN9L$Dr݋|$D)fE|$I]Dt$oD|EI-fffID9\A@fvff HA44;tMm1-BED$9uB )AADfML"MtD~IM9tuI4$HLuDt$E1fAEJ ftAHEA9x,HDPD)HxH9uE1ۅ_A2ID9Dt$A} x$$LD$0PD$DPLL$8DD$TL$HT$Dt$0JH fA2~fH=1Zf.A8DAEE1EAAWAVIAUATMUSHXH$$fA9AT$8L$MD$D`AM܉D$HAŃD$LDEGA49t$DfEIIt$$DD$(|(fDff=H9D1D0f=[vf=7f=|$T$ EHL$t$ HHL$|$Ht5D;4tMMu1,F<9|$IĉD$ rF AfT$?L>\$$L\$(IDLIfD HL9H3LLgu1f|$\$$L\$(D$ N ft8H0A9x'qHHD)HxH9u|$1ҁw#9A47@ |@ \F@H=Y1HX1[]A\A]A^A_ÐH=1f.D8tsH9@t$$DD$(A t$0t$HMD$XHPD$dPDD$$L$\T$XH @D2tAfD2tAjMMMYfE8,cHEAD;,zfDE2,A_D$IT$XEAMA.H DifyEjQHcHcHE2,A>Dl$HDjTDL$1fEAH:D<*-f tf D9\$ A< fEA9\$‰D$ DA DfDl$ L)fDL$IlLMIII9I4$HLuDL$D$ 1MfE@SQ ft=H9x-JHP)HxH9uDH)HtD$DLd$D$$AD$(DmEdD9d$DfELEDd$ Dl$ADLM)DfWf=-AIE9E4$D0f=vf=4f=DL$DHAA47DL$;tHm1H1Ld$fHAPfDE24AuAIE9CDd$ Dl$} t$0t$HDD$4LPD$@PLL$8DD$$L$\T$XH A@H=Q}1"f.DE84 fDDE24AfHm\$$L\$(D$s9A<7 1҅MDMD$Ld$DDf.ATUS9f9^fF^ft.LfA1@fAHu$f9w8f9s[]A\@IHH HhHHt8H DLH1ɃL$A$[H]A\H={xf1NAVAUATUSHH(LHMH@tH88gH$HD$1Ld$H(@LjLHiHHtHIEHHuHL(HuLd$HH<$HH;|$HGH$L7M}MtqIFH1ېHHt0IFH@HHHtH HtHJLHutHHyIF1H[]A\A]A^HD$H$1Ld$HfHHIEHL9tLHGtHÉ[]A\A]A^Ë7H=ن1L}H81ۀ8fH=-z1fSIFHuH@HHxtH8tIFHD$Hl$HH<$HH;|$HGH$L/MIEHtE1?HHHzt[HHBIItIEJ HHuIE H@HPHtJ"HtHHHHHuHJH HHHBH@HBHzxHD$1DAVAUAATUASHHhAHHHhHź]HEHHxD8D9H@H7|t5Et0Hh?HH@tsH[1]A\A]A^1[]A\A]A^DH=Ix1R[]A\A]A^@H=Yx12HHh?H=axHHhHp HHhbATUE1SHuKHhHu8Hhf}Tu=HhHAD9vAH DH,HuHuHu@HhHUXHuT,f.H Ht Hh8H(Ht Hh 1t@@HHHpHtH@HtH;pt Hh9wċ1t,HHhH49wHHt Hh1t,HHhH4T9wHHt Hh4HHt#HpHhHHhH@HtHh[]A\f[]A\Ðf.AWHAVAUATH)USHHH4$HT$@HL$PLD$XDL$tb@<;;T$p1|$tt1Ht ƃHu9HD$PT$|H$T$xH $;T$pw1b;T$pt1UD$D$7H=p1+H=+q1H=p1lH=p1HQD$HT$pH5H|1{D$<=<>t7<<;l$p HD$PL$lH|$X(HH p;l$pw1cH=p1ND$f.AWAVAUATUSHHHHLJHHAH1AHH)EHD{sEDck u?HCHH@HH9uǃ1H[]A\A]A^A_fDAN4LHHCH$HHD$UH $HH{H7Hv7E@L  fH{H7Aȃ@J4H4HI9uLHHC8 LHHC0L.LHC "HHC(Lk  MLt$LIELk(LyIEHC HHHC(H81 HS H HS(HHH=u؃PE@Lf.HK HHH9H<HK(HH1HK H HK(H HH=uH@I9uDH=Dx1H[]A\A]A^A_fDCVH H_HHtDEGA9s4AAu$FHH HAURHHfH|HfDA9EE EtEA)E9EEEofuT@vNH@Ƌ4zrH`f=)f=u;$AU`fKHq`8:XH$DD$]H$HHtfx v A+9A'A)r$t$AHt fx DT$(HDDhDT$(HxH$HH4H HuHHHuHH$Hf@uDHD$0@hEdHH[HcfDLd$PfDIDDT$(脛DT$(H_88PAu$.fDAE(H|$8 DT$(HIU8H|$8DHIU@HHHPHHHPH[DT$(DAI>ZEDE;exnA9`AU`f>;$19$0H^8:Iu8H=`1DDT$(nAEbDT$(AM0AU,E1DT$(EH|$hLHĸ[]A\A]A^A_AubftDf>f)@f@u;${AE`fAu(rH|$8H$H$tH$@2 H|$pHtIE8HH|$xHtIE@HH$tH$@2 f.AEPHHDD$tA+HH$H$HW RL@9`A}PD$HT$(HHT$(D$HAE$PIHHHdAEPD$HT$(<HcHpHT$(D$HAE$PIHHH8HAEPDT$(HcH˹AE$DT$(PIHкHfA}PvJfAE$HIH4ʍH>HHHAE$pIHHfA9UPwAU$AERJIH HH=]1 v,HD$huH=\1AH=\D1DT$(Au$DT$(Iu8HDT$(袆Ƅ$DT$(M1H$H;]xD9 DT$(SHDT$(H$IU8H|$8HIU@HPHHPAUPHTJHHHH[AE`f9$9$HY88H$Ɖ$At0H$HHfx $+H9D$HL$(HcHofA}PD$3HL$(1@ЃHfA9EPw >:H=;[1l"HDDT$(AAM0AU,D@A))$t$7A*L$EMIH9H$L$l$(AHB<'A+HHt fx HDD$D$D$B $HD$D$D$$DHHxHHtfH2HuHHHuHHf@AVPH}II(%L$LHMEߋl$(L$HH$H3H H$H@ @Lv9D0E:KDŽ$HgH?H=X1VAE$PIH<;AE$PIHH=0X1Iu8H=X1D$HL$(AubAUPD$HL$(AERAWAVAUATUSHhH$Ht$L$8D$$D$D$L$ IHHE=A8HH9s-Ht$H=X1JHh[]A\A]A^A_fDIh蚷IǸMtD$fAO4fAO6H$fEwbfEgPfAoRfAG`$IG@AG$$AG$AG tH$AG(HIG,[H2HmH衾HHD$07H1fD$HD$\H$HD$XHD$D$ D$([HHLp]LHH $HT$H5wL`L1F D$\9D$Xƒ   H萻HL~HBLHH.D$8D fAH$HH<$BfAG6LD$XfAGJD$\fAGNHZH|$0IHD$ M(HHHѺHHHD$苻HH$mHD$IHHD$(D$ D$<@(LSHHEIhH] HI H;\$(r }!HT$H<$L諴H#HHt11D<)HH9 <(u(H诿HIhHװHIIH$HVfATtIhIWXIwT豠IhLҾH<$ZtTELb @ MFH 9I>H 3AF fjAVZf.AUATUSHHf~8w,HvH=9J1jH[]A\A]f.IHHNA$LN,LF(H10 A-Et<AD$4I$@Ht AT$,t}8A~nMD$1D9~V3DT3@ЍPDDT3CAI<uftH]A)fM:fDM8H]HH]3vƍFs4sID$L0ID$HXH 8H>HHB0HuHE0Hj0HEE>ID$Hf@<AD$,uAD$0H1[]A\A]AD$0It$I$hPH躛HID$AT$0H,Ѓ}tAD$0E(U8HMHurH=H1ȲI$@I$hcIDŽ$@>fH9HE0LID$HHtB_L$1)D8L$B L$Ht!Md$0MAD$>D8uAD$89T$rNEL$:D9MDr=HxA|$YAL$(HUtDD)9KMd$0@1Hh[]A\A]A^A_ÃEu1}AD$EHtfEuB<9LEA;EuB<9LEA9t D;z/HHHpuE1HD$PHHD$PHD$"HEHD$0HD$H@HT$ Ht$HL$XuD$XXHD$H)øHHcHD$Dt$ A)\$$HD$(HD$J0HD$DH,EHI1AUjjDL$DHT$8t$@H|$0觔H H'E.HH[]A\A]A^A_f.LtMHaHEHD$0I@H`T$ Ht$HL$XsD$XD`AHA)ĸDHIcċ\$ HD$D)Dd$$AJHD$(HD$PAV,HD$HM1AUjHjDL$Dt$@H|$0薓H tSHAE2 AfDHD$D$8AUjE1jAW1ATt$XMHT$HH|$X謅H0=AALI} HT$L!D\$<袈L$L3HD\$DH9s6H$8:AH=:1HD1L$L$ Hq$88AUj1LL$@LD$DHT$(H|$8辒_AXAU0 utt$ ED@HEMAUj1jH|$HH‰H tfDHA1AUjDjLD$(HT$8H|$HڏH .1E1fDDT$8EHHD$PA3D11AE2 D$8:Ht$PLPOAHAD$ DIIc;H=.tf.HD$HD$ IHcfDA0AH\$`AAH8H\$0lH|$`L$L$Ht$PLlNHt$PLXNH|$`L$҆L$fHD$Lt$`AL0FLt$0Ht$PLMVHt$PLMA H=.D1AWAVAUATUSHHxHMAtA~Xtm H3HcHIL莐 1LGC„t;fD1Hx[]A\A]A^A_C V9H~HMH@At‹S HNHHB CA H+CAMtAuAwCAHx1[]A\A]A^A_ËF+CADFL^SHIPADC V9AMAAAiCFARfH=Q.10fDHH$?*Au$uA1AHLL$L$视H@L$LL$v8H=,1躎RLVHSIPAfDLl$ HHL1ɨt t < f<Ht ,LLL$L$؋HIL$LL$t~LxL L$LL$UH=+@H=K*1z1҃уH| 9I| rItH1CH=*AALH=)Ltz|$ SH=)LH=)LDAH=+1D1|$"+ILŌ7H=*1迌W 1LLL$L$]ACL$LL$|$!EH5(Huiy$LLL$L$HL$LL$HT$H5(1LltWH=*1LHL$HT$H5u(1L1H=1*1ʋbD$w:C1IIL苋H=)臋H=.*1oLLL$L$>y 1LL$CLL$ACAD$CD$C  1L识C cAULoATUSHH1HHHGXLIHH)`HH{0HBPHCWt^tI tH[]A\A]fH9~ LLЃCXH[]A\A]HyH)8AWAVE1AUATIUSHIHHB HL$HD$(HHxHD$(HH$LHE H4$1LHPxH+88HD$@H\$`MHD$IAH5AL1IIL9uH8D$`82HE H|$HH5%)DHUhHxxHDMAHE DHxx11LHS`HIEH$1LLH|HE H$ADHHHxtHE H4$HHPx]u{H88t,Ht$(H=(1E16@H88E1HD[]A\A]A^A_HE HxxEEHD$0HD$8HE H\$p@0uHȃB$DHT$0HHkxA u(HE H$AHHHxHE L8Mt:HD$H#L}xHHEHEhH8 HT$@MHLAHE LMt(H\$H=#HL$0LLLHHEAH|$8AHďHE H8 \D$H\$pL1LLL$LsL|HE H$ADLHHxLL$gHE H4$LLL$HPx*LL$;ET$WHD$0HD$8DHE HK1H\$pf8Ht$(H=c%1E1豀@HE HxxHE Hxx71E!AqH880H= &1B DAHt$(H=y$D1E1HD$H <Ht$H=!DHHE1Hb88Ht$(H=$1E1H788H=%1sL8M@HE H$ALLL$HHxLL$t,D$HD$0HD$8HE pH88H==$1E111LHS`HID$L1fAVAUHATUSHPHIu0H!88HP[]A\A]A^fAHLd$PHLH)HrH1t tD fD Ht4@4L$AHLr DH1At At  f HAt  1 HHHCHcMcDPBƄI@4=~H@# HH$PD$$H8fT$81Ҁ$LHLHDʀ|$PIEHH*zDD$ H}f. eT$ VH=#1|"DfDH=dLL1|@Df.DE(AWAVHAUATIUSHE1H1HEHL$(H|$lHL$pHD$HIGPLD$@D$'HL$H|$8HD$PH$'<A9HAJL2AFuHD$pD$lL2IGhMVHLLT$HD$0qxH4$HHD$莪ALT$yH$Ht$E1LD$HL$8LH@LJmQIFpHtLD$pA9D$+IH~A;W4j\$Ld$XHl$9Iً,tLDfsA9vDHD$@AG4LHPHIWXIGPIFx0UAo4AAG2 t!9D$'qDD$'HĨ[]A\A]A^A_fH|$1HIGhHH$HH@PHD$pHD$(HtxXtFHT$H4$E11L0+ AE1AF IvLZ;Af@HD$x밋\$Ld$XHl$IFhHt HL$0HQPH9@H9tIF`H+HL$(HYyXOHtQ9?;P6IFXHtHL$(Q9;PHD$@Ht!I~xtH|$PH-IHHD$(HxXIHt$HLANH$Hp(H@I E1HPWt$8N NLHt$8nP AXAAYIfD1Ë\$Hl$H$D$Ht$HVPH9H H7A9H="H1DL$XhDL$X͉)ŋ$Iׅ$i$MH$Lu6AE2 D$x~H$LLT$x)LT$xTAPH$HLAUj1$DL$xHLD$@DLT$piH LT$P@E116fDAE2 D$PuH$LLT$P0)LT$PKAlH$D$4,@HD$ HD$ILcfDH|$`DD$YgH|$pOgDD$pDHD$HXPHH|$`$gH|$pgH$ gMDŽ$D$4H$L$HL$hLLH A/@HT$hH|$ HV{HT$hH|$ H$LXMDŽ$A$0A$H$A$AHa|$HH$`H$sft$XA6Ht$H;VP$I} !H$D$]D$EgHD$$8Ht$HVPH9/H 7A9'H= H1DD$X eDD$XH|$pLr@H|$`Lr\@AH$L`&E1E1]DH$HT$HEAt$PH|$AH$Ht$8DH|$SAD$AH$Dt$XLl$I1H$HI HEEtAt$P1AHL`t1HLuLE1@H$AD$4fH$L0%AHD$(@2 H$Ht$8DH|$OAD$D$fDAHD$HPPH78Lt$11DT$XLAV`HIvPAUMHH$RL$HHL$Hf]AXDT$X}H$ 蠻pH$FHD$H$H@PHD$T$H$SDŽ$H$&HD$H$H@PHD$T$pH$VDŽ$QA H$LE#A1EEHD$H|$pHp jHD$p?H|$`HiHD$`LDt$XD$t?H\$(H$H"C2 AE}HDŽ$D$4|$qID$ HL@MIl$xL"JHAHULDL$ HL$HT$A_AXD$ID$ HLM f.AG`9tXtSMxMt$EwEtLD"A9tMxMuAD$0L$1!H([]A\A]A^A_fAGltAWu 9D$`uIW0H9t I;W8H$IW8HGIG@H9t.IWHH9Ht I9@HtI92DIGPH9t/IWXH9"H9$s HHtH9$@AGdt/AWh9;t 9D$9T$vAwt*HD$HIE111H^I7LCD$AD$2 gDI9T"fLHT$>!HT$H9-IW8HLHT$!HT$H9H9$fLHT$ HT$H9IW0I;W8K0D9D$fD$RH(1[]A\A]A^A_A>uzH5LAD$2 D$Gt$hL$hH=9HML1QL$ QSLL$ HL$(YH EHt$H=31XnHa7DHi8D]f. HHcHDHHHHHHH#HAH2HHHHHHHKH)HYHHHHHgHAHHHHHHQHH=HAWAVAUATUSHP3Z~buZ8H\$t{1Hߍ]M\$Z+<[du D$ KD$ HĘ[]A\A]A^A_ÐZHH5H=H1H\$U^H=`S8ZIL597t A>/p\H HHDA>L%X7L=X7LH\$H HH1QIHKHIu!A>GIM9M$@HPHt A>VH5ZL*_H;8HHH5`L_H 8HHH5L^H8HHH5L^H8HHtuH>7([YH HH H5H=HDH1\fH=u11H\$\fDXH=H1z\DH5H=H1SH5kH=H1S+HPH HH5@H=RHHEHHHE1{SmH5H=H1aSff.USHHPHHoH@8@H@@@H@L'@P@THǀHǀHǀ HǀPHǀǀǀ`ǀ@@@>NHHHIHHCXHPHHHIHHHH HHc K`OHHHx81eLH=H]0E2E E$ HH/K HǃHǃǃ2ǃdǃ HHM HHN HHO HHO HHU H1'IHǃ(Hǃ0HHǃ8.Hg78HH[]@HǃH=91UHHRHHRHsXHRHpWH1^^HH[]@3]H=H12PWDH=)1*UHH7RHH$RHsXHRHVH1]H]H=91TDH=YTH1]DH=qT H=tTH=\THHiQ@Ht7#SHHHc HHHO01[DHHO01[DH H1[1[DHHP$1[HHO01[DW1[H(1[r$1[cfH81[RH01[B 1[3f1[#fH7HO01[ f.HH1[H@Hg0H1[@HH1[HH1[G 1[iWL1[VDG vHHhH511\D1[@1[fHH1[WT1[DW1[DW1[DW(1[DHW@1[@HW81[@HWH1[m@H=11T[PWP1[>DH=91*Q[ Z 1[fHg01[Hg01[Hg01"@Hg01[H=!1P[H=1P[HO01[H=1SCH1[iH=1ZP[PH=1SHǃ1[*H=b1PSHǃP1[H=1 `SHǃ 1[H=^1:SHǃ1[H=`1SHǃ1[HHtGHt"!SHHc H!aHHcHDH=q1HT$-OHT$HHtHÐH8H0H($ H@${HG0n@HG0^@HN@H>@H.@H@H@DDDG(GGGGG GrGTbGPRGLBGH2HG@!HG8H=y1HT$ MHT$HH=O1LHff.Ht)SHt% uHHH9HHC t#[1HH9HHuݸ[DH=q1bL[f.HHtHtZt? uHG HfH=y1HT$ LHT$1HHH@t tH=71K1@H=I1HT$KHT$Ht1p@f.USHHH?HHËEECECHE HtHoBHCE(CHE8HC HE@HC(EHC0ELC4HHHHHHHHHHEPC8ETC<C@CDCHHHtHAHCPHHC`HHChHHCpH HCxH(HH0HH8HH@HHHHHE0HCXHHHHHHHHHHHHHHHH $ (H(H0H0H8H8H@HH[]H= 1HOI1f.USHHHGFGFGFG(HF HG8HF(HG@F0GHF4GLHHHHHHHHHHF8GPFH9uMLtQHD$I$L$ ITITID$HI)F,!M)AArA1҉уI4D9H4rLH8 []A\A]A^A_fD$ H=|1ATAUH5SHHHt%HD1HE@HHFH[]A\fH=!1HD1f.H$81҃t HĈC8H満;H=H1;GHĈff.ATUSHG H Ht,HLgxH(HGhH8vZLHH[]A\D[]A\Ðf.H?6USHHHHGhHt1H8Ht)HwPHHHt1H[]S0 CHHH(?S0tHHtHT$H5Iu)YAHHD$HH5H5=H3HtHH|$HK@H[]Kt 4[AfH=4B f.1DH=1 Bf.G1t tUSH5HHqHB7ǃ8u H[]@Y@HH=.H[]1HcHHH@HHHDBt%D9HHBuu1@Dt1y@f.W4x19|HcHWHHvH‹Ít21y@O4xQ9|UHcHHH@HHHDBt%D9HHBuuHGfHBt1yHHf.AWAVAUATIUSH*L5H^HH$L$0HD$fHT$L@L1`<8HD$Gt'HDHHH;t{.L{L4LI4I|EHHH5HLL186LH޿H:t#$HH%=@te+ H`EHPDHHX@Hh:C$<.@{1Dc0uHD$8 H߉T$b@T$vH=7H1T$A?HDHA?T$6L3LHu3H=nHt1;H ?H[]A\A]A^A_H>1HUDH>Ht$ ?3H=HL1+;H>H=1T$ ;H>HCT$lSCHt0H@Hf3HHt%H[fH=11:1[H=R:HxC1[ff.HtSHH?HtRCH[IC@f.AUATIUSHHHH;_Is I$DH[]A\A]Hk5HwPHtH9wHI<$HHt$Hߺ1G7uH78u.MRzHLHDH N1ht"HD$PHL$IVB(HAHfIL;l$aD$(Dd$H\$HC0Ht 82H=j1A50-L-HV.L-H@DcHD$HsHD AD$HCHHCLD$@HL$HHT$tH5H1L)HCL$tD HCAT$L$x HCAT$L$| Dk HD$LD(+'HsATHS SHIHCL&DHLL5C HS-L,HL`DkHD$HsHD(AEHCHHCL.L.HCD1LH HL$`3*HL$`AU1LHCL, *AEL0.DcHT$HH3AD$D"HCHHN$ 1L)A$mDkHD$L$>LLD(|*H CHH3HL$`DHCHHHL$`E}B E1Dt$`Hl$hMAHLAAI<4=D$ttJAWHMHD9BuHDt$`Hl$hH78"H=1'H`78D$AH=JAHİ1'WD$H=tAHİ1,2D$H=AHİ1j, DHL$PHT$IFB )HRHHHT$PIFB *HT$HHHH=H1A,H=1A+CA~CAlH=L1A+PH78H=1At&'D$H=AHİ1H&HĻ78cD$H=0LHİ1&AH=1A +H=`LA*f.AWAVAUATIUSHH=xHH8)ۅt,H78H8[]A\A]A^A_fDH}.ALu (Ht&IM)AW vWHȺ78H78tH=H1%@H=H1$kfHL$H)LHPHHL$t,HL$LBD<H$At=HH%78]H=H1$GfDHDH=H1R$f.ATUISHHHHtP{Ņss(K 8HsxHt H&Z[]A\DHC0Htg((9SuCRC wHsxHt H%H78Z[]A\HC(HKD[EKDSEnDK EIHsxHt H<%H78tH=11L" DHsH%K HsH$HsxHH3H$s~@H78H=L1_"f.HsHp$HH3Y$w@HsH@$tCDcE`k =HsxHt H$H=1&HC0ht&9C HsxHH#~H{hDCEu[{uAHHDHHD$ HIQ1Dd$(D|$,DAHI9IqLB 3IǍy@T|K[b{!t (!ECL= HA< H ECL=<)CD=)Qfl$Dt$E$L$EEP$U$Ef.HLpLgHHHwHHL1H&H{]( HH}[ HuHHWH$H$0H$H$0hH$H$0NnH$Ht$H=ժ1KA$Lt$PH=zLl$hAIHt$`D$HD$0H|$PH|$X$<$AO=DH|$0jH|$01 !pt9Hq78YH|$01 H=Q13H|$8H$H $9I(H $H`D(H|$81 HD$LD$A@IHt$@LD$HH $I@H|$@HL$L$TL$ffA@ IHt$HwL$HHL$I@II@MD$,D@D$,H5H=61HĈ []A\A]A^A_fDIGXATEjj1t$PDD$ HT$`Ht$hH8H AwDHH5EH=DHE1yLl$hL[t'1L ID9_fAII@MHo71ۀ8t$,H=1H=A1T$,uH5̔H=ɔAH=L$AL$ILAIpIAL$ILlhAWAVAUAT@USHE1E1H!HD$@H$LD$H|$D$,HD$HD$pD$4T$0HD$ HL$HT$ HH$#tHAHL$;HK>HLd$@HtLL覥t D$,H(HttH5BL&HLHIH|$ 1Ht$ HHLH$nAD$ED$ED$EH$Ht H$vALKfHt$pH$fH$H$fD1DH 2HHD$8HHt$@HT$8HHEHT$8HHt$XHT$8IHBH|$XHT$8ffBMHD$4E1JHBHJ9LLx LHIHL$HH,HL1HT$8IHBH|$XHT$8fBdH$H$Ht$xH$Ht$pH$vT$,t$4H=171H$H=L1Ht$xH$.Ht$pH$H$H$H=)1AH$H$Ht$xH$Ht$pH$zH$H$Ht$xH$kHt$pH$TH$H$cƒd[D$ED$Euf$uDH$Ht H$H=h1XH=mAOH$H$Ht$xH$Ht$pH$pbH=T1HT$8HT$HAEAH2A5HT$HH!HHAAS H]HH@1H¿r t2H=1H@xHǃ@[fDH@'Hp tgH=1AH@H8"r H@HH@Hǃ@[fDH=٭[DH@'Hpc tGH=@1H@1Hx诒 H@H8q H@H@Z@H@'Hp H=ܭ1]H@1HxK H@1Hx9 H@H8q H@H@vfDH@HSHHxHt1 H@H@H@HxHt1Ƒ H@H@H@HxHt1蠑 H@H@H@H8Htmp H@HH@HXHǃ@[fAWAVAUATIUSLHH/MH|$HT$ $CAH<E1H\$/HLpHLD$ H5KLLD$ $LHT$LkAEDWHt$H=҆H1Mt6L,fH$@1H HHuE1HH/D[]A\A]A^A_ÐH5%L4$LAdID$XI$HHD$0_ HHD$$H$@D$(E1Dl$8Ѓ@D$ HL HH$A$@#tHI$t H|$H=HHII$HtHT$HxxI$(HI$0T$ HH=ЅHp^787H= H1!H$?*AEH$>*~L$A>*u A~"-LH"HL$HT$\H51L-H$H$H=1*A}I$Iu.I$LAI$t H|$ |$(EvH|$tHD$L$0@L)]7A:E1H5L9HE1jLL$L$HT$ LLgAXZDH5LfH\78tHt$H=k1E1fA}=M$IUE1E11HPHjjPH|$PH D$(fDH5|LaH5LJ$HAjLL$ @Dl$8I$t H|$VEt,E?H|$HD$L$(L[7|H=1AeHAjLL$Ht$H=H1?fDH|$H5/OHI$Ht$H=1ABHD$H=D1AsH5~L%E1D$\H$HHHD$q HD$`HLZ7HHD$ HHXH$HH$HL$(HL$\ǃ,H$@HD$8MHL$0@HL HHI$@#tH$@tHL$ ;H5HH@HkH HD$h<0q<11DŽ$ H|$p}H|$xH$?fHHHH$HPH$P$$H$'A}HD$9H<$/H|$H $H$HH$HAH$A$NHt$H|$(HH) Ht$0H|$8 H$<0y<1DŽ$H$<0N<1VDŽ$H$<0<1DŽ$HD$`8HDH$H$8t 1qHH$Ht$I$HDŽ$DŽ$q H<$mH|$cH5Y{LuH5Z{L7HI1AVDD$HT$ LLLA[A[YH=D1CH=A5LUW7AA:ZH=.D1DH$H $H $H$1 HL$AH$8;$HL$A}Ht$`H=V15xHL$HHHDHLǀT-H=D1L,$AL$A:H|$n !DŽ$ DŽ$H|$8HV78+Ht$H=(1a@H=!D1Ll$ L,$NLT$ LL$5L$HD$HHL$AL$ME1H5xL覸$PAVIDD$1AȀDŽ$H=D1Ll$ L,$LT$ QH 6H$s`H$1 'H$;$A}H$Ht$`H=1bf.DŽ$-A$H=z1 H=>D1Ll$ L,$LT$ H5wLrH5wL[4IPAVDD$bHt$pH=z1kA}H$H=z1JLl$ L,$H==D=MHD$LT$ A)H=TDL,$AL$H=D1L,$AL$H=DL,$AL$H="D1Ll$ L,$LT$ DH=D1L,$xL$6H5vLH5UvLtPAVIDD$H5FvLѵuH5xL辵tIPAVDD$H5uL薵t$AUAVIDD$AȀH5uLguH5uLTt(ARAVIDD$1HT$ LLYA^H5uLt$"AQAVIDD$1AȀH|$H5lut $IHT$LLA\H|$H5>u賴t$ $IɀH|$H5t艴$ 4$LD$`DŽ$fAI$@ I$(Ht{$I$0LH=*uA~tO-L艬HLHL$HT$\H5eb1LXH$H$oIEHIE@L$A>*uA~tO-LH@HL$HT$\H5a1L褨H$H$IEXIEPL$A>*uA~tO-L觫HHL$HT$\H5a1L3H$H$AEhAEdH$*xyAE`H$>*~I$D$0IExM$'D$\AEdD$`AEh돋D$\IEPD$`IEXLH$ 1˨IEXIEPE1HD$ |H5`L臠L711,HHtHLHY L=7tA:tH=L1L$sL$L$HSXL$L<7A:H=xcL1L$6L$H5`LޟLA舙 $LLx QCH=A8t$H=)1A̫I$HuۨI$H˨H$L$H$H5_L.$0D$\IE@D$`IEHL7eH$ 1AEhAEdiH$H=ה1A}0t1uЀxu0AE`JLH$ 1uIE8IE0IE8IE0L|H$ 10IEHIE@H5^LH5^LqHD$`H$@Hl$HE1D$D$HD$8H$D$ HHD$($L<$Ѓ@D$DHL$HH$ HH$@#tHHL$8;HD$ TI$H\$`HtHHquFI$(HtCI$0T$DHH=]Ѕt'H978tH=VH1D$9Ll$hA}tH5K_L/HtLHIH|$(1"I$LH|$(HpLA譱ED$AL<$T$ H5^H=1耨1LHHHLh LHItHL$hH^HL1(MH=1L<$A뀻$tH$H$P$tH$H$P$tH$H$PפH$HHt H$P轤H|$p胧H|$p1 :IljD$0v7H778}H=D1=g*1#I$ 蠙HI4I$Ht$`HIEI$Ht$xIFH|$x1HHHHfAFI~tAI$D$HIFI$L4H=WL<$AxH=|1L<$a|$0I$I6EiI$ALAQwIFH|$x1HHHHffAFDI$LL<$AGL<$A8L<$A)Ht$H=61qEL<$|$u H5[H=[1A{L57A:T$t$H=1L$;L$fAWAVAUATUSHH6F It-H=61A HD[]A\A]A^A_@IHT$@HH薧tI H"578 LA $uD$XA _%=@=E1LLHD$/8Dd$6H478HD$Dd$ETE_IPԝAX@H=J[1Aܣ .U,H=H1A 蕣(KH=wH1A gYf؀D$$H378HD$H誛HIHHHD$D$ t&HD8/uxuHD$D$ 8H HD$D$HHD$(fDH8FL讪HuHD$Hx賫HID\$ HEwH56ZH1 L耦LpHHD$8* DT$ Ea H5ZHL1L3H5YHL1藛D $ELDD$ HE0H5YL1SLƥu!L$$E1LLLMD$MH5kYHL1 L耥u!L$$E1LLLD$L5LUHD$$HHD$@LHH8tx.HXH=UY HtH=X HtH=X HtH5THcB<$tH5XHśHW HTHL$H<~HIt$ HHH5H1יL$$E1LLLD$-LfI@ELA2P.x@H=H1A衟@H= W1zDL`H5VLuH5VL LHL$(H<DHIMLDd$ HH5EuH5]DL1LL$蓘LL$L$$E1LLLLL$0D$LL$0LçfDH=!H1A 詞@H=YH1A 艞{@H=H1A i[@H=H1A I;@L踡|$H=H1H5UH1薗L D$(H5DVHL1iLܡH5xUHL1@D$($H5qUL1#L薡H5dUHL1L$$E1LLLD$_L4L贠L7HHHD$8q9pv'|$ H $H<H5TL1{H $HoH|$8eH5U$HL1IL輠H=9H1臜D$(H=ӊ1\H\$;tg5'8H=WT1>;<5'8H=LT1!;H=HT11;5'8H=1H\$;5w'8H= T1ɖ;H=)1貖Dd$L0H= 1袛D$CH="SH1t=H5@H1"H5ROH H5@OHH5.OH܎yH5OHŎbH5NH讎KH5NH藎4H5NH耎H5NHiH5NHRH5NH;H5NH$H5NH H5uNHH5cNHߍ|H5QNHȍeH5?NH豍NH5-NH蚍7H5NH胍 H5 NHl H5MHUH5rQH>H5XMH'H5HxHt1C H@HxHt1C H@H@H@HHH8L-6L=4L5 ;E1HCXJ,Ht9HKxuyHH0HH(uXH78ubIIIuH{`HtH{hHtH{xHtH&tH[]A\A]A^A_fDJLIUH=5qDIDPHP\PXPLPE8PE4PE0PD41D0W|H@4fDHsfHHt#c}HH@~HǃHHJ H HHlRE1pDp8H<P@HHtH}HJHHA}D9HEJxuHpH`}HJp8mHp H:}HJH<RHp(H}HJP@7Hp0H|HJfDHx%HxE111HNH|H HH}|HǃHVSHjfHHPHߋP AuH50L/p'H50LpH50LpH5n0LoH5\0LoH5J0LoH580LoH5&0LoH50LwooH50L`oXH5}3LIoAH5c/L2o*H5G/LoH5>/LoH5:3LnH53LnH52LnH5O/LnH5=/LnH5.LznuvH5/LgnucH5 /LTnuPH5.LAnu=H5.L.nu*H5.LnuH5.LnHMHL1$iHDLƄ$VAcL}DPD.\x1M@LP}1fHDHUH=j1HyfH 7ATIUSHHӀ8u7MtLbHtH]kHtH[]A\{@[]A\H=1"tAWAVAUATUSHHHt$pXiH~ 78lAH5>-qHHؿHHD$\qHIH$Ld$PE1E1HC|HD$HD$CHD$ HD$H%qt1Mv MuH=H1p|$LzCAD$tJI9FQI|$@Ht$0>tH= lHID$@tI~Ht$0 5rD$LE1%t )A΋D$I<$1`H;D$8EI<$D`I|$^HD$8H5#HcH5#HcH5#H~cH5#Hgc|H5#HPceH5#H9cNH5#H"c7H5q#H c H5_#Hb H5M#HbH5;#HbH5)#HbH5#HbH5#HbH5"HjbH5"HSbhH5"HAHWAF2 uH=R"H!68 H=DL1$wI$HQH68H=Ӄ1$AI$H߉$Q$fDAWAVAUATUSHHG D$THD$`HD$hD$XH@ PHItRw49sKHD6;SIhL ;1HĨ[]A\A]A^A_fDIGhLHHpPe IMgp %I1 5n6IAG0IMHT$pH5{LSu%zKHHD$pH5{HLZGURHIH|$pHhJAG0IH5L< ;H68HJ{H=12GDH=1%LH68sHYzH=?1FTfDHa6; 4fDIhH86H z8 IGhIw H87ME1HD$XLLLIHD$IG HT$Xt~Ht$`ME111LH=LyKH68mHEyH=91ENHByH=11E0@H\$`L1HHAM11LIH=JH6Hry8bDH=1RED)vv"%E1AG0HpHsOHIHxH5xIH9 HU682HoxH=1DI? AG3HD$`AHD$H|$LD\$蒩 AD\$H68H]xH=zD1(DIGhIH5cHHPPB; Hy68VHwH="1C:@H=1C;H/wH= 1CLH跩 AG3AAD\$Itkm H6D\$M8DHwH=xD1&CIH5vL7 3AG0E1s IGhHt$`H|$hHHHAG0HHPIG IGpHL$HH A9O4SLH6; IG HLD$LLLDl$XEEMA1HT$Ht$LH=Y4GH68HuH=N1AH=FHj6Hnu8cÉHO68,HuH=1AA9O4H6;H=y1zAD$ HD$pD\$(L$`HHHD$w!PD$~P$P$P$P$P$P$P$P$P$P$P$PD$1D$H$4HpHT$IH5tS5 IG D\$(DT$ @0H6Ӏ8HtH=1X@HLD$LLLDL$XAEtdMEARt$E1111ALH:A[]1AuIG @HA9G4MgpMEsH\$Hl$LHHHAM1HL>H|$D HIGp%D$/>yIG xt-@0AHL$TLDD$1L“AAG4I1Ҿ+ IGhLHHPP HweHHcH;IGhH8ZLJH=rHƉ1>AG1tIG`@@t LAI1Ҿ Ao4Ax>t+(AG0t IG`@uIG xAG4Ao4IpAMgpDHੀEMME1uH\$H=1AHBHKI1Ҿ Ao46AG0tAIG`@ t7IGhHIG HH9JPv#H6D$/:tH=1.=IG x@0AT$/LDD$HL$TLD蜑Aw)DH6}HHA68t*Dl@HIGhH8XH=·H1LHHPPI1Ҿ Ao4AjMgpMAH=1Z9IG Ll$Hl$LLHiIpAMgpM1LHL{AG3tIG`@t Ld AI1Ҿ^ Ao4AAG0tIG`@ tL AAG1@tIG`@tL AAG0tIG`@tL A|AG0qIG`@c1Lz AQAG0FIG`@ 8LA#AG0IG`@  1LTAAG0IG`@LmAAG0tIG`@t L>jAI1Ҿ Ao4ANAG0IG`@sLE AcAG3XIG`@JL# A:AG0IW`BIt}LAmdAG0t}IG`@ ucI1ҾE13 Ao4UAG0IG`@ LAAG0IG`@ LAI1ҾE1 Ao4AG0:IG`@,L AAG2@IG`@@L\a AAG0IG`@1LaAAG0IG`@L(9ADH9HIGhH8yQH=\jH1f5-AG1eIG`@ WLeAGAG1 {14IG HL$\HT$pHp IGhH8INAt;H=*{13|$\11L0uH|$pA|$\n(H|$p,H|$pAAG0IG`@ L~A{AG0pIG`@ bL'zARAG0GIG`@ @9L A$AG0IG`@ @ 1Lr AAG0IG`@ @L9 AAG0IG`@ @L  AAG0IG`@H6IGh;HHD$ tH=f1Y2IG Hx +HHD$HǺ1BJ2D$(`;tHt$H= z12H\$8H\$ E1HSPL9C L)LHH9HF1LcʉT$0HT$HLL$@LS`HLL$@LD$HDHM|)HHtD$0|$(HL$0HHcMMoh|$(11H\$8Q2IEIGhH8tuLRcAIGhHHPXIGhHL$ |$(HV%IG x(t';tHt$H=x1t0H|$r>tH|$$ DEHt$H=x1E1H5AIG`@,|$T(LZZAIG`@IG Hx 4)HHtHO=t0HL68tH=xH1/HA=IGhHH0|AuLHAIG x(uH8He=gAG1@\IG`@N1LXAH=N]1D$ D$#@A HT68A;tH=c1 A0AH<$DT$bDT$L;HItOIFXjjjhjE1t$(L11LLT$8H0LT$L(H<$;I@E!Hc68+A HH68H= bD1D$ D$H6A8H=a1D$q D$H6A58H=cM1D$@ D$vLL HHE\H$P1HT$@D|$Ll$ HLd$(HD$0H1H\$@HD$H HD$PfH|$ eH|$H0AH,$H}DT$Ht$HH~0IFXjE1jj1jj1ULHH0=(H<$}NH6A8aH=`1D$D$F;H=Z1H<$"A=;H=bZ1;H=Z1A H=6X1(H= `1mH6A(8 H=K`1Df.DATUISH@H1HtL@@ @H@8@L` Hh(HH@HC1[]A\fDH=_ []A\fAUATIUSHHL-!6A}H{8{tO~Lú{Ņ~%H;CHtID$ @(t:MHH[]A\A]Ð~A}uEL {fDH;t DH7H=f_1TfH=b1{f.ATUSH_HtSCE1H~ HAH;HtH{HtHHED[]A\[1]A\fAWAVAUATUSH( H_HHCII1E1I9voHfDA<.DytLH-bHu A~{H4$HC8D$ HC0{L)DHC0Ls HI9MM)H{0Hs(H[HC8CoL=i6A? HK81HHI9HK8HH_A.8tA?t4(H='Z1HK8e1HfDHI9A.DQtL9HH|]HAB C D$ CI)HIHC8Ct@HE1^fDI)I H=\1H==\1H==\1uHC8?H~ HC@C{ HsH=Z1PH=2Z13Hs0H=CZ1_H=Y1 L)A?HC0H=Y11H=YIE1bff.HGHUSHHHG uH68C H HEHEHEDHELHETH HEHE\HEHE HE(HE0E8E<E@EdH[]DHHH @HGHHHHHPHVHPHVHPHVHP HV HP(HV(HP0HV0HP8HV8HP@HV@HPHHVHHPPHVPHPXHVXH@`HF`f.H=X1bf.HtVATIUHSHfDH}t8HmHC Hu3HHhH{tHCHtLHH}u[]A\H H HHHCHCHCHC(HC0C8C<HKDHKLHKTHS\CdHC F@f.AWAVAUATIUSHHݑ68H$1 HD$PHD$XHHD$HD$`HƄ$[Ƅ$]Ƅ$< HHD$@tpID$ Hx %HHD$t<H> tfH968w H|$@ H|$ H[]A\A]A^A_H=VwH=/X1WH51HHHD$ H5XH H Ƅ$HD$pH$H$H$H HD$xH$ID$hHDŽ$HDŽ$HDŽ$HDŽ$HDŽ$DŽ$DŽ$DŽ$HHPPH Ht$pH$L5RWl$HkHCH1[]D1DH= K1C fH{uH[]DHhHHCtHk뛐XUSHHHtXH?HtPH{8HtH-6}umCPuH{H{8HtHH[]DH{HtHCHtYHs8H=VKHHD1fDHH=J1CPu}tH=J1eH{8e@Hs H=EK1VXSHH?HtDH{8t=H68u\HC@HtCH@ @(t8H{8HHC8H{Ht HCH[H{8WDHs8H=K1ff.Ht;HHHt8USHHHHHTHu&KP1H[]Ð1DHoHSH=J1HCff.HGÐf.Hw@Ðf.USHGPHH?HH{8H{@~{11sHHT$0HsE1H{@jE1jH蓋Hs@ZYtX{tYH}68HĘ[]f.H=I1HĘ[]ÐF2 t{bH}68uVHĘ[]DHq}618tH=G1yHs8H=G1[Hs8H=lG1ff.SHHt.tHAH1[fHH1[H߉D$ D$ H[f.GPfD,fD<.t<_tPЀJwPƀv[<w_HufUSHHHHU|68u8H;HtHHHtHH[]}DH[]ÐH=mFH1f.Ht USHHHH{681HPCxiH5K HHHC@HH@ Hp H{HHsHtHS H9tMHHC8H[]fHHH=G[]1fH=iG1IDH{HCHC(HC KP댐1_H=zG]{H[]Df.Ht ATUHSHHH)HSHt$HLcdujHqz68ug{H5HHthHsHt5HS Hu%H{KPHCHC(HC HD$HC8H[]A\HT$H=FL1gH=Fi{H|$ODAUATUSHHH(HHIH HHDB uHML-iy6A}(HtWH1E111Ʌu1HHt'u<(tg~M<)<\uqHuڐt\HA}IHL[]A\A]fD<"u,"AHEtS(AHofYEutODJ@)AH4fDD#H=VHH1X@AH=_E1HsHxHHHE1SH=DHp1q@E1HtsAUATAUSIH1HHI9t?H|HtouH|pH5'H2tAHI9ufDH[]A\A]Éf.AVAUATUSHHIHIIH;HHt\H1LHhHtCI}Ltj H5@ULIfDH[HuHv61ۀ8DH=-U1DH5TH)HuH5THHuHHtH-Dv6}IuHTHoIuHHLHt~HAE H[]A\A]A^DH5MTLLDH[H H5THaHHHu61ۀ8tD}u%H1wH=S1#H=BH AWAVIAUATIUSI1HID=ftp:HHjtjH HL9sFI4 =httpuA|:HZA|sHHjH L9HrDH[]A\A]A^A_DHZI9AH< HZ'H=t!HkJv tHHI9wHkALrH1At At  f HAt  H5RLL:!DI9޸HjL@A|:I9bfAUATIUSHHH56RH)HHHHR1H)HA HHH*5E1AHLF HA&HNEuyH5QHHHfH1[]A\A]ÐHr68tH=M@16@Hr68u2I$HtHH5dQ[]A\A] HD[]A\A]H=#@1fAWAVAUATUSHH$Ht$H5uvHL$IHQHL1L8HH5H4vHIHwLHLI I| 8HIt*H5PHLL1HLjLHtHjq68H1 LH\$pLIH=}E1HHL H=HHD$HT$DLHH5fH5uHHp680Ht/1 HDt$,HHD$$HD$A9LLH|$1H$[]A\A]A^A_8HH$L$??H=+>L1 #LL~zLHHJL0H$HL$HMHD$8H1%Ho68H|$8H52HHD$@HH|$h|E|H$H$L|$PL|$@IHD$H$Ll$HL$ Ld$HAHD$XHf.HL$H|$HYE1pHhHH8tx.L`HL$HH1M-_LHtH|$H>IF8H@ P(t11H ApHT$ ƿx%HD$hH+$H=: ~H>LD^HH.DHAD;l$,Ld$HL|$PHH|$@BP.x@H=LH19H 5NHH=LLLHE1H5OHlHHD$0uDH|$ L{tNE1HT$0H|$ OH$ txEt DAtL uH|$0Ld$HL|$PH|$@H|$8H|$>L6L.H"AXH=l:1L LH|$0NIF8H@ @(CHS3Ld$HL|$PX@H|$LLLHt$8H=BK1_EH|$8L|$PELd$HH|$@H|$7L/L'HD;H$H=zJHL1LHt$XH=J1Ld$HL|$PZHt$8H=JLLH|$H XfDHj6SH8u@H=zJ H޸8tH=gJH[f.HH=81f.UGSHvCHH5HHt(H5HHtH5IH@H[]ÐHGHHH8HUSHHH^HUHPup=HHtOH;f1HHiH&HH9s";wHHHuHHuH1[]fDH[]@1f.AWAVAUATIUSHHHH9H}t+HqHDH9vDH@H9w8 tH<-t'<(t#H[1H[]A\A]A^A_-HHtHH=wFHt$HE1HHDÀ8-L`tCMtLH9tHf.1HHIHDÀ8-L`uDxEtHLHHD$HuA<$-ILLuMAL[E1AH9DHDd$5D$@H<-t<(-HHH9f.Lef.A<$-uIILLuGH2g6A8UH=t5HL1IHH$IH@HAwH5EHuwHkE1[E1.HXf%fAHEt؀ uHEAuA@A  ŃH[]A\A]H5DHTmI$LHHP i=)@@f.HATUSH2IHXPHHH)HHG1HP`HHLHHHHHVJ tD ttHI9HHHO u4H)HI$[]A\fHHO t~ H~HDfD~ H~HDfHd68u1[]A\H=21_1H=21Z1fDHtH9tHH\:8HHH A'H@`@ AWAVAUATUSH1HH8HT$D$Lt$D$HD$ HD$HD$(HIL$HI0H=Hb6D$HD$ HD$HD$(8 LLt$IHE81LLLL@`At Hb68L$uCT$u-LL=H8[]A\A]A^A_DfDLLLD$tH;LuHD$MsHb68tH=A1Ha68tH=11^fDLLt$3QfDH=1112DH=A11DATUHSH5xAIHHZI4$HS}Ht&HH\a68u'EH[]A\/[]A\fDH=,A1ATE1HUStbH\P~SLcHH5HGH HfHdH5{HIQHIH^68LVLHLLH8MtKD/8 mAMfDH!^6A8Hl$8H|$Ht$6\$6D$7HHHt HHusH|$PHH[]A\A]A^A_H5 HcHH[]A\A]A^A_LpH==HDD1H5~H1CHHpHH]68$1HmHIH|$ HLA1H?HHAfAAHU1H|$lHHD$H|$THD$H=<1 $H=,A1uH|$H|$L0Ht$H=<1LH Ht$H=<1Iܾ/L3HZLRHxHIL}/`;HD$(HII $DJ Hu"lD$f.xfDH59uHHEH=%1H=41aDH=)%ԽH=3Lt$D@t$pH=31蒽H=31xE1H5tYL蓼LH8D$LhHt$(H|$ 諹D$H=S$1$Df.AWAVAUATIUSHHBH<$Ht$L$@H$HX D$CtH@`DpADt$ID$(HD$H7R68CHt 9D$@UsLt6A;t$ w/HR687H=$1d$H$DŽ$H H_H1HQ68L<$LIL JI|$(HD$ HH54: HID$(GHGH ,5f.;YtHQHHuH2H5y4K I|$(HT$ H5l45 H<$YH2H &5 @9AtHQHHuH1I|$(H52 L<$LII|$(H5;8HƯ LVH1I|$(H51螯 I|$Ht$ Oƒ ˆT$c_ H?P68H7HcHDAt$ H="1}CH;D$@HO68tt$@H="1Jf.H[]A\A]A^A_H|$L$MD$@}ID$E1Ld$I!AMvM[$KI>HtEI^H-H;LHuH;Hu=HO6E1Iހ8tH='1`fDH[HH;Ht^H51 HHuH5-H4HuD$uH51HHuH;HuffDH[HcH;HtH5D1 HH菽uH5A1HܸHuH581HȸHuH5h,H贸Hu*HHHM68H\$H_,HAH3H50H}HsHLE1fDIHдLHHBH5tH.LcMI<$HA8sLHH//H_LH;HxEtIE1HL68MH<$H5mnDHL68AH4$H$Wsl$H$H<$H$It$$L$D$@H<$8RHHQL68tH=m$1趶I4$H<$hHHHL68AH AD$ H<$h@$L$D$@H|$u MJD$@tTH$H{(ZHZHIHaZH8HL1;D$@Í\$tDŽ$HD$ID$(HHK68|H=%1觵$`L$MND$@$6fHJ6Ld$8H$.pH<$HDŽ$u$#D$@AfD;LH\)IE1Hb]HD$@ MMD@H<$WBH$Hx0HYHHVHHH J68FI4$H(H7H5-HIt$H6HHsH$AD$ "D$@%\$$L$D$@H<$XH H tH)68H= 1Hp8HH)68H=1@HX2HX/HA)68H= 1袓D$H$HuLHaH=]L1kt$H=1TOH=@1AH讋|;t/MtBH1H<"utfDE1Af.1H6HIt HLkHT$8H|$HAxHM1멐|$BH|$1D$Bt-@H|$t H|$Ht;tD$DAH|$CHZ#68RH\$Hl1HtCHt$(H2HT$`11He&At!AtHD$D`sAAAH|$ăEnH"68HXD[]A\A]A^A_fDLl$0HL萒Lx$` ZHLufˊI$HP:LlH3H\$HHH1LH芍HHt$0HDH|$8HHDHD$D|$CHt$H|$D1ED$C@HT$H|$MLHE1$E1fH舶HE1|$CHO68H=1谈H,68H=H1芈DH=LL$CD1ۈL$CH=D1FH=7136LL# HLH-E5HH7H5 DHHuHUH=7舑yH=7訑H=7H7H7APPH=71}31VD$H=$Dh1YDl$芌H-C5HH97H5HHuHUH= 7ȐyH=7H=7ܐ/H=1نLLHË H!%tDHJHDщHL)HHBHD$ txD$CsH=}1iAH6Ll$8tt$H=1+At$H=1HD$D$CHsH|$EHb6I81fHt 6fDH168u fDH=9H1膅Hf.fHI@?8<DfDGff.AWAVAUATIUSIHHHDwDAhAFAE>@tl{AH{AADAID AT${D?AD D AT$AD$;@uHL[]A\A]A^A_D1E1E}pAH;@tEAEuDEtWAUDAUDDAMDHAMDD>@AMrAUqfEupAEDGfDGrEMqOf.1@DT$ D $HDT$ D $c@DT$ D $HDT$ AD $ fDfL$ T$ H^H4$DT$ADL$IT$ L$ ?H4$@A @Et$  AT$AL$~@WEuDDL$DT$wfE0H868AAFAEDDAAAEuDA DE<$A AEL$IHsDT$DL$ T$ H4$DT$DL$ T$ H4$AEDAIE|$qEtDAA DE<$uIEAIAD$0AIEL$DT$ D $H0D$ @AFD$DDFAD~H= DE1PEuDDT$ D $E1E1E1@f.AWAVIAUATUSHHH}H$C@~IH[L- 8L|fDH+MHLEA<$tH$LL蝅t!HI9uE1HD[]A\A]A^A_D$ L$${~DD$ HII$DQ u=t5H68tHx7HH=LD$HE1MtLߥH9tHH}uL裥Ht^L֥HItsAAuHmHtH<$)H 68HD$HhhH[]A\A]A^A_ÐHuH$LHDH$cHIuHH= []A\A]A^A_}H=1wHD$Hh(HH$k@H4$H=1w`1IfUSHHuHDXu5E]<vE]<vH 6=8u H[]]H[]@H=a@1>wff.USH5FHH{H5H{H5H{H5H{tH5gTH{tgH5˷Hm{tOH5HU{t7H5H={tH 618tH=tH1:vH[]ÐHsHt@Hff.ATUSHHHtH{ HtH{Ht2C@~&E11J<'I踃9k@H{誃H{(Htt0H;Ht菃H{xHtH{H1HHCxHH)HC[]A\DSH7H[6@f.AWAVAUATUSHHH 6IH8crHfHtxHDQHtH=C7~H=73H=)7dH=7HqAtEEl$A#H 68tH=1ftfDE1HD[]A\A]A^A_AD$uH5H yBH5 HTk H=pOH-~5E1E1HA9} L}DmAHH}HuA1HH 68$H=2DLH1sDH=1sxHHH7H5NL5҉5II6HAVH=7|AuH=7 }H=7Hk7~H68uAAD$AAD$Ap8u8AD$AWH=1rH=7E1U~3H=QH1rf.Gff.USHHHHt'H}HtIHiqHEH[]fDH6H:)8tH=1rDHGH)HHDf.ATIUSH HHtHtKH]tBoH HH]t+DX uHpHID$ t[]A\HfDID$ []A\f.HG Hu(HHDf.AWAVAUATUSH(HH|$H oH HHDQ ut|H~68Ht`HD$Lcp@AHD$E1L`I4$Il$Hu'@fAE9IIHHuM)Ht!HguH([]A\A]A^A_ME1H5HLD$pHLD$H"mHxQ~HLD$4Hƀ*=HHufHH~68XI=HLD$rHLD$H56 HttH5H{tH|$H68H|$H(H5`F[]A\A]A^A_2ft H*u8H&H5HLD$AUoHHLD$H68HLD$kHx|HIH9HHLD$t"fHBHH9FuHH)HLHP=fH}=uEApAt`<'EHu<'bHuf.}HrH}EHH<%uE< gLD$HT$0uHT$LD$@@ @LD$HT$AHT$AH}LD$D"}Hrt ElHH6L8yH=:L1LD$MmLD$YH=H1/m=H=rfc2231HH~HfailureH~D<'tuEHu<'tdHu|LxbMfDH|$AFG@HLH4tH.H|$NN<HGHFHnjHE_LLD$ZzH6LD$8H=V#LD$\kHHILD$1H68H(H=1[]A\A]A^A_k@HntH=HuZHhHHA6 8C=A3H=H1LD$|kLD$;tH68FH\$LD$HCJ<NyHCLD$J}HrH}H5HE1>kHHLD$HjLD$tHHVuIHH=31j68H=1jEH}HcHD$h@H=H1LD$OjLD$QH=H14jLD$H=+1jmH=`H1LD$jLD$H=0nIH=1nDf.AWAVAUATIUSHHH-58LfD3EtnrgL AADD usA;tm=HlHHHHPADL HuQHH ADL Ht=uH58H[]A\A]A^A_f.Hg<"LrtHBuDIItADD tMI)I|$vHIt|HLHtLC'HLCLvfD:HkHH5LH=Q8'H1[]A\A]A^A_+hLHHgHI=HjH"LjHHXLLfHI"HXjHILtdLIidIDLHHD$ToHILd$H5HL^LLL^LCuL6uH5H;89H=L1g#:LiHHg58t_H=L1fLH=1fLtLtH58tH=UL1{fHL[]A\A]A^A_mtLH=|H58tH=L19fL9tDf.AWAVIAUATUSHHHbHD$C@~IH[L- L|DH+MHLEA<$tHT$LLjt HI9u1H[]A\A]A^A_fDcLd$H fII$DQ u=t-H58tHxHH=LHE1@eI\$HbHvA|$"tHH[]A\A]A^A_=dI"LgHtLdHH4"HgHHtHaDEHHf.SH5?|HpHt [fHH5[PSH5|H@uH5. H(1҅‰[f.AWAVAUATUSHHH|$bHHHEBuH58H5CH"[uH_5H-81DFH/HD$*_HI>9jE1I1HlL5z5xt#IIHtOIIUH8 94uH= HtHLdtL9~M&IIHu1H58>H|$LLpt$)HD$p +H8AV;t}NHGHL H;PtfH9uHcHjHt)Ht$HcV HJN AN H58I>qFfDH[]A\A]A^A_H58tH=L14b뽀8uQH\$H5ۧHH5H H=~1a+H=*H1aH=L1aH=LL1aHD$H8v H=L1aW 1tHATUHSH(HtLg0ioID$HC0H@HC0HtoHH@t6HFHt)Lc0HUHI$I[]A\HC0H[]A\nHC(HC0H=]efHATUHSHIx(z^HLfHHpxDZ uH}(H]0fnHCHE0HxH8HJLHOeHE0H@1HE0HMH@A<$|HH]0H[]A\DE1H}(um1HE(HE0H]0H;mHCHE0H@Ht7E11`DHE0H[]A\H8H@7@HH]0BmHCHE0H@HuH=1d7L%@L舋HHE0H8tHHAH]0LUHHE0H8ufDH(¸H]0HH]0lHCHE0Hx8ATUHSLg(HMtMKlHHC(tQL`H=?Lc(HHE诊I$HC(H8t3[]A\H舊HH[]A\iLc(H=1bfAVAUIATUSH(HtKH01HHC0ufHC0H8uH@Hu[]A\A]A^fHHC0fHIHs(Hj(H9uJDM9t@LH}HtLeHkMuH58[]A\A]A^IF0HC0I~HIF0IF(t!HC(1HC0GHC(HC05I~`uI~PuI~Xu1$1HHC(HC0w1H=R1[\]fDHG(Ðf.SHHHH58u1KD1tH E11HCDH[Ht$wDH=1[HT$벐f.HGXÐf.HGPÐf.HGHÐf.HG`Ðf.Hw8Ðf.GsUS1H?btH[]f.H(XH vH5H`u8YHUHDPtHUDPtHUDPt1ۀ} 뎐1H[]DAVAUATUISHHH`twnHH=fHtmIT$*IHBEHtM<=LbuEt=@IHBHLD$t:tH5 hHbQoA$H`L[]A\A]A^DH7MHYN,)HڈCII9Il$AD$H<=Lcu}@x@ n}A@ 2@)<=ItAIA HDsfHtLH LIH5LLH`[]A\A]A^ÐHHUHLLl$HHLrH1ɨ L=H_[HItH%58xHtHc<tMHuE1M4H LHHL9I+HEfHDBHBuL@Lb @H(WHHLl$&fH IH3Eƒ? oP߀=cH HDJTLD$I9rI9vUH58ulCD)IT$E4$"H TE1AH=H1 WrE1H ALHHMH=1VAWAVAUATIUSHhHt$@HT$PHL$XLD$HLL$0H$FHHD$PHHD$H586AE lHtIu8HtH|$EE E_IED$HD$8D HD$`HD$(H58 A&t$AhL@HHE{8HuHHt$@H|$HD$HLSHHcHEbAE ;D$1Ht$H$D$D$A9E vHD$8|$Ht$8IED$0HD$PHHHD$XH|$H5H\$8t$H=1DTALHLH8HԁH5HTHHxSHHHSHH58}H;H|$Ht$@HD$HHEHGbHkIEXHAHD$ fDHtHPL@I"L|$(AE1LHDLHHI9t$L)LH|$HHD$HD$0HD$HD$ M9Ht$tAE ;D$HmHt6H}腀AHHHtH=H1@H58AUDH\$(LHOHH)HH|$HHD$0ЃD$D$A9E H\$LLD$`LD$IIH}HE#f.L`H58'IEHt$8L0HHt^H5L;HuHHt$@H|$E1HD$HLHnfDM9L_E1Hp58H5LHHt$@H|$HD$HL`HHH%58H|$HD$X1=@HXHt$@H|$HD$H$H\$$HH$HhH[]A\A]A^A_Au H=1 QEU EH58tH=1PfH5hLHH}HH|$Ht$@HD$HHEH^EM EDLH$Ht$H$H3Ht$ H=D1dP7H=OH1NPH=1;PH=1(PDH5H\$8H=1PH5LHHt'H5LH=1O)H>58u,H5LbHzHt$@H|$HD$HH=F1wODAVAUAATUISHIHH581H\HHrIAVMLH1CHcL heHLhH cH$55595 H Ht Hc1H[]A\A]A^fH=1NXf.USHHH58uqHL dL7iH 0cHcHU5555tH t(H{(HtHD$ HD$HC0HC(H[]DH=_1Ht$MHt$rf.USHHHV58uqHL 5LfH 5H51UjH5 5H t(H{(HtHD$[HD$HC0HC(H[]H=1JM|DAWAVAUATIUSH( jL|$ HD$1E1D$IEHL$D$Hr58D$w)H1HcHLHT$LKHI|$D$D$Ll$A~ZHEHHD$ < HtHIHHLDLxHEHtEt=HNHuQMd$MtGI<$yHHuEut$H|$ALH?HtM6H5Ll$AEDDD$HD$D$A9E zHHELfLHHtMu2VYIH3fDkxHEH[HtMtHtT"YHEHH H;HuHEH=1RSMtwHtHEL1H([]A\A]A^A_@HEI<$wHElfDXIHHtH61fH E11LLAHt7|$ t0MHt"&XHEHHt LvHEAEDUfLH,H=1AR@cHHQE11vI$HmHt:HۿtDWID$IM H}HuI$HmHuID$HSWHIT$t$H=1I4M?1OWIHM'1*L"HGxHtfDS1H1F HCx[f.AFATUISHHt"H;HkHtwVHHlVHu[L]A\[VHtUUSHHHHt'DH;Ht H`?tH[HuH[]CH[]øAUATAUSHIHHD~D9H[]A\A]H]HEt@H;H[HuEH]UHCHEHt4H@H]LFHHEDhHD[]A\A]H58tH= 1&GH[]A\A]fDL8FDkHD.UHEHEifHteAUATIUSAHHHHtH;Ht H=t$H[HuHDH[L]A\A]KPDcHD[]A\A]øHtbAUATIUSIHHHu >H[Ht4H+HtLHt=uH0THAMH[HuH[]A\A]Ht8ATUISHHHt"fH;HtsLH[Hu[]A\ÐUSHHHtrHHBHHHSHHH5B[]Sf.USHHHt}rHH2BHHH[HHH5[][f.Ht2USHHfH;HkHtqHHRHuH[]HATIUStlHHHHHSHuRHHCI$HtlHI$IT$HPID$H[]A\Ht`qRHtfI$HIT$HPI$[ID$]A\fDHHH=I1H=1I1zH=gH1gf.AUATIUSHHH8Ht9lMHtHLHHHQHH[]A\A]D#MHHImHW1DHHEHuH58t"[pI$H[LHt,QHEH;IHuHH[LHuID$LHH[]A\A]DH1E1oHEH[HtiMt4PHEHHtcHEH;HuHEfsPHILH=1:B*Mt@HELH=11 GM|LoL11^H=1FKfDH=AVAAUIATIU1SH"nH{>H[HlHtH;HuH[HHuHLt$Mt(HLUt5H=u1I1[]A\A]A^6OHItHHKUuEtbLH;LMH;Ht nHH[HuI|$HtID$LpS[L]A\A]A^@I<$LMd$MuH=1ILzNH>1HATUHSH5I8ID$@tnHt1HfDH;LH;Ht (mHH[HuH}Ht4HEL[]A\f.H}LtHmHuL[]A\HQ58u<THIa1HVH=HƉ1?-H=1x?fDAVAAUATUSOA=ALABLcJD5H~]LH?uRHI9}FH9IISI$ 1HLHP`Ht HLHJ[]A\A]A^@[1]A\A]A^D1DH1Lk2I$)Df.AVAU ATAUASAAmHDHODDHIB")t(u :ft3$LHuH[]A\A]A^D H$DHD)‰)кA)McB JtABH[]A\A]A^ø@USHxs;o,~'H58uFH[]f.HcHLLt()HcH[]ÐH=1=못fx6 _Sf.xeATUASHHۋGHHD$"HH$8DAED9H<$McLrH<$L>vC8A9FxHt$DH ls DDK9O)DHcHt$|$F9K D9O9DH)AE2|$$H|$=H<$T1DKH=m4|$K$KHt$DHDKDHt$|$9O8KD9O9u?DH$KAD9O)]@HD$8tH=1.|$#H|$q"Hi58H= 1E1"f|$ wHD$ HtH0MtIF H(u H|$H|$A 0H|$y0H<$H5Lt$(8CH=ϷD1="-H5Lt$(8H=ܷ1"L|$LBLA //HH$H=/1&H|$/|$ uHD$ HtH/H\$H&uH|$A/HA w/Ht$H=1W!H0H9EL|$ Z0|$ H5Lt$(8H=ܶ1 |$ HD$ HtH.H|$.H<$bH\$HE0H|$A.|$ OHD$ HtH.H|${.H<$ H|$ c.|$ IF @(u H|$H|$;.H|$1.H<$bHT$Ht$ H=:1 |$>x |$?AD#H=%1$H|$-|$ ku@H:HHD$ H0(7H=ڵ1kH=1XHG1Df.1HDf.USHH-Ht&(HSHPHC1H[]f.HQ58tH=1Df.ATUSHdt H58u/[]A\H{/Lgi,+Lc[]A\ÐH=a1BSHf.HHt1[AWAVEAUATE1USHHhLl$PHt$ HL$0DD$,LL$LL$D$LsAdw2HD$8w%Mt;IF pHA9v/t+H58HhD[]A\A]A^A_fDLVA:HD$LD$8HD$HD$`HD$D$,D$<@L8Ht$L 5s0L4$]Ax;ANj4$AE~1DH߃A9uL|$HL?wDA,)HcHHMH|$ t I<HMcLHL H$`IIJ 8B<<t6<Q<HH5:H=̳1MIF pLtAHL$AV89s2HC58tH=_1LAZ DHP@HHHtaH9s\H$H;vOH58tH=1MHH$AVLL$(DD$<xHL$HHT$ HHt$H߃H$H)LHD$0ЅtAF2 D$8uEDL$,EHD$DELtt@$AVALL$(HL$@Ht$0HM^_tAF2 t,u'D$8HHtLtALH,LfDLDd$8KLA8H|$ H $AF3H|$ ~Hx'HI)H|$ _HL$ HpHEL1b L&Hή58HHtE$AVLLL$(DD$LHHL$@ZYtAF2 D$8HHtLH,tL~MiL&\IHH5s1N$H $HD$@J<8HIH=HtH= HuIH5 L&NfDHq58H=1H=1/H;58u;LA`E1VH=L1@L}%H=D1bLAf.AWAVAUATIUSIHHhH5D$ 8NHtMHE HDŽ$PHDŽ$0HP8Hu?HD$HHEhHT$HHxPw91Hh[]A\A]A^A_DHM(H9vH)HT$H$@HPP11HH$(P`HLt$ Hƹ@LHDŽ$ QHIH$0MH55LH589LH$PHt# fH=1DH)58L$01MtD$>Pf>t$@b9WT$XHȪ58H$@HRPH-=LHH)HcH1H$$HD$L|$ DŽ$HH ,E11PUM1LH$@IHDŽ$@_AXDL$ EHH$0H$P,H58H$PHg L$0H 51ۀ92H=G1 L$0rH51ۀ8H=G1L$0EH=1H=1L$0 H=!1H$@H@PH=v"H58L$0HӨ5L$>3HcˁHLH)ȋL$@Hc1H@$$H=1Hz58L$"T$!H=/t$ ASD$/PD$6PD$=PDL$D1DD$CH-5H 8L$*T$)H=t$(ARD$?PD$FPD$MPD$TPD$[PD$bPD$iPD$pPD$wPD$~P$PD$1D$"H5H`8&t$8H=v1H|58twt$:H=m1H]58t$H=P1H58t$@H=B1xH58ttt$LH=:1ZHۦ58bt$PH=(18H58ttt$XH=1H58"t$\H= 1Hy58ttt$`H=1H[58t$dH=1H958t$hH=1H58H=;1xH58$$H=1SfH=1@$HtpH58s|$ HH$8-HD$D$ H MLE1PU1L1H$HL$@Y^IE3HB58HD$D$ H M1E1PU1LyL$@XZH=1jH58H$PH=1DHŤ58H$PH=p 1H58H$PH=p$1H=ܝ1)H[58tH=1L$0 H=j1zf.AVAUIATUAS@IHIcHH<HmHHbLHCn HHC(JH;HCH{(t$HtHtDc8Lk0H[]A\A]A^fDHtH{HtH;HtH{HtHH=f11H=11@f.HAWAVAUATUSHH(?At<)HcdHHD$yAIcIAHD$H\$6HL$HHkHELt$AGA9A.@x HHHL$DH@u@ wK_AHCJ0KHX_몐AtH58AAEDE9~KfAF_CaCa ʼnaCffaa@kCHCz@HH+t$HH\$HHHDH([]A\A]A^A_1H\$H=D1 >1H=1DATUSHĀIHc1LHHu#L H1[]A\DL)HpH)rHH[H?]A\ftoAWAVAAUATAUSA H ILDC9u!)t DLFDb 9tH []A\A]A^A_Ðf.AWAVAUATAUS1HDHAIH$HHHIHD$1l1Lx 7H$ L$! DAFHHD$PHD$XHD$`Hl$Lt$(D$0 T$r ;D$t4DH|$jD$D$HĘA[]A\A]A^A_@Ld$H5:p)LD$tID$u. HFDHl$T$;D$)1LPu\T$0u LDt= uuLt$(D$0 fDHt$H=1D$& DL+T$0+\$0D9t_LDDpLDXH|$H=1D$+LCD$fUSպHH1҃ufEºfH[]DAWAV1AUAT1USAE11HXfD$.HD$.fT$HD$HD$0HD$Ht$Dw/t$.fPf9t$sHHL$.HfL$1HI-T$.HT$.9|DHL-Ȝ5IA}M1H=L AwH=e HLHt$D D$.Af HA}Ht$L|$H5L% H5vL A}HCHCA}8H=1%D$.)Hc HLHHXD[]A\A]A^A_Ðt$.HʥHH=HE1Xf.A}H=1gfHm HxHĚ5E18eH=1"RDH=9H1jfE1A}H=˟1 L-Y5A}uc1L HE1A}H=W1E1E1A}H=ܤ1lH=1YH=դ1I@ATUISLʼnO Ht!߉L19É[]A\H51ۀ8tH=1f.AWAVIAUATIUSHHH5D$bD$ca8MHD$hH5-3 LHHD$ H$LD$hH 3ALH1R1H1Ƅ$^cHl$p"H"Ht$bH 1߉ HI1Ҿ" H1 9H!5E18`Hl$\fDf|$\t8Ht1HĨ[]A\A]A^A_fAHHtf|$\t' HEDHtt$\ft HDHnRD$\fHpdN HHt$ZD.H58|$Zff3LLHIf|$Z)1E1HD$fD$.HD$`L|$8Hl$0HD$HD$^HD$@HD$dHD$HID$Ht$DDt$(N<BooT$`fAf;T$.v(H|$uHDL$`HD$fL$.Ht$T$`9H|$DHHMML$HLL$ HL$H|$8HLL$ AH58H HT$hI$Ht$JDt$`Ht$0DateD$\fHp Ht$@D/t3D$^H4Ht$HHD$HtH> T$ZL9T$(I<$Ld$ HD$Hx HD$Hx( HD$Hx HD$H 1nfHA58LH=19DQH58tH=1w1t$dEEH5t$d8 ID$B48TAFID$(D$Z91@H=1PDHt$0DD$\Hp(fD1LHvH5A8H=m1vHT$hH=H1ZX1ҾdfT$\H=16t$dH=>1H58H=1Hx58H=.1p@t$ZH=D1RH958DH=11DH588H=i1r%DH58H=!1JDH5I8u=L1 H58H=1D$(HT$hH=H1Hl$LD$fAWAVAUATUSHHHHT$ HHD$/H|$@1Hs1AH|$(IE1HHD$=DHD$HD$>H$Ht$L$ L$ ;AEDfDEt EODLsAEtD$=EADtH4$1҉i)At$>1Ѓ A )к1A@)1A)1A)1A)1A)1A)AG!z)DB A9v)CL w%A w fJAGA7A9T@BT<@AuH4$&uH|$L18H|$fH|$ t HD$ 1HH[]A\A]A^A_DLLs$t0@2E;H0H2H|0H|2HzHH)H)ʉHHHt$(H|$DKH\$ Ht H|$O H|$# E1Ë0ɉ2DD nDfD ] AUAT1USH1HLd$ xLt1HĨ[]A\A]@HT$޿O¸ tыD$ HL$@H)H1HtHE Hx 9IĸMt1LAxqHB58(T$ Dc11DHDܫDBHtHE @(Ln1DH=1LL? D7HVGHL6iL( EH=L1xAWAVAUATUSH(HHF Hx HI&HL%5Lt$A<$LtA<$LH([]A\A]A^A_ÐA<$D|$\$fAtF1HH91HމH9uA<$wH=1{dfDHAA<$SLA<$4LL H(1[]A\A]A^A_H=$1D\$H=1ރA<$fH=1A<$D|$H=1AA<$\$H=1nfH=1T$ LT$ 1H=1L8L(1)A<$H=1H=D|$\$f.AWAV1AUATAUSHHLt$0Lfu"H#581HH[]A\A]A^A_ÐDl$4D|$0EtAL%5A<$7Ao1҉HoH9tZA<$tH=15H58tH= 11H=1cDHD$,E1Ll$-HD$0fL$8H$HD$.1HD$IFHD$f.1I9H4$XL$,@bHsHcHA<$tH=z1;끐Ht$1҉ A<$tH=ΔDHt$1҉l$.E1fA<$nHH5HLA~JHH5֧HLANHʧH1赿H-HH5HLBA~HtH5HLA~HtH5pHLA~uA~ uA>t A~uA~HtH5/HLLLH$Ldt!L$LAFt1AFH/`58HsH`58rAF srH `59.r }rAM0@t#A}@u\$LnsAF1^sA>-IE`t:t5$'u+ANc.uwL$`A~`T$0DʈL$`IE L`hMH$HDŽ$0E1ADLD$g1DBL1H$BB %qHjBAE0@tA}@u 9D$HAF‰D$p$D$0I$H$(D$09D$H|$(L$D$H$H$@H$DL$HLD$ T$Ht$|$HH$ D$Lu[$tQHx\58tH=1H|$AE0@A}@H5L^AvMtT$LH5УLνHLAA=AE0@t!A}@uL$0H\$Hk$+D ;D u7AFL$p9G9$L$pAV$$H[58tH=r1H5L蕇H|$(AH|$HH[58tH=r1H5LNH|$(AH|$PH[58tt$LH=1`|$xD$LH$HHHL$0HH$9$$t"T$ )ʅ~Hc҉LAD$8DŽ$H$H$f$D$L$$Ht$XH$48H$H$ <Ht$hH$ 󥉄$L$ $)$D$H$$HIqH$HT$LHH$LL Iu ILLŖpppLMu`A+IE H@pHHD$(SpH$`1H$HDŽ$DŽ$ HHD$xH$0HD$XH|$(A+HL$XoHD$xHHHuHX5H$8u It$0H$ ARjD$XLPD$(PH$LL$(HL$xH$L@YH AH@X58u It{HcH$`0CIHX58t#H5ʙ$ MH=՟IE1aIHtHMH5IEMtL6H$L$Ld$x1H$E1HD$XKwf|$8vHD$hx9GAE@AE@A` $t@T$HD$1DJD9s(x HP$uxtx0t x("BHӉL$($B|$@D$xf|$8ut$PO|$@u f|$8u$<`'<"|$xt>Mu`A@t*$($'$n4A B$^5$Mu`D$8fD$PAL$PtQtMHk$HL$HT܋L$9r5B =2v+-29s"HD$0H5 Hx65At5|$Pt.D$8HL$Hk$HDHD$@D$(`9$0HAt+|$Pt$D$8HL$Hk$HD܋L$;HD$@ AD$LHH9D$ vvH|$0H54u\$vOHD$0H5H[u.HD$11P9BʃH$9t$uȅD$8A$HL$0'H5 HHL$(HL$(HQ5ATD+q8tH=vD1t$L1ɺHD)U`HtzDt$LD01ɺHDU`Ht]8uAHH@ H=L$9L$0CE11ɉ 9$tHL$;Ay$AE@HILt$H$HLLL+Iu ILLy fLALH|$0H5u,HD$0H5 Hx&tu$ H|$0H5 Lu,HD$0H5Hx.u$H|$0H5 $f$HD$0H5!Hxf+$$=$AD$(D$(-=HT$0IH5DD$`H|cW_HT$@L$(DD$`BAȉL$hH9D$ 2H|$ pHIHL$ 1HHJHH9D$ tN58t%D$DD$hH=әL$($p1茸IE Hx ϱHH$`HǺ1BzD$@yKHM58tH$`H=v10H$`A %Ht$1L1*MAPD$pLLPD$8PD$XPD$0D$HL$(T$@D@H IE x(H?M58tH$`H=mp1薷11LLH|$|$@11蓿HL58tH=pg1Y|$@LkANj|$@t9IE x(uH$`赫H$`E1ëIE x(uH$`|H$`83H=o1軶 H7L58tH=1蜶|$@SH$`t^H|$A zH$`m1L1wK$H$`A I H$`A 111L6KH$`AE2 t D$pA;Eu(IEHt4HL$`H;t*H|$AH|$AMu`Ht$1LAJjHD$`Ht$ H= n1A胺H|$q4l+$$=$+$D$(ATL$$DL$HLD$ T$Ht$DH$ljD$D$Lu$nt$L1ɺHU`HHqLH=eE11HLHD$(xH|$(3LL$(E1IIHH\$(H$AH$D9D$uH\$(MtHH5L֨IE Hx iHH$`HǺ1BD$(HiI58tH$`H=1ƳH$`A Ht$1L1HmLűH|$HLAE0E1|$XAA!E*ARD$0LPD$,D$LL$ HT$t$HD@螎A[Z8IE x(HH58tH$`H=Im111LHH|$|$(11HPH58tH=b1赲|$(LfANj|$(t5XIE x(uH$`uGH$`E1u8#IE x(uH$`ܦu*H$`CH$`A +H$`A 8 H=~l1HkG58tH=1б|$(臦H$`JH|$A 調H$`蝿1L1FTHt$1LAF:9D$8rMsLL9|BH1L9I9u,L9LL$P}"SHDD$@9;DD$@LL$PD9D$H\$(HF58tH=k1LMu`sL11EH$`˾Mu`QH|$A貾uH|$E1蠾cH$`L'L詮H$`HIE x(HE58tH=k1711LEH|$,119HE58tH=`1LEdt6詤IE x(uH$`bH$`ŽsIE x(uH$`,H$`A艽LH|$0H5&bHD$0H5Hxh@HD$@11DHHD$HA9DGʃH$9t$t}PP9Bf$QHD$0H5Hx虵/l+$$=$+$D$(E1EɉL$P…DL$`D9pH=ԏE11HLHD$(qDL$`H|$(DL$`߫HIDL$`E1HLHLD$`DL$hLD$`HI9t?HvC5DL$h8tH= gD1ӭLA ͻH|$ûD$L\$(E1L$DHME9AOAI$H|$Au8H|$E1c&8H=i1?H= Z1A6H$`A H$`A HHD$(zD$0LHHD$0HU`HHD$8#D$DL$HLD$ H$T$Ht$zljD$u$1ɉƺHU`HHD$LHT$0HUxHD$L$@DtHA58tH= D1MtHH5pL诠IE Hx BHH$`4HǺ1BAyMHGA58tH$`H=1褫H$`A 虹Ht$H|$(11@IWPEHD$D$LLHt$8H|$H|AXAY7IE x(H@58tH$`H=6f1H|$(11'@H|$11DHt@58tH=Z1٪DL_ADt5~IE x(uH$`7uGH$`E1蛸^IIE x(uH$`u*H$`i,H$`A QH$`A 98 H=le1H?58tH=+1D讞H$`qt[H|$A շH$`ȷH|$(11>}Ht$H|$(1A>aH|$(菷H|$(11>H$`o$H=58tH=b1誨L誶Mu`HD$@x 7HHD$(HD$@@ uIH=58tHD$@H=ap 1KLA EH|$(;H|$1HD$@Ht$(HPHL$@HQ H9uMtHaH5TL蓜IE Hx &HH$`LHǺ1BѧD$@yPH*=58tH$`H=1臧H$`A |HT$Ht$(1L1|<)DD$8QLD$HPD$ AHL$HT$8Et$`wU^_=IE x(H<5 8tH$`H=`1Ht$(11L;H|$ڴ|$@11HF<58tH=V1諦|$@LZANj|$@t5NIE x(uH$`uGH$`E1k.IE x(uH$`Қu*H$`9H$`A !H$`A 8H=_1Ha;58tH=a1ƥ|$@}H$`@toH|$A 褳H$`藳Ht$(1L1:IHT$Ht$(1LA}:*LATH|$J Ht$(L11J:H$`'Mu`|$8LT$$<$Hk$At9fHt$D9D$@Mu`AH3:58$ <$+D$pH=E11L‰D$P$g$HIeD$HL$H\$hH$Hk$HDDHD$(D$pHD$`Stv{$p 9f^sH+t$`LL9JH<1LI9AH9@A,H9#H諾;H$H9\$(tMH\$htHH5ՁLIE Hx 觜HH$`HǺ1BRD$(H858tH$`H=O1H$`A Ht$1L17H\858t$H=1Z1躢H|$A貰ut$@H=Y1蓢$ <H858H=Y1dMu`D$@H|$LL$@RL$R$RQL$HQL$DQDD$@D$lHL$8$$A)AH0IE x(HV758tH$`H=LY1譡11L6H|$蟯|$(11誩H 758tH=Q1p|$(LUANj|$(t9IE x(uH$`̕H$`E1,ڕIE x(uH$`蓕uH$`H$`A HV658tH=$1軠|$(rH$`5tHH|$A 虮H$`茮1L15CHt$1LA|5)L11k5H$`H\8H=W1$rH$`A f$DL$hHD$L$@ L$(P_ Lt$1ɉHAvU`HHD$PPD$`1Ld$`Hl$x1҉Hk$HLLE1HL$(H@ MIIލH9H\$P Z׋z B rD$(9r D$(+av=+av @N=ogo[@QrH=G1ɺ)U`Ht]HЈH,Ht?|$(HBvH5vLHD8`AtPMD$XAE2 +M|$`t |$PD$D$(Ht$PA $DL$HLD$ L$L| T$H$$L$HD$(@ HL$(I9HH~H9AH9AukH9}f@u8$],LH- HIË$#,19vA 9wt AHAAD$ l$PLT$(Ld$`Hl$xMH258tt$PH=J1Lt$`D$(HD$`1ɺ H0U`HtU`tDxt"D$(HD$`D$(;D$PrL轪lUt:Uu΀xuȀxuH5[zL5^tu3AE2 tD$X뜀x`uLA`H|$VLD$EH|$;D$A$$<)9L$p9$$$HZ158HD$|$@HDp(L$hHL$DIALDI L$P$<L$`Dt$hHL$DH=]zLDL$hDD9IDCQD$9BE11ɉ^DL$hE$tgL\$ACDtZ9rVAK$+L$PHH9@H@u7H9}2|$@t&A9w&Et!ACHA+DHH9H9~ uA9v#HP058|H=J1豚iDL$hMHIDL$hE1HLHD$LD$h|D$LD$hA9t'H/58tH=J1@L@|$@tHD$LLxHH)L衜HD$HHDp$P@D$PH)LHL$;ADt1Hh/58tH=|J1͙H|$Aç醽MtHxH5 xLKIE Hx ޒHH$`IHǺ1B艙D$PyKH.58tH$`H=0x1?H$`A 4Ht$1L19.VD$XLPHD$P$TPDL$lD$HL$P$$|$`諱H 8IE x(HG.58tH$`H=}I1螘11L-H|$萦|$P11蛠H-58tH=xH1a|$PLLANj|$Pt5IE x(uH$`轌u{H$`E1!όIE x(uH$`舌uH$`鲻H$`A ץ隻8#H=H1賗H$`A 裥fH-58tH=v1||$P3H$`tHH|$A ZH$`M1L1W,Ht$1LA=,L11,,H$` H|$齺8tH=u1ږHL$D$PA$DI@D)ɉL$`+H=Su1誖HD$|$@HDp(H,5L$ht8H=H=6D1G+H"58tH=Sm1(IE x(t0H$`A ϰH$`A 鷰H$`jtH$`A ˚鎰H?"58tH$`H=#C1蜌H$`A 葚1L1!H1LA!3H|$A[H!58"H=_>10H!58H=pk1 H!58H=1k1Hf!58H=j1NjHC!58tt$@H=C=1褋H|$A 蜙_H!58cH=<D1nMH 58tt$`H=<1KH|$E1F H|$7$+$<1DL$HLD$ 1H$Au7$t-Hq 58tH==1֊Mu`A@HD$hH=iE11LDL$`@D)A‰D$@LLT$PNLT$PDL$`1DLHU`HItU$<AHHT$h)L$PAH)$9r );B rhH58PH=<1=H58tt$@H=<1H|$A 鰭H|$E1ۗ鞭A9T$P7HB58t$PH=<1蟉$+$<9|$pz$l$^D$(L$Hk$HD$HD$`9;)-9,H$DL$H1LD$ 1$D$h$<D$)$$)HD$`L$PL$+@ D$xD$($Hk$HD$EH$@$lH)58EMu`H|$荖PH|$E1{Ls6HT$ H=hE11LKH|$ SHIkHL$ 1HH-HH9D$ t111L H|$|$(11HU58tH=51躅|$(L9ANj|$(t5]zIE x(uH$`zuGH$`E1z=(zIE x(uH$`yu*H$`H H$`A 0H$`A ۨ8 H=k=11L1Ht$1LA锨Ht$ H=<1A軉H|$詒lH|$E1藒ZD$@A D$`H\$@$D;$DLH$tw+$<D$`XtAH58t5t$`H=i71L$D$AL$D$9)A;FAgH\$@D$`L$DpMcMk$LđHHD$@L$:HD$@L$P;T$`Ht$@Hk$AD+$<H=61EMu`4Ht$`$9r )щ;Vr'H58yH=51Mu`H$9T$PHg58>t$PH=51ĂMu`H\$@HD$hx u=H'58tt$(H='41舂H|$A 耐H|$@v9HD$hT$x1HpU`HH$t$HI$CL$$H58t$H=ra1MtHaH5G`LvIE Hx {HH$`HǺ1BāD$PyPH58tH$`H=a1zH$`A oHT$Ht$@1L1oHD$h$LT$xH$)H)PD$XHP$P$TPD$LD$`$$VsH =IE x(HZ5 8tH$`H=31豀Ht$@11LH|$螎|$P11詈H 58tH=01o|$PL4ANj|$Pt5uIE x(uH$`tuGH$`E1/tIE x(uH$`tu*H$`H$`A 騣H$`A ͍鐣8H=821H%58tH==_1|$PAtH$`tH|$A dH$`WHt$@1L1\ H58tH=11|$PsH$`stnH|$A H$`H|$@驢HT$Ht$@1LA銢Ht$@L11H$`褌H$`蒌H|$@舌kH|$AsH|$@i,H=1LAWH|$EH5H\$@8H$;AL$xH=!]L9CE11ɉmAuDD$x$v9rjHV58tt$xH=.1}H|$E1貋uH|$裋ft$`H=11LD$@}H$LD$@RHD$`H=\E11L@+D$hAD$@LL$@L$t$h1LHU`HH2D$@$<1L$D$hp9 BAD DHAED$h )D9D)A;@H$H5L$(HT$P8tH=#*1l|MtH5eZLcvMu`A t$v0$X $vD$@D$x鉽H|$ Οt$(H|$IHk$HHHD$(@ ‰D$@Hk$HH=[HHD$`AFL9‰$CE11ɉ?oD$@$9!` HD$(x u2H58tH=/D1B{H|$A :HD$(T$@1HpU`HHD$ht$ xHI HD$0H=Z HiHHD$PEnHd H=58tH=/1zHۤHD$PHD$(D$+$<D)Ȁ$A H$HD$xVT$$RHL$pDHt$PH|$xLHD$`ЅZYH58tH=F/1zAHD$0H=}dDD$PHP/mmHDD$P1$`$$0t};$v0EH458tH=01yL虇鎻t$@H|$hH$0h)HNjD$$LPHD$8DHD$pD贬YA^대$uHL$($++$<HEOHD$0H=YDD$PHP9plHDD$P&HD$0H=XHPEClHDD$P1$`$$$0 ;$t$@H|$hH$0R)HH 58tH=-1MxHD$PH;Y 5sASD$$LPHD$8H$t$PH|$xDHD$pDKZYH 58H=y-1wD$D$(闸hquHIDŽ$`2 HD$hHxAQAVH$pPjjD$pPLL$PDD$@HL$8H0Lg  Mu`LH 58tt$@H=F+17wH|$E12H|$#H 58t0t$hH=w*1H$$v$H$D$@ 93|(D$hH$pHcHk$HH$貄HHD$@H$H$HD$@T$PD$h1ҍxAFrLT$@HHk$ADAD  +$<9A2sHD$`x H 58tt$(H=)1uH|$A H|$@鬙H] 58tt$@H=(1uH|$A 趃yH|$E1褃gHD$`T$x1HpU`HH$Y$sHI$t$EЋ$H$tD$H 58t$H=|T1tMtHTH5QSLiIE Hx #nHH$` HǺ1BtD$PyPH' 58tH$`H=T1tH$`A yHT$Ht$@1L1y &HD$`$D$xH)H$)ASL‹D$XP$P$TPD$LD$`$$^fH IE x(Hb 58tH$`H=&1sHt$@11LH|$要|$P11{H 58tH=#1ws|$PL'ANj|$Pt9hIE x(uH$`gH$`E13gIE x(uH$`gH$`8.H=h%1rHU58tH=mR1r|$PqgH$`4gtcH|$A 蘀H$`苀Ht$@1L1=H$`A b%H$`A J Ht$@L11JH$`'H58tH=$1r|$PfH$`zfKH|$A H$`H|$@醕HT$Ht$@1LAgH|$AH|$@HH=%AvvH|$d'H|$AOl$PLLd$`Hl$xMD$@LpHD$hAPHxD$$PHD$8H$DHD$pD/AYAZHc58tH=?&1pHD$PH;L5ASD$$LPHD$8H$t$PH|$xDHD$pD覝ZYH58TH=D&1]pAHD$0H=P HPqcHtHT$PH=P cHt+H58tH=$1oHHD$POHD$0H=O HqHHD$P>cHuHD$0H=O HPicHt+H58tH=R$1{oHHD$PHT$PH=WO bHuH$HD$PHD$xH|$A'}$+$<9D$p$<$6$D$H-OL$xH658tT$H=1nDt$x1ɺHDU`HH$BATH598H$HT$P@+$<9Ht$PNу9r6H58H=1n$P)ЉD$hHD$Px HX58H=K1mH=1mH$HL$P@+$<9cMAB=D9T$@H58tH=S"D1DT$xDmDT$xH$t$@IcH|$hLHD$xHAPD$$D)D$D)PHD$8DHD$pDHD$`AYAZD$EpVD$$PHD$8H$DHD$pDf$Ht$($++$<HED$@LpHD$hAPHxD$$PHD$8H$DHD$pDfAYAZH58tH=!1lHD$PH;c5ASD$$LPHD$8H$t$PH|$xDHD$pDZY+HS58H=!1kAH5ILJ-4uGAE2 t#D$XMu`oH|$Apy3LA]yH|$SyLD$ByH|$8yD$A8H=<1 kbHD$PH$@QD$`Љ$99D$hH Q59t$hH=1jxD$@LpHD$hAPHxD$$PHD$8H$DHD$pD荚AYAZH48uE1;H=U 1>jE1%H48tL$ht$`H=S1jD$`9$H=2HC$LE11ɉk-HL$PD$`H=H$LQ 9BE11ɉ5-u1QdH48t$HH=>1/dH48d$|H=}>1 dJ$@H==1cHq48t$DH==1cHP48t$PH==1cH.48$RH==1c鷏$(H= =1mcH48m$,H= 1HcH48it$H=<1&cH48i$4H=<1c!H=9<1bHo48q$"H=$<1bHI48p$#H=<1bH#48l$$H= <1}b鍎H5;L_f$TtGH48tH= 1CbAE0@A}@H50:L#AHD$XIHH}tGHr48tH= 1aAE0@A}@H59Lb#AzIHD$$0D$$\D$HH 48H48pH48H48lM@$"H5;LL$`X$#H5;LIX$$H5;L3X$(H5;LX$,H5;LX$H5;LW$PH5;LW$RH5;LW$4H L1fTH5;LLU$@HL17TH5_;LLT$DHdL1TH5A;LLT$XH5L1SH5 ;LLwTL$HH L1SH5;LLKTHD$XD$xD$@HpHD$h逍H$L$ HLHL$LD$.]H="8H1=_MLD$HL$H48†$TH=SA1_駆HD$XD$xD$@HpHD$hZ$XH=91^HH48ot$HH=91^H&48M$H=81^3$@H=N81f^H48t$DH=E81E^H48t$PH=881#^H48$RH=-81]$(H=71]Hd48m$,H==1]H?48it$H=W71]H48i$4H=M71w] H=81d]H48q$"H=61>]H48p$#H=61]H48l$$H=61\vt$8H=51\H5D5L轿AE0@taA}@H54LVAnH3H2ل$TH=>1p\H2鲄A}@$D$8f H=41df=Aef=Of=df=Nv/f=b؆f=f†f=`ɂ[H1%f=Lt'f=Mʆ飂H1H1H11f=Lv/f=hf=f=fU鑅Hj1鱃f=f=+H1錃H=31c~H4D$8tH=K1[H|$(iH|$hAE0@~A}@~H52L{A~H\58uA6H=71ZIEhA1AvHHP`H4H$hHIH$AH=] E1HgH48tpAGAOH=APAGPAG PAG PAG PAG PAG PAGPAGPAGPAGPAGPEO1EGA6YH`Lg H=W1^AH$DT$gH$gH$gDT$AE5D$]H=uH1c^H=1P^A H|H$L!H$0LAugAE2 qA8H|H$AA7LG0H$0L^Au AE2 EH=q5]$t#CHĠHgfJDAH=16XAA9FsH48tH=41XAF tH48H=1WA~xH`48hH=1WUAVAvH=41WH'48AvAH=41WH48AVAvH=31[WȌt$0H=w31DWH48tH$H=a31"WH48tH=1WH48jAVAv H=331V?H^48CH5.LnH|$(AdH|$dpzH|$(AdH|$dQzH48t$H=LD1L$YVL$f|$8t~DD$DA%pHL$Hk$HHk$HHljHι D9r+At$DHL$(Hk(HHk(AHHHι E9rfl$8D$8D$QH|$(cH|$cAE0@|yA}@qyH5-LBAZyH=T21|UH48H=1^U4XHH$EH5-HLTH48tH=1UH|$(AcxHt4A8xH=1TxH=?01LL$TML$l遃L5+1DEғAE0 H$Lu\1阒H$LtkAE2 t@KEEID$(H9qHh48tH=,1PHEP3P!P3P#H5.L@AAE0D$X H|$A]^ trpH=pG1ɺ)U`HH+:HCH|$(Hi'H5E'LHDAru7D$XAE2 ]H|$A]sH|$E]nsH|$E]\s|$P7|$`'AE1L$H$H$Mu`{H>o$AIA9HDt$xIYErEwGHr/KvA<w#E1ۃA8t8L$(tIcE)HEHELErv qC@w<AuAyuABH$AHD$(H48{t$(H=1D$L$D$$)N$D$L$D$$IYErȃHCPAwII)H9vn1IvEHS`HtVf=MZf$tlf=ZMtfA>tCH=l$1rL3LHS`HHtH$L7XA>H[]A\A]A^A_fDAGHSPp:HH9vH)1HvqHS`Ht(퉬$udA>tH=$1KfH=.1KDH=z#1KXHS`HDAwHSPH9v,H)1HIw@HS`HHtH$L5WA>H=,1-KHS`HtHHHH@PEH$H$H$t A>H=1J$fAGf_qD$fAw A>VH=1JEAoH$HHHD$HUhe=t A> H=`19Jf$ HfAHt AH $<D$ D$$D$ D$ EtD$ 1AA‰D$ D$ A$DT$AG$TGHIDT$kA(DT$(/GHHD$DT$()AOHHl$HDT$(HHk([dAOHcHk(H9Hu1DɽDT$(1D9s5Et >tDF1DAt ADDH(AuE1DH|$Lk(1IAC A1AAACIMAAA@IMELk(1IACA1AA@ACIMAAA@ IL0Axu.Ax tKHk(EҋDt1AAA@IHP tD9HwpEtkHH9cH9}^AOAA9sdDHk$IMEHk(HP AI@MHk(HPAPI@M>LH)I9щP 닃|$ $Ld$AG IpH$A DL$ I7MHHD$@;cAG u$$ u%A|$tAG H|$U1A|$AG tAT$H$1H|$8HPHaVHكPD$$PEOMgH $tIG(P HHD$0hLl$HDŽ$MHD$H\$PHD$HD$$9ȉ*A>RHL$HD$8AUDL$ LD$HIuE|$H$Ll$ DH HL$`)9ՉL$lL{Djl$|Av`AA9rwvrIWH9vzu:tH9v)L$hD$(w4A)I뚋l$|1l$lH\$`DLl$ g1LH+D$XH|$0ƉD$xA>tDd$(IGHHD$pDN;HHtDt$hDd$(I|0;HItUt$ht$(H|$pIHIt3A>t%t$xH=IHD$(LH1CLL$(LQLPHPH=g1L|$ GH|$09GH|$PI?PInH=1GAT$AW I`%A>tH=$rBA>tH=#1\BA>tH=*1HBzA>zH=-BiA>H=BfAt A>H=91AHD$HH\o$<HD$ D$$D$ D$ AWAVAAUATIUSHIԉHAt+Ht HE`u)Hĸ[]A\A]A^A_fɸtDHEhL0IFPHtHvR11LAV`Htf=MZtf=ZMuIFPH z>HHD$H$Hl$HHD$Lx ؃D$0LA߉D$8EtSu1ɉLAV`HH#HD$Ht|$0tUHHUJ|$8|$0tEHD$HD$H$HD$9D$@wAHl$HDHD$HL$ H9Ht$()ljV$9H<$1JH|$tmH|$LDH4;tCL$E1CT%KfDŽ$H|$XD$P|$ D)Љ$$Ɖ$ABƉD$LƉ$$$$Ht$($D$0+D$ $HH$H$H$$|$8$lj|$@fDD$PD D$0E11E1C<E@D1fD)AAH*Qf.H,EAUUv|$0$<D`d)1)1kdAA)ċ$4D$0D`d))1)1kdA1A)ċ$8D$4hd1)kdA)ʼn$8AD9tIDAẢ9DCA9DB9FE9GA)AED9uADD$ E9D$8H|$(D$8D$@D$04D$@DAUPH5L1IAUXI|$H51AUdI|$H51II9uLl$XHkPAUtH5L1IAU|I|$H5y1wAI|$H5_1IYI9uLl$XHkbAH58L1I/AI|$H51AI|$H51II9uLl$`HktAH5L1IAI|$H51AI|$H51II9u$0H5}L1Lt$s$4H{vH5\1Z$8H{xH5C1A$<H{zH5*1(H 4L\$8H=dH1bL\$HGhLO LGINIV PD|$0IvDD$HIEIN,hIVDIv8Hx,LHDL@8WDH AE1IE.DŽ$<DŽ$0DŽ$4DŽ$8D$LyXH=1L\$ L\$( wl$ Dd$(LE1E1EDE)EY1EPA B4A DDH{ L.MDL|$(LIH|$PHAT$AI|$щЃAH n&D$T9E0DŽ$6AD$$DŽ$66$$AGD$0؃LGH|$@L %IBƄA A|DL$[BBENt$\A|$IAkH|$@H5L%Ƅ t> H=$D$[H$DD$\~|$LtDHxHDHH)ع)HxuрxuˋT$p+T$H)؍TT$,|$L)HDHH9T$HHHH9@H9@H9D(H$0A9dMcMEM9<ID$LI9H9I9A<$ ID$I9IT$ I9@H9@H9A|$@HPI9HxH9AI9@ArH9ixH@u&0HH9AH9@AtI9:t I9H~HI9&HzH9AI9@AtH9} zhL`M9&HPI9@H9@tI9} PH\$,ILD$(LLHHH)Mu$ ML5q4E1$$AA AA \A$HHHHH}H5HLHHHH)HEHH)ցHHLH5HHHH)H) HHHL$`$HLHHXA$EEA H$A>jH8[]A\A]A^A_ÉAD$CLAMED$<HHD$HHHH}H5LM$HHEHHHH)H)HLLDl$(CDfEA$A$ 9X9P 9EA$Dd$E1H<$D);7$DA݉CANAVD9D9D9AF H<$+t$;7H| I(HL)I49\$(wDH$D$ 93Ho48H1H8[]A\A]A^A_L5n41큼$ A> $DMM9s?Ll$(H\$,H,$fDIM9uMHLLHtHLL)AvMmH`DT$(DD$,CE<ED\$EEALd$1L|$DIIE11A1E AAAtcEu^D9wYD9rTÉHL9AL9Au;L9}6MME }H(D9EuME Him48`H=911M<cL$(T$,>fD11A@AfDMHLL)A DD$,E1D$(Eu3Ld$L|$"H=1!A>H=11HHql48hHH=1T$,QH=1+L5"l4A>1큼$ A$E1AA 3HT$HLDH$HNHk48H=1(fDH=1LD$LD$LLH=1^H=1yL5Sk4fDAWAVIAUATAUSIE1AH8Hl$H\$H $DD$DL$ D$D$D$ D$$D$(D$,DHHLtbtAA#DDHHLF$`tubDHHLu̸H8[]A\A]A^A_D$A9vH<$D;?sҍPT$ADAAZfAx&D$A9vE,APT$EAjDHHLAkDHHLQF$`EH$AAA9EDIcHLL9DLH< I9AH9@AH9I6I9HI9@H9 H9EC4/10A AA9A wEA!DHHLF$`uDHHLu0'AHLDAWLHD$0PD$$PDL$(D$HL$ H AWAVE1AUATIUSHAH8Ll$ Ld$H $DD$DL$ D$D$ D$$D$($D$,LLHt|t^AALLHFPt6u{LLHAtFPLLHuH8[]A\A]A^A_DD$ 9vH<$D;?s֍PT$ TDAABAzD$ 9vD\APT$ EAuEAALLHdFPEH$AAA9E2*DIcHLL9DLH< I9AH9@AH9I6I9HI9@H9 H9EC410A AA9A wEA LLHFPuLLHuEI9HH9@I9@ H9@EC|1f. :A4AL9A4wAxAt!LfDDLHHFPuDLHHu2)ABDLHHLDHHeHLLAUDHHD$4PD$$PDL$(D$H Df.AWAV1AUATUSHH˹HD$HLt$0D$$ D$( D$,LHDDߋ <A@L$ AEA@IALEDD$ HDŽ$D؈D$HD$H$ 1҅tH[]A\A]A^A_DLL$H$H$HEH$LtQHLHDHPHD$4PAWDL$,D$`EH sf._葱P~eAVIAUL,ATUHS1LgfHI9t'I<H uIFH[]A\A]A^fD[1]A\A]A^1fHt$ ~SHwH?ǃ [DHHwVH9vQ1#EyS=wLD Hw/H9s*HDFuEDDH1HvHf.=A=AEuy=tr=AAAAEtLYItgDLLEELIItFDTIIHt4BDOf.LI=D.L.1 ffDA@<vAOtIɸD.1HIw1ATUHSH5HIf.t|< !< !}Hr4HcHHHl4<HEA$IE?EEHɉMuHHH CH=s4C  CCȉуu S9DHo]48H HHLHP[]A\OHA$CHKIT$AD${t-HIHCM{*KHc HEIA$[]A\fDHøH>>DH pDH@@XDH @DH<<(DHHsH=- H\4t8H=1x8H= 1\yHH=`1A^ff.HtIATUISHc HHHH=wLHw#Hc HLH| []A\H(L;[]A\ fAWAVIAUATUSHHHHc = cP DH[]A\A]A^A_f.HHc @HHc wH H!%tDHJHD@H1H)An HzHc GH4$eHc H4$DATUISHHcHHxH:DHt*HHsHHI$HLH[]A\[]A\H=1@f.USHHHHDHHl$0IDH9sH9}Et=H[]fDHH9H9H9|H)DL$ DL$ fDH萺HHEHH[]~iATIULSHLO1LfDHI9t2I4 LuICILH<H]LH[]A\Df.AWAVIAUATUSH H(zHMIEMNIvLH)HHOATIFH1HP`MNIvHI)N< L9HˆT$1HHHHIH\$H)ځWI~HzLd$1HO0LHG`L)LHH)H+w@1HHI9u'@I9DeAD-t$ADHCuI9AuDLH+D$IFAD|$LthAH8LDW uRD@ʍBHADGf @@uۃA9A)ADM)fLH([]A\A]A^A_I9ߺID$PHI[DLHHD$6I~HL$HH@1H(L[]A\A]A^A_fDHHHPÁ A1LLHtOKT%D)H9rHH9t28tfw#H9vHHtރAL5v݉؁ADLIH0@ӍCHADFf u݃غ)ADHHYLZHrS48tH=1׽L1*H)O4HHLHAD-InI9HI!ˆT$wH=+1AMHAID$2AI%H=1B1f.AUATIUSHHHp7HHcH薷 HHCHc3H{Hy HHCCt)Hc3H{HU HHCxHcHDHcHCLLl踻HIE}"HcHCH\H荻HH[]A\A]1~]1E1fDHt HL6DmHD$E1EDŽ$D$ AD$P HD$HHDXEDT$XEHD$`HH9H$HH1.^$=S$ HWH9NHVuƄ; 1H+HADQ Dd$D$'A;"HAոQAMf2wH HH8|$ AAEtIcAƄ &Ht Hc = U*P D&H|$(D$L$Ht$(D$H$D$LHE=DJ DlAEtIcAD IL9iA $HHD,tHc uHHD$(Hc HD$(DH5HHH$ /@/HH$$Dd$DmDŽ$D$hDD$\E DDŽ$.fDHE48/!H$1HD$xHtHT$XKH|$@{Lt$@L2Ht$ LL蝣Td$\HD$p耭HAP%  D$\BD(ЉD$\H|$pDmDDd$H\@A#DL$hAE:|$ uAIcAƄ &Ht Hc = (P D&Dm@D$lta軬HAH$DP uFPH$H"<'EHt$Hc = V)H TDmA>ED$DmD$DDHVfDAH=<. A A&A'=A"HADQ A>$9$E"="$A D$fDmHfH|$ E 蒻HHD$.L$HL$ H 1LIL葦HI-L%B4A<$ "AL1/Lt$LAA-Lt$H5qLAdž H5gLEu$ ;{&Lt$H$IcLaIc = jLt$D`H$H5 E AD 蕬HtH5Q"L E A Ht$AD$McA BD& ADm fA'A"ǩHAPf% A> f A,AHT$P4HT$PHEoMcB< EfA=Hc$^ H|$8H$p 1Ƅp A DmD$DŽ$'HAHD$H$H5HADŽ$H@EE Dm$EЉ$U ҍ $E$EЉ$U UUЉ$&fDH=vHE/E/ADmD$HD軧HADQ D$lH{Hc = %PDd$D$ D Dm}DA&9 A%A'A"@+HADQ 6A>,HD$Ht%Hc = ,%Ht$P DlH A= HADP Hc$HD$ AƄp Dm$$A!$uVA>"JHBDh  HHF,t!Hc QJ DlL$l-$U/DEHHc$ `A$HI=48PH踵4E A fH$HxƄH$臵H%H$H$H>HHD$HHcT$XH@HLHDŽ$L$wkD$DAEtTHt Hc |'J DHt$Ht%Hc %Ht$J DD}H%Hc = %H|$P Dlt0HD$Hc &Ht$BHۉ Dlt@D$Hc =  P DlH|$HD$ =  Ht$PHDŽ$ DdDd$DmD$DA;)qHAP $HDd$\&Hc =  "P DdDd$DmD$(H$HD$@HtMHI1t$(Dl$|HH$H$HEFAXAY1HEHDH$HD$@$AH$EH$D$AHDŽ$"DH9418rH=%1H_H|$ D$h@H|$0DŽ$DHDŽ$tDŽ$@HDŽ$H1HDŽ$PHDŽ$XDŽ$HD$HD$(H=DHDmHD$(HHt Hc = P D.HD$Ht%Hc = Ht$P D.$Dd$DmDŽ$D$H= H$Hs  ~  $M Hc = !PD$ AE1 D"DmH$Dd$D$HD$(D$DmgDd$HHF,Hc = fP DlA&YE@ H$蓨H$HDT$lEAt <'"DDHt Hc = 6P DlDL$lEj}D$EOHD$H.$Hc = n%Ht$PDŽ$ D @A>h$ H$貧H$HHt&D A %AMMc퉋 BT+$UHHc$ p A$o%H|$H DD$XHt$`EAHu EHEHt$`a$aLd$8H5LHHD$<83HD$HxH5\Lt$XIŅtHD$H(Hc = EHt$PDŽ$ D HD$HHD`ED\$XEt~Ht$`HttH9H$vVHwM1&~=s Hw(H9v#HVu΄# 1HH$HD$`DmH$AHD$DŽ$Ht Hc = P D=Hc$Ƅp DmDŽ$HD$ AE1D$PsHD$Dd$\HU Hc = Ht$P DdADm*D$Pub$uWDmDŽ$HD$ ADŽ$EHt Hc = P D"AIcAƄ "DmA HDŽ$D$\xH=sLuSHD$@D$lHtAHHE1t$(H$IH$HA]XHDŽ$HD$@HD$HHDXEDT$XE$`/Hl$`$aau$bH$HxƄH$襧HKH$H$H\HHD$HHcT$XHl$`D$XH@HLHDŽ$H=PLu7HD$xHt-HAHD$xD$H|$HiD$AH|$8+DmH3Hc = EP D=t$\$uBD(ЉD$\LH=U1~H$H$Ht$\DD$\Ht Hc = P D>Hc$HD$ AƄ`DmDd$A$a@$bH|$8H5]HIH5HԎ H5L轎Et$AAE$E$$$LD$ ADŽ$#t$l, Ht Hc = 3P D!DmD$HADŽ$TH$Dl$\@H$HAADD$\PHHc = DhD D MHIH5xLl$8L,LLHnD$AE<vAOlE1HD$$UfDADd$Dm$HAIcHD$Ƅ ADmDmD$ AE1$-Ht!Hc J DlAcUHDP IcBƄ >A=$HAHH$Hc H$HHc HHc Ll$LIc 4HHc |$ At$\|$hAGMcB<  ADd$\ADA$w蛚HIcԋHAt Hc = DP DdDmDd$HD$H$誡Ht$01$HŅH$#EAD$Dd$A$H} H$DmDd$HAD$Pa$SDmDŽ$HD$ ADŽ$AHHD$pD$AD$\HHc Ht$B=  D%t$\Df0Ht$PH DdADmQH'48;H*H|$ DmDŽ$H A$Dd$DŽ$D$EiHt Hc = HP D"Ƅ$ "HDmDŽ$AD$Pu$~HD$HeHc =  Ht$P D';HD$(L$H$ LƄBHIE1Hl$(HLDl$3Dp LA uAIcA HL芍H9s8HA tHc = uH$Hc $HHl$(DmDd$HHD$(D$QH=1CS=A=@A==AA@tLII@ LDtHyH_D HHyHC H5;HH舝H=1肔D$h?Dd$\HHF$\wEHt Hc = UP D"Ƅ$ "HDmDŽ$A\D$AH=1ˎHt Hc = P D>Hc$tH|$8H$p 1Ƅp YDmD$HA mhHHD$@H$AD$lOH#48?H=1H$$fDl$PEu$HD$HHc = Ht$P D"D$l $u>HD$HHc = JHt$PDŽ$ D DmDd$HA\D$ ADŽ$Lt$LqE Lt$LXIc }DŽ$D$ADŽ$H=LHt$HVH|$8H5{HIHD$xHtH腚LA蟋D$HD$xxD$P|$mHt Hc = P D"AIcAƄ "H$H|$8H$p IcƄ H  Ll$LIc OHHc Hy=Ƅ .H1H=HH1WD9d$H 4D$8H=X1!@H=H1$1%$AAHۉD$P@E툄$D@ ω@$(Hc = IH T$ $ Hc x$D$N @|3  qAHcɉ DD tIcAD t!Att$PIcA@ AS$IcA@ DmE-+HHF,t Hc = ` P DlADŽ$UIcA HD$pHc D$Ld$LNIc$ yim$am_$bgQ$cCH|$8H5荽HIt 8 H|$8H5AeHD$8H5HHD$Ld$HL/ET$HL$Et E Ll$xM6H|$HH58HL$LHDŽ$لHL HD$HLA0HxD$HHc D$D$P$Ht Hc = ! P D"AIcAƄ "H$H|$8H$p IcƄ Dd$\AHD$H& Hc =  Ht$PDŽ$ Dl=A=@A^=S=i AA@tLII @ LDtHyHD HHyH H H|$H5 jH[Hc H$@HD$@HD$xD$XHD$HD$(HD$8L$hHt Hc = P D.AIcAƄ .$DmH蠺Hc HLl$L臺A _H߈$lHc $L$|$\ L>5L9LHL)HHP蚾H߈$H$D $H$H=LLLLL$H5t)LLLL$AH5m H|$8AHD$'8L$HHD$LH3Hc EH|$HD$Hc Ll$LA =IHIc$ HӸHc QDd$DŽ$AD$ldHy=Ƅ .H1H{Hc H$H|$8H$p IcAƄ DmD$ DŽ$GLl$LIc H$QH$DŽ$HܷHc HȷHc Ht Hc = uP D&|$ @A@H|$(AGMcBƄ< &A@$E1虈$H$MD$Hl$(AE@z DlAD tAMcF< AIL9vNC<HHD,tHc uHL$HD$(誶Hc L$HD$(qH$D$tIcAƄ ;HHc = 7P D;H|$H Hc H$HD$Hc $ HHc ,HѵHc Ld$L踵Ic$ HHD$蔵Hc HD$H=H1"HeHD$Hc a\$aH5& H|$8A趴HID$8H|LLl$HLnMIc = 0Ht$PD$ADŽ$ D mH=V9H߉$肴Hc $bA<$ H$H=1~fHD$(H$H$ HƄ/HIH1{PL牓 Dl}{HH9HE,,tHc = uHHc H诳Hc DmDŽ$HJLl$L}Ic HiHc OHUHc HAHc 6B<vO!Ƅ .1HAHHc DŽ$4H|$(j@D$N 1A6H蟲Hc DŽ$B<vOƄ .1HHSHc ^H|$=HD$Hc DŽ$HHc Ll$LIc i$am$bg$cyH5zT$PDHAY>LAE<AO`HA?D$PE1Ll$L4Ic yH|$HH5)H褾Ht$HD^Et E?H|$xH|$HH5LL$eH|$xHDŽ$OxHHT$xusHD$HL0HxRH蕰Hc Ll$L|Ic AQ1҄BHt$xLwHt$xLe{H(Hc wHHc H=!1VDŽ$Ic$ID$LLdHcD$XHVH|yI$HL$,DŽ$Ld$L薯Ic$ H=1;Hl$`D$XHl$`H|$(IHt+Hc = uH8Hc P D&nLd$(III!fDP @lIM9AIEHۋ,tHc = uHǮHc HcHFHNHTHcD$XHT$H|zxHT$H=AHD$mHc $H߈$D$$; $D$$H߈$$Hc $$VH=1}pH$Ht$`L11f.H(HHH<$Ht$HLHHD$HD$载H(H(HGPH|$HHD$HD$荽H(AVAUHATUHSH@HGPH\$@H|$8HD$ HD$0Ll$ HD$(H1k1AHwAy'.fDH5μLwHuA^_IIE HP8H L`@MLD/IE D$H(HsHW_H;xAJAE2 HAHt$LAWLhT$DEHĈD[]A\A]A^A_@HsswfDH@xfDH5qH=ǵ1j@H3A8tH5?H=ap1if3LHt$AWLKg=fDA DH!38u?LAgwA Ht$LE1AWLfH5H=w1;ifAWAV AUATIUSHHGhHD$HD$HT$ HHHD$1HHŋ3HHD$ H3HD$(H3HD$0H3HD$8H3HD$@H3HD$HH3HD$PH3HD$XH3HD$`H3HD$hH3HD$pjH7IHt$HHHD$HD$HX HAD$It$(H9PHQ@H<H9yH)HD$xHy 0aHHHHLAVtHD3:sLHAID$ @(HuEHAHHs HKEMjjE11L^ A^_YIL$ HA8HHA@HHD,f.ID$ D$H(HpHn[HAtA@AD$2 =AHt$LAVL9gT$ADHĈ[]A\A]A^A_HEHopfDHPtH5H=ױ1)fq@H38|H5ıH=n1e]@-Ht$LAVLff2ADH138u=L7fsA Ht$L1AVL fH5 H=ʰ1Mef.AWAVAUATE1USDՍH8A$AEDHE1A EDEA ADA AA E9D$T$v/DE1AAEDHA EEA `Ju\ELv E1HLT0A1ҩ I$ AM9uA` vyH81[]A\A]A^A_D~\ELv E1HLT0fA11é I$ AM9uA` wE1H|$C3HD$L$$E1A1ҋl$ HXAD9~jSH$S܋KtA9r0LL9|&AL$I9I9@L9@t L9A}EC܉CAEH\$l$ Lc 1I$9~.AEtAL$AT$H=KE $ED$1WNj$LP$PD$DD$PL$TT$0Ht$(^_A}H|$~e$eL-3D$@$A}DD$@t$@H=٤1'WlfH=YD1WE1@Y<6@@@4Vc?@@IEI9I9t*M9}%A]I ) @A?H=1T$XLD$@LL$8t$(KT$XLD$@LL$8t$(f.,M9IEI9I9tvM9}qA]1I AAA@sM9CIEI9I9+M9"A] I7A? |H=1T$@LD$8LL$( JLL$(LD$8T$@MDM9IMI9@I9@M9A] I)ʼn )A EA4A@+M9/IEI9I9tM9}A] I@A? H=˘1T$XLD$@LL$8DT$(+IT$XLD$@LL$8DT$(A? H={1T$XLD$@LL$8t$(Ht$(LL$8LD$@T$XUDA?1H=01T$XLD$@LL$8DT$(HEDT$(LL$8LD$@T$X@A޽AEAA?eH=1T$`LD$XLL$@t$8DT$(HT$`LD$XLL$@t$8DT$($@Du:M9EIEI9@I9@t/M9}*A]A I QfA?A  tH=1T$lLD$`LL$XD\$@L$8t$(QGL$8t$(T$lLD$`LL$XD\$@A޽AAAvA@ A)A@8@(AR J |$HtHt$L9fIQLt$H9I9IM9@D)A LIH)H9HrI9@I9@@L9ALIH)RAQBDM9IEI9I9M9A]E I) )A fM9;IEI9I9t'M9}"A]I )A A?H=1T$XLD$@LL$8DT$(`ET$XLD$@LL$8DT$(A? H=1T$@LD$8LL$(EALL$(LD$8T$@AvAfDAvAfA@ @u9M9IEI9I9hM9_A] IfA@A0 M9@BIEI9@I9@t,M9}'A]I )A DA?E5ͺfDݾ t7IEI9I9t#M9}A]IA yfA?cH=1T$@LD$8LL$(`CT$@LD$8LL$(4DAA@tEA fM9;IEI9I9t'M9}"A]I )A `A?QH=P1T$XLD$@LL$8DT$(BT$XLD$@LL$8DT$(A Gt6@uM9rA? @uE1۹AA@8@(u;M9BIEI9I9*M9!A] I@EmfAމͺA@t=IEI9I9t)M9}$A]I )A NfA?=H=1T$XLD$@LL$8DT$(PAT$XLD$@LL$8DT$(IEI9I9M9A] I!DIEI9@I9@tM9kA] ImM9IEI9I9M9A] IP@M9IEI9I9M9A] I) )A RfA? H=1T$XLD$@LL$8DT$(?DT$(LL$8LD$@T$XcA? H=N1T$XLD$@LL$8DT$(?DT$(LL$8LD$@T$XbfDA?H=1T$`LD$XLL$@D\$8DT$([?T$`LD$XLL$@D\$8DT$(^fD#D$L9D$HHx[]A\A]A^A_ÄtH=1>H=o1LD$@LL$8L$(>L$(LL$8LD$@*DAH=Ŏ1LL$(A)>LL$(7f.T$L9T$H`L$L(9L$HO\$LP9\$H>t$Ln9l$H-Ht$|$h@<fHD$ @ MH|$0HHH•H92HƘHH9@H9@@H9HD$ HD$0HT$ HT$HD$ L$L@)*DHf|$hH;D$|$H't$HHT$HH'HH9@H9 H9@@UT$hHL$PHHTH6H\$H9+L@'H$L9AI9AE H9DH(D@DAD@DD@DAD@H9u"A? H=;1T$`LD$XLL$@D\$8DT$(H@1H[]A\A]H`M.̓ l두H-H`HxHHǀHH)1H0fHcL$ ЅL+lMH@ l f=lh舌luځ&fLZHLiǃhL8uPHI9uH`HmHHHxHHHH)H)HiǃhAWAVDAUATIUSH(D$HHD$hH|t$4HT$PL$XDL$pfL$NH$!H, IH$HD |$HH$DŽ$H$ID DŽ$Ht$(H$DŽ$H$I DHDŽ$DŽ$1H$I H$I H$IH$I H$I H$DA HA9uH|$(E1HDŽ$1^HLJjfDrHpƇHDŽ$ HLJHt$4rH<$I9HbHJ4:I9H9Ht$ ?H96D$0UH31ۉHD$8D$HLHD$@H$HD$H$@D$ 9D$4DL$0KL9Dd$ H|$ IL9H9H9D$ DLHHD$H|$LHHH$LH$-HD$88zHt$(10HhHHHHH$0HHzHHǂHH)HHDŽ$ u;H|$)/H$/HD$881H([]A\A]A^A_fL|$xDŽ$E1DŽ$DŽ$DŽ$l$tD|$ Ll$(@DAE9HT$1LD$EJ=v=CD$D`AA 5Dȋ$A8DHD$@F8A.AH$H$H9D$H9AHH$$A уD$wHT$A*LDL$dD\$`DT$\$D\$`DL$dDT$\)AË$AAD)AG ADEۋt$$AD9DD)D9EE!AI#fD FBt= OuL9M9AILFBuL9M9A IT fL9M9EIAECTf/ L; $bAIAAT$ EXT$ E1D\$E1ۅED\$M9H9JH9D$'DD$'L9AL9T$ IILD$(IL9oML9D$'T$'M9ADOM9FT$DZN\'HT$(@DHD@L9ufA ID\ fDL9?M96AILDA% FBt= uL9M9AILFBuL9M9A IT 릐H a39IcHLcHIHQAVHWH=b1H ]H3DD$:CET$ DHcHH)H9HH9L;L L9AM9AEL9AH9HHH9AH9@AbH9ASHH=aHARAP1RUVH0~fAFBAw)uL9;M92AIL@AЅ҉T$ u$H9 AHfE1AD$ыT$ EADD$E1T$ ADD$AC #|L$ v%DL$D$ыT$ AE1T$ F|$ wۃ|$ wCD$ҋT$ HE1H)HE1Ht$1LHt$H8E1E1L|$f.DAVAUEATUE1SEE1IͻH09uJD$hD$Hl$ l$E1D4$DPjLDD$poÅXZuHh38u+H0[]A\A]A^@H0[]A\A]A^@H=_1 AWAVAUATEUSHHEH|$H4$T$LD$(H|$0Ht$8HHt$8M`E1E1Ht$ Ht$0Ht$.DHD$8AE<$I$HH)AT$AE9|HH|$0HH+$ًT$LL$ HLD$)HH+D$)uHH[]A\A]A^A_AELL$(HD I4fAL1H$9v$H0x D@P$H H,x0D@,HH$H9uʅuHD$(E1L=3HhAH$E9|LE9E U))ÉMA?tӋUDMH=u^DEMD1AH$ E9}$AUE1PjD$$Ht$8H|$X…XYu8HQ38H=]1$ $$둺]MfDLI9}ÐMHHЅAI9D L9ADuI9|ÐHH9H9~DOADG D D9v[OL)f1 A1OvLLHID W LOD ʉW HHA)A)f1DG ADOAHD) ЉAWAVAUATUSHD*H<$HT$HL$EL>IMDDACILIwH[]A\A]A^A_f.H<$LLtAÃuHT$DA)ÉHD$DH1[]A\A]A^A_DAAWAVAUATUSHl$PwH[]A\A]A^A_DIIL:I͉LLLML$D$tIGLLLID$tu^HL$AEIAMLLLI\$sQD$H$H1[]A\A]A^A_@IHL$AEAM;MLLLD$HL$AEIDAMLLLI\$D$cfDAWAVIAUATAUSHEL$DD$\D$DFHn)1IDHD$(HD$ LHD$xH$HD$H$HD$DI܉D\$\I$knI$lnLT$xEL9HAL9@L9@nL9e1DAD+D$MiHA HŁkn9M90Lt$ ML9AL9AEM9MAIL9uL9LHM9AI9AM9AHEH L9HE L9L9uL9}zE+D$HuLHD$(IHN+D$D$DHI;l$Xt?A9r:L\$8I4L9|,I9@HL9AAuI9|LHL9H[]A\A]A^A_É$H}3t$XLD$8DŽ$H$8DŽ$I$h E11E11EH$H$H$MD$@D$PHD$hH$D$4D$0D\$HHD$pI$dA܉H$Ht$DLD$lj$|$`H|$LH$$D$Ht$H|$DLHD$HIH$7$H$MH H$$ATLD$xH$HT$Ht$ |$p^_.$D$HHH`$HL$hLHT$pHt$EH|$MDŽ$H$Z$ƉDND ADŽ$)ljEI^HD$PH$E1L$AMD$`AD?|$`D$D$D$AD$ ÉD9ȉD$`CHt$H|$DLD$$HD$PD$H$_{D$H@ HIlHD$HH$*CS B‰EF+T$@HD$8$L9OL9FHt$H0H|$Aɉ A$EɈD$`DDLD$ HHt$H$D$AAA9AL$MAH\$H%D$EA 9D$HAgD$`H|$DLD$AAAAÍFt$HHt$ED\$`DHH$u)Lt$`MAH\$HHt$H|$$D$HDHLH$ D$H=vDMLt$`D$HHD$8$L9L9|$HE1@8$;l$XZD$\DH$MH1UADML$D$DDЃtDT$HL$XL\$8)‰$$A)A9L$EE9I4L9EI9J<D$HL9AD L$HI9MIM9MM9D$PD\$PM9AExM9oA9f;l$X\HL9AD D$HGL9>Ht$8HHI9AL9AI9HL$8Et?H$DAD9$$n;l$XW$$r|$0t$4AD\$H|$P|$@t$0D$@|$4{HD$HHt$DH|$LIH$$MAHD$HHt$DH|$LIH$$ HD$HHt$DH|$LIH$s~D$P|$0$|$PD$0|$4D$0|$0|$@D$@|$4H$HMH$ATLD$xH$HT$Ht$ |$pZYU$t$4ۋ|$0D$HD$@ t$@t$P$|$4t$0H=O1#YCHt$H|$DLD$`$LH$k$ +D$@H|$8ۃƒ HL9L90M$ ЈT$HHL9iL9`$AD$0$D$4|$0$|$4D$0mDML$ED\$Hu(DAH=KHIH1H=KIH1A)AO DOD)_@AWAVAAUATIUSI͉MHLL$Hl$PXD9s84L$XHLLIukuH[]A\A]A^A_HD$D)H1[]A\A]A^A_DAWAVIAUATIUSHMMHLʉt$ L$PHuHM\$ Hq0ۃHu\$ uOA|$PLHWAULLL$ZYt \$ 1A$H[]A\A]A^A_DL$PLL\$ \$ t*AD$ DAHuyfDHu`Df.AWAVEAUATUSDHhEs'H38/Hh[]A\A]A^A_AʉAAs3Ht3:tH= ƹ1DHIHH9A H9Hy EML9AL9AI9D)Dt$H38?H=E1H.AWAVAUATAUSHHL53HL$H$ILL$(A>DD$`Ht$pT$xL$|@L$\$HE1LL|$A>B@ABIIuD\$HL|$(HD$ HLt$pHD$HD$\HD$0HD$hHD$HD$DHDL\$\JtXHt$h>T$\zt$`DLD$=@0҃0t$`Ht$h HD$\Ht$h$H|$I\$\$D$$H L$HT$h\$\HT$`HATHL$ LD$tLY^!DT$dABxT$\DT$H@D$`@ATUH|$LL$@HL$ LLYA]ZD$\DT$H<SAH|$DXAAAABLxLD$hDD$\@ AD$`EHT$pH97H|$ HJL/I9@I9@@H9 x1gt$\ud$|HD$xHT$p|$`HT$pH9HBL9@L9@H9t$\ D$xDL$|D)ɉD$x9wAt$\DL$|p@v0҃ Ãw D0L;|$(Av L;|$Ll$DD$`@Et$\LLl$8$LH)EH9ˆT$HHD$ HH9L|$@\$LIDIf)ȨaA"EDHL0 Ɖt$\LHt$ht$\@@ P t$\uL|$@\$LD$`MLL9+|$H L9\$D$\LzL;$t$`DHHt$hLHt$h$,HD$hDHLHp`Ht$h]$D$AHD$\$\HT$`HILHxHD$pATHL$ LD$tAXAYSD$`D$\D$dD$`E:T$`A9-%I9H|$ LH4/@I9 H9@@H9BA9DHI<H9HH9AH9A H9ADD$HBD$ITAIAGI9u ID$`D$\2fDH=Y?D1f.f1L|$@\$L Lt$\ATULL$@LD$HHL$ ^_@HĨ[]A\A]A^A_fD$`ATULL$@LLD$HHL$ IZYtED$HcDt$`DHHt$hLHt$h\$\LD$`L)E\$\]H9TH|$ H/H9BI99L90IAGAG$D,@A ADxD$\AAHD$L@LD$hDT$8T$`D\$\D\$HLATULL$@HL$ )AZA[T$\DT$8D\$HfAAuT$\DDhDT$`t$`DHHt$hLHt$h$$D$$AqD$$]H=<1EA>Rff.AWAVAAUATEUSAHHKE1yDQE)IA  I9IB EJ,3H9H9I9A D)D$H.|38HD$( EDHD H9HHH9@H9@H9{AA <mHD L| IIWH9RIGH9@H9@8H9/A$AWAJD)HT HH9HBH9AH9@AH9:wA9H9HH9AH9@AH9|:ED:Awt04LH)HD3+HxH96H9AH9AEu#H9}xu D$XA^HD3.HxH9H9AH9AEH9xA D$XAtADNLL9LH9@H9@I9DA<ADAD LDL$XHHAHEHD$LH3H9_HxH9AH9@AuHH9}C8u>|3u7DL3AADHD$8tf.H=:1fHĘ[]A\A]A^A_EDLH9[HD$X_A:HD$EtBEHL9wH9|N<3HL9@H9@sL9jHc‹|DBDЉD$Hx38HD$T )Ѓ+FL)ЉD$ AD$XEEHD$8H={:1fDHDH9HHH9@H9@H9AA<HcD 1L| IIW%fyyyHD$XAAHD$fE1y6DQAE)IA G@LH)ލt05mDRHD$A8 AgIGH9IW H9@H9@H9ABA9sH9jHH9H9SH9JAGD)HA3H9*HH9@H9@ H91f44HHuHHyHqEҋhHQAA|$XAzA AAHttHH9uA$ Lcx Hc@4L)M)HIHD$(L9|$(HD$8EH=>714H)HA H9 HE I9H9L9HD$8D$HcEHLcmL)HM)H)I݉L$(UH HcDHHH9HI9rH9iHI9@H9@PL9GB 8A9/L9&LH9@I9@ M9r1HH|A|HH9uHcIDIUI9@H9@AMI}HVHHHHHHHH9HWI9H9rI9iAQEɋNHTtHH9uHnH98HFI9I9 H9D$(FHD$EM8< AHH9I9IE,H9IU/I9H9L9IEHH9IUKH9I9L9xD+$HcVImHNL<IcE,DnL)HL)HHD$(F Dn FL;|$(HD$v!8&H=518 D\$8LT$0HRD$0E11MDHPt$@zH t$XLT$0D\$8WICt@EHD$H9N,3L9HD$DHD$8NM9|I9s11L%f.IL9PH9GwAITpH9HJI9@H9@L9 A9"f.HD$8H=11f.T$H=1D1D\$(LT$ DD$DL$XGDL$XDD$LT$ D\$(fDT$H=21DD\$8LT$0L$(DD$ HcL$(LcD$ LT$0D\$8T )ЃvHD$8FLH|$)ЉD$ A?H=v1Dʉ1D\$8LT$0DL$({|$XDL$(LT$0D\$8vHD$8t6H=t01D\$8DL$0LT$(9D\$8DL$0LT$(f.$HcHBH)HA9HMH9HH9I9L9HU EAEɋLHEEEE JTEEEtHH9uHc0LcPH)HH)I)HIHD$(*Dm@IWH9KIGH9H93H9*AA AG;$A9+$AO BpD)HHA9H9HH9@H9@H9AH9HH9@H9@wH9n1@44HHXuHXHXk8D\$ HE1D$`1DHL)HPAQMt$@H D\$ [fDH=1/1D\$HLT$@HT$8HL$0D\$HLT$@HT$8HL$0D$MH==-1HHD\$@DL$8LT$0oD$HcEHLT$0DL$8D\$@L)HH)HD$L$(8H=,1D\$PLD$HDL$@LT$8HL$0 LcmLD$HHD$HL$0LT$8DL$@D\$PLM)I݀8C+$H=,1HL$8LT$0ULT$0HL$8DL$@LD$HD\$PHD$H 8H=p,1D\$\LD$PDL$HHL$@LT$8T$0UD\$\LD$PDL$HHL$@LT$8T$0$Mh@I)HcPdIL)H<H|$(H=,DD1D\$8DD$0HL$(DT$ DL$XDL$XDT$ HL$(DD$0D\$81H|$?J 3MH=!.HD1σAD ) ;$D$hD$`HD$(L)EۉD$lD$d|$A9I$H<$Ht$`E1ɺPjDD$$$itZY9HD$851HD$8H=,1H=*1D\$PL$HLD$@Ht$8DL$0LT$(wD\$PL$HLD$@Ht$8DL$0LT$(vH=+1D\$8DL$0HL$ 7D\$8DL$0HL$ HD$85H=b*1$H=P,Dʉ1D\$DL$XD\$DL$XHD$8H=f,11A9r1H=)1LcmUM)I݅f.ATUIS4HxH`Ht#HxHHLD+H[]A\ÐH=,1"1@f.PH҈tH1HHt HGfD1f.ApLl11fDDADƃHluA9AA9AEnDD$Ha`3D$$8H=!&1DH='1{HH=#1D\$  11L~߉IE P(f.D$ [8H$DD$ H$pH=&H1D|$ 蝾6MLADNIcIL9EGH$p (>H=&#1xH='#1e* +AH=w$18H^3H=$1rHt$@H="19Ht$8Ht$@H=$H1&AWAVAAUATAUSMDHxJH$JH|$t$DD$ %H\$0EH$JH&1H_1BHƄ$/cPH\$fAbH0JcHH$0$1 L$011HHHD$HL$H$DŽ$P$ H$0$D$$8$ L%5]31A<$_YH$JH@ @(H$J#A<$HxJ[]A\A]A^A_@D9|$L%\3H$JH@ Hp@HtD$H9sA<$t$D|$Ht$D7D9N fL%a\31A<$,H=(A1DHD$t$ H$0$L$0DŽ$X* HH$0$D$L$8$$T*hWLl$L$JE1A HWH$X*= D)IE AHp@Ht DH9{L=$X*D)9a H='1H)ֻNL%O[3"ffA  H$0$L5Z3HHCL{ LCHD$ HbZ3HD$(1HHHD$L$0HHHD$ L D$AA ҅ED$D1HAօtA  )D$H$JL$H@ Hp@Ht H9LA )9(H=)& 1H)2HHD$(L%$Z3L%Z31A<$H=&A1jDH$JH@ Hx 薽HHD$H|$1BBH\$H=&1HH߻H=q&H1ReDH|$N E-E1Ll$HAA$P$= tg )H$JAH@ Hp@Ht DH9L$P$ )9sEL$H$DŽ$P$ rDELl$H߉L$AL%rX3L$1ۅHD$@ A9t]H|$HD$H@HD$Ht$T$_Dl$^L$^FH5Q3> HD$fD9h uDEAHQ38yH$$HD$8Ld$`H$$HLD1ʯ1BLƄ$_λD$ Ld$HD$@ uHt$( Hl$(D$E1HD Lf HD$HD$SLI@HH;l$DDL׉҃DA2E`D$S[ADALAiD$S+AAApHt$(|$ DD9%Dl$HE1H;l$NEHl$(\$HP38|$ 1HHH11HHP`H H\$t$@HHK$$ $$t$HDCLL$XT$dIH HUX|$ 贮HD$0H@ @(H$$`H|$HD$D$I>HD$@A9xH|$fHD$ H@HD$ -D>HD$fD9h-AxV4gE#AxV4H$`HN38H=1HD$H=ZD@ 1Ht$H=DN 1θAHt$H=DN1譸HD$H=9D@1莸*H=81q1HD$0H@ Hx 許HHD$H?H|$H1BTD$ H\$HH=31HHH|$H~H$$ cD|$ DHD9'Dl$H=1LI4$H=`1ypHt$HH=1ܿZHT$Ht$H=W1@Ht$HH= 西HUX1D$AWAVIAUATEUSHAMH8HW`H8PKItBMH8L38IHHSx1H8[]A\A]A^A_DHAE9MH@HD$H$xH@ HHK3H$fA)E,1L\$0D$0A)H$AHL$ Dd$8EBAJLARjEABE1LT$APH$X^_LT$SAB EH$8H=I1芵DHK38H=1bDH=1JDHJ381f8vH=>1 c@AAHS0HC`IrHtH)H+s@LT$ DL$1LLD$HHLD$DL$LT$ L\$0Ht$LLT$DL$LxDL$LT$IBD 0ABAT$t]tYH$xA0tKH$8$H$xH5LT$uH$pjLT$AABuPKI DD)fD;l$H$8gH=1TDHArAJH$H=TLڋ@4PAVABPEJ1EBLT$HL\$(話H LT$(L\$ABDLHD$HS0HC`HzH)H+s@LT$1D\$ DHHLT$tE$$LD\$0L$MDLLT$(DFH$XZLT$Lt$D)l$HH)H+s@LT$1D\$ HT$HHLT$tHAJM$$D$D\$@LEBLT$8DH$H LT$kH=1LT$]LT$H=1LT$@LT$4D$ aIH)ދCH=1LT$LT$H)ދS{H)ދSDf.AWAVAUATIUSIEź.H(HL$L $H$pW`Ht.8PKItLIG0LHTH)I+w@.LAWxHD38y1H([]A\A]A^A_DHD3ET$.8EfD)D9D=f=ELCDABDT$1LLD$D$ D$LAW`HLD$DT$tNLd$ ADHL1_FD$D HD38EfD$AF*DT$H=0AV ANAvPAF"PAF PAFPEN1EFEfDT$0H D)D9DHC38t$H==1DT$EfDT$D$ D$EH$`D$tKDT$Ld$ EFANAVEjAFLAPH$pPAXAYDT$D$AFD)9|$uH B39E$AF D)9DHۉD$D$Av*E9H|B38H=1ݬsH=P 1ʬtDE$AF D)9t$u"H #B39tH=/1般AF DHۉD$^D$|$tQIG0LHH)I+w@.LAWxD$D$fL)AG@H$@DHۉD$L$tnI1Ld$ Yf.I}PI}IFUPLBuǃAF*I9 H@38tIUH= 1Q@fHrfLHHVH5@3j$)$t$(MHL$8ELH0ZfL)AGcH=I L1DT$螪EfD$DT$H=1DT$tAFDT$-DAWAVAUATIUSHHHGhD$4D$8HH?3D$<8LkPDI9t1HH[]A\A]A^A_A-DvID$ Hx 9HHD$HtžHJHC?38H|$谷돐H=e 1蒩HCPAI9t&H?38bH=I 1hOA-D\H>38/H=/ 151fDD} fA1DHS`Ht8PKuً@HP-IL9}L9}ŅeH^>38HD$8E1D$,HD$HD$4HD$HD$EDl$AuAv1DHS`Ht8PKuً@HP-IL9}L9}Ņ=H838eHD$T$L|$E1HD$HA1ATjDUT$$MEHH AA$tD$HHE pLtA9rH838D$Ht$HەtWH([]A\A]A^A_f.H731Ҁ8tH=1T$T$f.T$H=n14DHY738uT$xH= 1赡@H=Q 1袡H=MD1菡f.ATUISHHH638ucHtH\$1HHHtH[]A\1HH;uۋ$A$fH=1HT$H4$HT$H4$xf.USHHHtHt$0HeHĘ[]H= 1营HĘ []ÐAWAVAUATUSHHXHF(D$HHD$F8D$H538H[AtHX[]A\A]A^A_DH5Y 1҉߹ KHHHD$LLl$HD$$D$ D$D$0D$4D$,D$(HD$8HLHHHtH= HuHDuHD$H$fDHukH裔HIMItHtH5L|L4$Hq438tH==1LLОH舦tH<$u H|$ H<$H5z Lt$LHHL$8PIvHHcH33t8D$8D$(ut$LHHePv1D$(nADd$(ED\$EHT$H5z HH5 貚DL$,EDD$ E6HT$ H5 ϔHH5 lt$4L$$HT$$H5b 荔HH5w *D$0HD$HHE(D$E8趞HަHXD[]A\A]A^A_@H5LiHD$IDHD$@HQ238H= 1貜DADH238NH= 1z;DH138H= 1RDH= 1:DDt$(HH5 DUAtHH5y DT$E,fDt$4HH5 DAtHH5 蜘T$$f7Dt$,HH5D D轒AtHH5 T|$ HT$0H53 y@H038HH5 HD$HE(D$E81H<$H5{fthH<$H57RLt$L}HL$8PIvHHc&H038!D$$Lt$L-HL$8PIvHHcH/3tC8D$ H<$H5K螎T$0qH=18Dt$,Et 1D$,t$LHH Pwـ8D$4Ht$H=1蜙DHt$H=c1脙GT$LHt$H=1h#Ht$H=1PT$LHt$H=[14:T$LHt$H=1ZAUATIUSHL-.3A}LtH[]A\A]fH5 1҉  HHtcH2E1A(HLÍ@vtH=V1HH7H[]A\A]f.A}fH=17SfH=5 1".f.USHHH-38uIHtHtH[]f.HH5# 譔H[]@H= 1袗HH5 }먐f.USHHH,38uIHOtHtH[]f.HH5 H[]@H= 1HH5 먐f.AUATIUSHL-b,3A}LtH[]A\A]fH5~ 1҉ HHtcH̹2E1AHLÍ@vtH=1מHHH[]A\A]f.A}fH=>1SfH=1.f.ATU1SHIH5* HHHHt1Hİ[]A\@H5~ HuH5k HuH5 HuHLHru$t5~!y#kdҸ YRJfATUSHH L%v*3D$A<$H۽tV#tYHL$H5 H0A<$#HH5kH []A\Hl$H5{ HHt?A<$HH5:H []A\HH5H []A\DH=1t$ ֓t$ DA<$t$HBHt HH5eH=a1bDH=1J Dt$HEHm{H5 HHA<$unHH5͏]t$H=1ƒHH5虏)HH5 | H=81y낋t$H|Hf.DAWAVAUATUSH LD$LD$Ht$HL$LL$Ip LfE1HfDHH9ut%H\$JLLKHHfDLI9uI@Df8uZHuH\$1E1HHPH@@fxHHPH@@fD@HD$H 1[]A\A]A^A_HD$IHADHf87AHAuADD D)HH9ut111ft$Ht$IfA f HHu1t5LD$LT$DA @fttLDNfArfDLLH9wڅ.DHD$HHDHHD$H!HDHD$ȸDD$=D$\$vtH []A\A]A^A_HD$DD$1E1D$ALD$D$DD$H|$EE)E1G9D$HHD$DxHD$@EETEtVD9s7E DE HEAHID9r݉DD)D!AELIAEAMlAI}`AADD!HP0D@9AvTE# E HEAHIDD!HP0D@9Aw‰@AAAȉL$8 уD$DD!DH0D@@A9viE DL$Ht$DDL$8 @Eg HEكAHDIÉD!DHD@@B9wDL$HDD)I)I@@ AEsAuT AEP$AU0D)9rAEE $AEPD)9o AM4)9A )AM,)IM8AUL9GS AEHX[]A\A]A^A_@ML|$D$MWEwI/EgAM,M]@A]HuA}AG9$I_(H{8Hh S,uK(C4C0S,,$A+o9' C4Iw)9FHljH)I觓D)N S4C,D9‰S4* S09vDS0AG\$,$A+_)ʼnIGIG AUIE tA}Ѓ@AEHA} D AG8t|$@D$t$EHX[]A\A]A^A_AEzHD$0LL$MEhHL$ Ht$(AEh L\$8IIEXmD$L\$8IH|$(MElAUxLL$HL$ AElIE`AEtL\$8H4GD$L\$8XAEfAMhI}XD!HPDDH9vNE  @EHEAHIÉD!HPDDH9wʼnEZ AO A уAE!AC-EHUAHIӉD!DHDDRR 9w)EULI)IEA A@+AAEEET\EM|AUtEUxAE9AMhI}XD!HHD@9sJE EHEAHIÉD!HXD@9wɉωىfA%fAGfAQ x9s7EZfDEWHuAHI9rމˉ1I)DI DD9 DAA9fAEuEM|f.MD$L|$kEAELAIAGAEDAuwC,k4C0LH)AELA9AFƍp)A)AUL1HAHH9uA}LIDžt AEmAEafD9s8EEHEAHI9rމˉ)D!AEPIAEPAE fD)IM8DEEPAEAuTLAEVx9s3E fEHuAHI9rމˉ)IEDAAIAEf.YfK(ȅD$,.tD$,AMttBI9WOLHQ 38H= 1uD$< t< uH 38Iq Ht|A뇐P@u <1ЃL|H=< 14uV$H=2 A1DD$D\$uDD$D\$NH 3A8u@k4E_H= 1tH= 1L $tL $!H= 1D$tD$ACAuDf.AWAVAUATUSHHGhH(H 38`11 HU`HHH5s HztE1H{H5s zD$ A M.*H)H+u@1ɺHHI M9W1ɺLHU`HH%@EH5 HAADD7zA$t)H5 HzH5 HyH5 HytQH5 Hyt9H5Hyt!H5c HyDHU0HsHE`HH)UH5 HAFyD$ eD$ H[]A\A]A^A_H38tH=U 1Fr@D$ fDH38tH=U 1rD$ IEEAIML9uH=/ 1qAWAVAUATUSHHTdHL$HT$ID$E1E11dEtjnoHB`L$t-AD$IGHD$wHB BD<0L|$HH9s$IwA|-Ed-tHAH9r܋T$MoBD<0@A@uIw6HT[]A\A]A^A_@D$uIbf.L$0D1Hl$0E1LQd1D$*IfD$.LD$/LM_fDt@ tBEA t7aafiȤAD v4pf=DwH\$Ȁ 0fKH9HBsHA< uAH9HBrIV$0IƨDE1I9t!H<vHAfDD*I9ufEL5)3ADD$*DE1 A1AfD$*D$, A1fD$,D$. AfD$.E1fAv%D$,ftfAv[f w E1f|$.AfAv8AEuHD$DTA>HD$DPu}ED$.E1fAL$.T$,H=? A1DD$nADD$DDD$*L$.H= T$,1DDD$jnADD$H5'1 AE1H= 1@n.AAH5 tE1H50 H= H1 n=AVAUATUISH0Hr3;TH$HD$LHD$HD$I$PHD$ 1fDpHH9t< v HHH9u wILt$( @IM9t9AE1AEtH3H5 IH81wM9 uNj$=y^1=YvD$ 1`@ńA$`A;$d=~*1H0[]A\A]A^1A$`A;$dC=AS|$Au}1Mbt$ NL$ HL$HD$ I< '< |$CEz<:AD$Ht$PH|$(DD$42kDD$4D$Ht$(|$lDD$49ADGD)DD)D$qD9DD$EDD$4!Ll$8|$l11bpH|$lL|f.|$h\|$l\IE @(H|$puH|$xuL$ZD$DD$#AW DD$4LHt$ L9IG1ɉAW`HHD$1D$ DD$4ifDA|$AHt$HH|$(DD$4iDD$4@D$0Ht$(|$h9ADFD)DD)D$0@pD9>DL$0AEHD$(DDD$\H4HPiDD$\A]D$4AobD$ۍH P x|$4 H  ʍH  ʉT$0PэP ʍH ʍH Ƅ 9T$T$0Ht$8H= E11J)D$@GT$Ht$8H= 1E1$)H#2L$EL$@8L$t$4HD$(H)HƉgAf<:YH i 4@AD$ZH<<-<tnL$ZD$D$[]DAD|$h11lH'Ht$8|$hD$@?A T$[@t$[t$DtJtwt$C@9DuL$ZD$DD$@[؈L$ZAD$DD$wщ T$[@t$[`f.@ t$[JH|$pjX>H|$x JXALL$xHL$pT$0Ht$HH=( 1cAl$@Ll$8<AOH28H= 1Qc@H2l$@Ll$88H=8 1!cH|$xW  H x2l$@Ll$89H= 1bLl$8 Ll$8Ll$8H&28 kH|$xWxl$@Ll$8IH2l$@Ll$880H=n 1BbH28|$h11@jHq|$hLZH2l$@Ll$88H=K 1aHX2l$@Ll$88H=g 1aH= 1akH=y 1aD1USHHHM_H0H DN Hu1H| f.PЀHB H9u݉HH1HHH9uHHH)H9u19u*HH=@ )ЃH[]ÿwmпDV EZDHGPH9tOHtJH9rMUSH)IHHH9LHF1HHW`Ht*HHHkH[]D1DøAWAVAUATUSHH HFhHHhPH&H?21ۀ8upHH []A\A]A^A_@1II1HP`Ht68x>"uIGhHHPPHvHu*1ɺHP` 두H= 12_1ɺHP`HtHD$@AH$D$(Hl$HD$IGhD$?HL9sPv'1ɺLHS`HtDIED\$?u[H<$t+H528H<${uHH<$YsH 2\$(8H= 1e^Ht$LHD\$D\$tVA A t)u%H28ZH= 1^GfH= 1rfD$(*Dd$@Ht$IVHD\$ DD$kuH72\$@InD\$ I8\$,AAH28IGhHHD$ fAfA{HcHkHIH|$ LcHLHLD$9LD$H}2C8H<$H<$LLwLjHcD$,H9D$HH?HL$HH9H9LpH28]H$HtH/qqH$H28fA uH= 1dHL$LcL9HH?IH9L9MpfH= 1AAZdH[2D$(8IG Hx UHHthHǺ1[xNH= H1E1cHt$HcЉI։dIGhHt$ LH8ωPHEiD$(uH2D$(8]H= 1 [H28?H= 1Z,Hh2D$(8H= 1ZHB28tDH= 1ZD$(H28HcH9D$rHH?D$(H<$IHl$H\$ L)LHH9HF1IS`HHT$AHHr DH1At At fHAtEt7Ht$H<$IcI!pD)tHSP HGL9YHl$H= 1bD$(T$H=d A1_YH=| 1LYIGhHHD$ H28T$H=5 A1YH= 1YH28u+H<$H= LsJH=m 1X%H=z 1XŋT$H=& A1XT$H= A1XD\$ 4mHH$fAfA mHH$WL3feH=a L1X)H=I 1]I1уHA O9wÐ?tvAfD@u߀tكLG몐f.SHX L\$T$IKfHAAD1ielЃpuMK DVLL$-III  DID$pLL$LɐYH1Ã1؁߰301ЉAH9ufDNH11ȁ߰3p1ЉFH9u΋L$$P 11ȁ߰3$1Љ$P HD$HPHT$ 1‰%X:1‰%1Љ1A0M9tD$ID$HX [fLHGApH‹D A@tI҉tJ=3WtK ?H H HT$D$\ fu=3Gu  ?H H HT$D$\W @f.SIҹHPHD$Ht$LIiSH)׉xH9u$D$ A LAuۍCtII\ ALLY,=AOIA0AL9uHP[ff.1SHfG&G 9sLW+W9whuufc$C tCuCH{HHƒKSf C$fC$ fC$c$C uC&[fH!28u C(1[H= 1{SfAWAVAUATIUSIHHGhHT$(H(HE0LE`HH)H+u@1ɺHAH I\$1IAT$I9u"Lt$pD$$D$ H$D$HD$0HD$@HD$8f.H= E111L*`HE0LE`HHH)H+u@1ɺHAH;m9D{A)L%2LCA<$NA+AHU0DLHD$HHE`HZH)H+u@LD$1HT$HHLD$<ALLr DH1At At fHAtA^DLLD$PA<$HD$LD$DpHE0LLE`HHH)H+u@1ɺHAHD;A)A<$LCCA+6HU0DLHD$HHE`HOH)H+u@LD$1HT$HHLD$!ALLr DH1At At fHAtA^DLLD$5A<$HD$LD$DpHE0LLE`HHH)H+u@1ɺ HAHwsD;Et$\ u4A<$H8DrDA<$UT$\H= E11LH1t D$\HA|$\u ]HHD$H(HE0T$\HLE`HH)H+u@1HAHT$\H|$HH)[D$\T$ H|$HHHAA<$FHD$HHD$@D$\D$XA<$WH|$@\H)E7A<$H|$H\D$HĨ[]A\A]A^A_f.H)E&DH)E1DA<$H= 1WNfA<$EH|$H?EA05SGȅD$XuD$\D$XH=+ E11ɉL9|$X\HHD$@WA<$xH\$H\$81D$PD$TD$dD$`D$h9D$XHaHLHA<1҃1|$XAAA9t$PHL$@L 1HI9EHOI9AL9AEI9|AE)IL9jML9AL9AEPL9G fDHL$@D)1D$PD$PuDL$hED$PDH= 1jLA<$sH=} 1EHLA<$ps H=b 1<H= 1L DD$$L|$0Hu D$$HL$(LA1?L1BƄ$KAeHt$@T$XTt$X9 H|$@YIE x(A<$11DSH.LDuAE2 XD$D?IE H(eH|$0?S ]fH=@ 1JH|$H?EA05A<$H= 1JH|$HfDH)UDH)UDH)EQH)E H=U L1LD$lJLD$H=; L1LD$LJLD$T$H28lH= 1JY1VA<$GH= 1I4A<$dH= 1IQH=/ 1ID|$PHL|$@lAD$PH= 1IH\$D$hH|$HmWDD$hEuD$XXA<$)D$PD$X6HH H=)|(H߉T$=T$WHt$0H=O 1H#H\$A<$D;=H|$@yVt$XH=\ 1UHqA<$H|$@CV A<$D< ht$PH=1 1HH=~ G2DA<$s H= 1>H= 1>cDA<$(|$H H5 HT$(H= HD1>H= 1p>H|$X?EA06{A<$H= 1F>H|$X@H)UDH)MDHt$H= 1>LT$$f.Ha28H= 1=DA<$H= 1=f.|$lKHHD$YHD$PD$`D$d01A<$D$xt$pfuit$ptlD$dT$h9s`H|$PHAL$dF<A7w^A0A*A 0AA<$D$xA<$H|$PJfA@rAVvtAuT$`D$lt$pJ9HD$L$` D$x.fDr9A<$D$xwH={ 1<LUHC(H&D HC(}fEID$HC(HC 1Hs(HP`HuH;Ht$Ht$H= 1}t$H=d 1}t$ H=] 1wD$<}A H= 1LD$CCD$ C D$CD$H;CtE1H=f A1AH=u 1L}H= L1}tH=Ѩ 1E1S}tH= 1E17t$H= 1s}t$H=z 1V}t$H= 19}t$H=c 1JH= 1 }tt$H=ߥ 1}tt$H= 1}tt$H=ĥ 1fAVAUATUISHHH-2}uVHtMuH[]A\A]A^CtA}oCHC(1H[]A\A]A^fDH=# 1*HV 1LHI}Y1BLAĉCESC<<}Dk/EWLC Hs(A A IFIhPH9rPlfDHtaHk(DHH9A)LC A DAFHs(IhPH9sH)LH9HG1HAP`HHu<uHpH= 1EsHs(Hs(sH= 11`Hv"H=r H1H=ä 1sf.@Ht H[ @f.HcM DHATUSHG8HH@AԉHHHHHHC0@ @$@ ǀt C CC$C(D`,Hǀ` HǀX HǀP @0h41[]A\f.H@HHG8Ff.H HO@,øHAWAVAUATUSHH_0HxH;;oHDCHt$HHLHt$PH| Ht$`@. ~ H ǃ$ǃ(E1ǃ,ǃ0E1ǃ4ǃ8E1ǃ<ǃ@1ǃDǃHE1ǃLǃPE1ǃTǃXE1ǃ\ǃ`E1ǃdǃhE1ǃlǃpǃtHǃxHǃHǃHD$@HD$8HD$0D$hD$xD$lDŽ$D$\D$XD$D$D$ D$$D$ D$( H5o HcHK$DAC L@HpRHs K$ S HHhH@ HP K$~C K$AD;L$$|t$(D$D(D@DDDH,t$ PDTDdDh0t$$4t$ 8t$<t$Lt$XXt$\\$`t$llt$xpt$htHt$0HxHt$8HHt$@H{f{,LEH EtK{TS I@HkH@Hh H@$LAp$uA@(LEH EuPE9DCLCL`DhDdDTDHDD$HD@Ht$@HHt$8HxHt$0tt$hpt$xlt$l\t$\Xt$XLt$<t$8t$ 4t$$0D(D$t$ ,t$(fDPDDD]E9gDic({HADL9uI4~>HH;t$uI{\LHH9u9|a1$)։$HHt$(HcHM4LHt$p1A+4HT$pAtFHH;|$(uߋ$$9|.)HpHc1HMLA||?+<fDD$HD$_f.A}/|$UD|$UH|$v^ @H1Lj|$8AE11Y^D8>3H=ww 1HD$8HT$0L$HHH)H9A}H=w 1JHD$8HT$0it$PH=w 1)[H=r 1 A}uH|$@ PH=r 1܀|$UtXH5H=!w 1|$Uq:f.L$T$H=w t$1AωӉ"H5q LbH|$@cHt$@H=v 1OHt$@H=q 17fAWAVAUATUSHLL$LL$L$L$(T$IQ@HL$LD$LH@H9uFHLHDHPDH9uD\$D9AEIADHuD$A9DBD$IY<D3E\HuAD)ۉ\$pD$D$E1D$fDJLT$11HATATHH9uL$01tLDQADTH9wEË\$HD$XA;\$HcËDD$H$0HcT$1Dt$1E1AHHD$IDHD$1\؉\$\$K\$Ћ\$SۉT$l$DL$GD)E)D;T$Dɍ_9D$t$9ADGE9AQA9v0+D$Ht$D9rDH9v )A9wA4$Ѹ |L$ A $I4LcJtXfHcDEH|XAFlDII)IA)H ߈DAfDqD)EE)ED;T$\$HT$AD)H9$0s0H$0D2D;t$AEH$0AA`L$ADD)AD9vDH 9D YfDqw\$DtDA1AuDٻA1Hc׉كD!9Lt(DDD)LcσD!B;TuAˋ\$\$A4$Dʍ SH\$1H3fA9ЉT$EvAA9E2r5D9t'AB+DyH[]A\A]A^A_fDщDTD)Ӊ\$xуDD$i@L$HD$HA1D+t$HT$H$0BrfT$T$DJPHT$F4rAD$HD$\$9\$|HcD$ԅt|$'1 AUATUSHLx-HLHHf.I9vHxU L)L9HG)ډU HvHLH}H;xH}uHMH9uLL@HH[]A\A]@f.AWAVAUATIUSHxLHLoLI9saL)DpH|$`A$H|$H|$TH|$H|$XH|$H|$hH<$LMMEIkHp HcHDxE)@v IM$LLT$ M$I$LT$ I96 E$xE)I9" A$A$RdA$I$A$I$ADŽ$9s< IRH$BIHI 9r݉Hp DI$f#1ɃDAD9AuA$/MM$A$Al$M$L 1DA$BADŽ$A$AHA)A$@ADŽ$A$ADŽ$ D$@ D$8HL)DzI$xII$xM)AˉH 1e w.ЃHADŽuADŽ$I$LT$(L\$ D$hI$M$PI$t$E11ADŽ$PI$PPH L\$ LT$(A$ADŽ$ADŽ$ 1 ADŽ$qA|$(CI$H D$h1HD$ IH@H t(~߁ ~ҁI$I|$*L\$@LT$8M$L&c HD$(H|$0H Uc PI$t$W PH|$@"H L\$@LT$8I$ @AEIL9uI$L\$@LT$8t$(t$M$t$@PLb H|$@H Mb 1ҾH AD$(L\$@LT$8A$ADŽ$A$A$A$I$I$I$I$1MADŽ$MM)I$M$x-L9^&L)DxE:@AEAAE)5MMADŽ$M$A$LAl$M$M$MM$A$Al$M$LI$x-H9$H)IDxD$ I$I$M$D|$0L\$HHt$0LT$@L` D$TD$X D$ D$\H ` H|$8Vt$AUt$0LL$0IDŽ$H T$XLT$@L\$HD$ H|$8L_ t$(LT$HH ` L\$@t$01t$AUH<HD$tPLL$ MH L\$@LT$H[D$\u|$ ET$XA$HD$`A$HT$hI$I$$E)I$x-H9v-H)IDxI;MEIA)oEIA)If.HtfHtfHtfHtfHtfHtfHtfHtfHtfHtfHtfHtfHtfHtfHtfHtfHtfHtfHtfAWAVEAUATIUSHHmc IHHM϶HL@LL)H)HH  H)IUH~WHb^ LljLD$lLD$HIT(HDL)IIMH¸H9}IH[]A\A]A^A_f1H[]A\A]A^A_x {EL@t)H~#x uL@ LL)Wf.L@LL)>H4H"@f.HAVL5h AUATUISIA4$FH3H=P~@HuH1L)II) II1MX[1]A\A]A^f.XII1Ðf.AWAVIAUATIUSHHHV2HDL$A wcHv]T$tgI7IHIHt$ H|$(1HD$0BHHH${OAH)V2Eu/8H[]A\A]A^A_HD$ HD$(란8HCHL`HD$IK&Ld$ HD$H<$LLD]1@AA0HHuIIWIIL9t$HD$ HT$(uHD$HڃHH)ËD$tgHD$p@ @@vFHD$H)H@88Ld$V1I)HAL@8 H9uH;HuHT2H)Hu8H=l 1KfDH=j 1DHHL$D$#D$HT2HL$A v$8qB4H=}j 1VHAH=j H1þ+H?T28uwH)]H=j 1蛾H=oj 1DD$H $DD$H $HS28tH=j @1PH=j 1@H=j 1-vAUATUSHD&E~~HHHIHԺDLHdHIt|H)؋]I|$)Ís]HcH1Ҁx<H)HL))Ӊ]H[]A\A]fDHS28tH=X D1s1H[]A\A]HR28tH==j 1LC1HR28tH=5j 1L1AUATAUSHt$ Ht$ Ht=\$ ~5 t8fDPHȀ u,HHۉ\$ ux/H1[]A\A]H/uLaۉ\$ ALt=ut܀}>u֋\$ fA9~'&HHA9݉\$ t HEDB uL)H} HLHLH(H[]A\A]HhD$ ILAWAVMAUATEUSIHHHɉt$ tMtI>Ht$ LbHT$ (<JHxHcҾ>LhL$ PHtsMtIL)III?IIIHHLHL| HB;D}HfDHIP281H[]A\A]A^A_HXT$ H߅~$<)tB<\tV<(H҉T$ H=g 1gH1[]A\A]A^A_fDHGT$ t0HHH=g L1Jf~MtIH)߉|$ HcHIEHcT$ 8HHH=wa H9r7@1HHH9"3@\usLKF LHH5A LܖHH5@ LŖ"HH5@ L讖fHH5@ L藖fH5@ LHHvH5> L›H貯ZD諜H5D@ LHH6H5= L肛HrDkH5H@ LHHH52= LBH2jD+H5? LHH趕H5= LHDH5? LHHvH58= LšH貮mD諛H5W? LHH6H5< L肚HrwDkH5t< LHHH5p< LBH2}D+H5> LHH趔H5< LHDAWAVAUATIUSIH3> HDH(L2HK,M IH)Ã~H=> HHXDrHIc7HItJIIHDPuIHMpH= E1E1DLmHHt H}h$H]hH([]A\A]A^A_fLLD$1H)ع LA)LL$IcHk LL$t_HP428vH=L 1豞c@HxsH = H>H‰L))щfDHLHd$LL$*HHLL$HIDPHLD$1L) HA)McLk t#H328H=iL 1Dt$LHL t$Lt$H8RwHA328u HD$Ed^LH=ML AH1莝ff.AUATIUSLAHH=; HHUHE11`HuH]LD|HcHH[]A\A]Ðf.AVAUAATUASHLgPFH AH11DdHItlHCHHSLC DHPDK8H jLHtIt$ MHLgoH轚LAUXY^[]A\A]A^fH128tH=: 1VID$hHSLC DHL(HCHPDK8H LH!tIt$ HMLnH/XZ[]A\A]A^fH=J 1[]A\A]A^@HtHGP@3t H tfDATUHS HGHIH t?HHUHcID$HS0HL : PE1HHGI$XZ[]A\@HtHGP@3t H(tfDATUHS H跘HIH(t?HHUHcID$HS0HL9 PE1HHOGI$XZ[]A\@HtHGP@3t HtfDATUHS H'HIHt?HHUHcID$HS0HL9 PE1HHFI$XZ[]A\@HtHGP@3t HtfDATUHS H藗HIHt?HHUHcID$HS0HLw8 PE1HH/FI$XZ[]A\@HtHGP@3t HtfDATUHS HHIHt?HHhUHcID$HS0HL7 PE1HHEI$XZ[]A\@HtHGP@3t HtfDATUHS HwHIHt?HHUHcID$HS0HLi7 PE1HHEI$XZ[]A\@HtHGP@3t HtfDATUHS HHIHt?HHHUHcID$HS0HL6 PE1HHDI$XZ[]A\@HtHGP@3t HtfDATUHS HWHIHt?HHUHcID$HS0HLa6 PE1HHCI$XZ[]A\@USHHHHH,28uHH[](H=6 HH1 HH[]@f.AWAVAUATIUSHXGGH4H?Hf HI$AT$H,HH1H}HHEHDžHH) HID$@Ml$8I)IM|$0M~IH6HE7 DL載Ht#LHHLL)I)Հ v!ILxMHX1[]A\A]A^A_HH6sMI~HXL9v[@< wHsHL9t=< vLL$D$蜓LL$HHT$@HL9v HDQuLLD$01H)޹ HLLL$Rb LL$t9H*28HIM+t$0Mt$@HX[]A\A]A^A_LSM9voC< w&H6DHsIM9tIA< vLT$LL$ȒLL$HLT$fIM9vAHDBuLH\$81L)ֹ LLILL$LT$na 6T$8D$0IM} ЉEM+t$0EDuI\$0EHID$8LH9HD$ \MSHD$HLd$(MHD$HD$@HD$@DMHD$HLd$H\H I)ĉ}<H;\$ MLHHIMLsLD$HL$I)LL)ALLLHD$sAuH. LۆHLd$I_IgLT$LL$IrL9H(28At$H=C 1At$H=MC 1fHD$(LX8LX0MELd$( EID$8ID$@HX[]A\A]A^A_Ld$(MID$8ID$@H=1 t9H'28ugIFI+D$0ID$@Ld$(HI+D$0ID$@L='2IA?L1IL)ֹ LL^ t@A?tAt$H=|B 1At$H=B ZA?FH=B 1讑3fH=QB L1LL$LT$腑LT$LL$QfDI G H&28t%H: HcHf.fDH52 APH=VB 1 fH51 H51 H51 H5Q1 H51 H50 H50 s@H5 0 c@H5/ S@H50 C@H50 3@H5p0 #@H5G0 @H5$0 @H5/ @H5/ @H5/ @H5/ @H5/ @H5a0 H5FHH9H)H988HH9As6H HH;QtkDfDH HH9QtN9rEt9;Pt_ApH Ht HH@HH ;tH9u1fDH@fD1E1m@HH9HAWAVAAUATIUSDIH8HT$X HDH蟜HIsA$It$xHVA$DLDDx@PDPttL|$H=30 E1HLL肛LA$I}F蛋HAHH7 HcHL|$H=/ E1HL@sAlTLL藛A$I}F HHt`H"280AALH|$HL HH8[]A\A]A^A_H"28@H1@H-"2}E$EtIL$xADHQ"28tH=7. 1趌@H1"28IUHt$HHNH"28IUHt$Hl$ HJDLHIUHH-HD1DH=B- 1DH=A- 1E$E}H=/- 1ً1fH=Y- 1‹DH=, 1誋5DH=, 1蒋f.FuuGÐG@G@AWAVIAUATIUSHH 2HD$PD$H8AFt 1ҩ<@‰ƹtуu1tH[]A\A]A^A_HI 28ED$`IL$XH, A@AD$`H$IHHD$(1~L1苊A\$4AFAE1HD$XHD$`HI\$0A|$w E1A|$AIt$8HL$XLD$`HH)HuLl$XMHa2!t$4t6Ht$PHXDp~ID$PH@ @(D$HDH~D$H1@LL7HcHvHD$hAD|$I\$0HD$ HD$PHD$HD$pHD$8H,+ HHD$p|HHD$hsEL$ H)LD$ L|+Hh H* 1ADHAAH\$hIHH)I)MLL者AD$HD$pH28AvED$LHL$8LIHD$pMELI|$PLD$Ht$LL$H;D$pLL$L'LH28HvHHHIHD$hH)H|Ht L9sHD$hIL9rfDIL9Ll$hvA} tHSI|$PLD$t$LH)MD請8Ht$pjHt$(H=N5 H1TYf.[CAI|$PHcIT$0LD$PHDH9D$H DHD$`HH( L)DHHD$Dl$L6zH^HhHHH)I)LeHI:HD$H)Hl$hI)1ҹ ILLLL$OS BLL$IHDMIIIDQu L\$8u}M~xMQILD$p1ҹ LLLL$ LT$R LL$ L\$8LT$IIIDJHuII IDJHtMu< HD$I+D$0Hl$hIL$8Ht(HH9v HH)HHcHL1H9Ht$XAIHHH9~H28AHH)IAF u M IEH9D$vH28Ll$Ht+HEH9D$v Hn28LL]MH|$zH928H=7 1蚄H2H|$(yD$H EfI|$PVI11DjIt$PD8kT$HD$HdDLD$HVAF 411DHa28LD5D$HLE1KDMgD|$fDH|$(IfvH=$ 1@HH=o% 10$Ll+Ll$h7fLAvH=$ 1@*fHa2D$HD$HID$P@2 AVHt$PH=]6 1萂H28Ht$(H=$ 1mH=|$ 1ZLD|$D$HH[H28tH=84 1!IL$81HQCAzR\Hz28tHT$pHt$hH=3 1ՁT$hD$pLL H-IL$8HHL$H)ID$0HdHHL$K1I LHaN H28tH=3 1OIL$81)Ll$t$XH'# HE1tHH2Aŀ8rHl$LH" HHHHLLHL$HL$1@<H9ˋT$Lr@H9sHT$L1@LL)qHIt x>LpM9rʅDH28 HD$0H@PHHt5H5 gyHt$H5 H#xHtAt$H.yHĸ[]A\A]A^A_@xvIH\$(LL|$ fDHD$BD,pE1L-%2H DAI A.IuH uރ|$ HD$E@u ?LH %2HDt4D$t,HD$88Ht$H|$0 LD$LD$HK%2LHHHBHtLD$Ht$H|$0LD$LH %2HD 9D$ |$ D$ HL$ ȃv |$ H|$ H袶HItvIIHDP)D$ ILd$ H\$(vfDHa$2LHH‹BD$ HD$JpHL$ A|$ |$ )Ht$H|$0HFLd$At$H#2L)2E1ɿ @H L9t9txuxAƒ Atԃ€AH L9uAAt At$  HD$88AD$AL$H=, 1Wwdf|$ HD$@)HD$88JHD$H @PTwH HcHDAEIMJHD$ptcHD$88aLt$H|$0LD$LLD$H`"2AvLHLLt$0Ht$Lt$HH|$@H HcH~YI;^8}SHAH-LIHD$8MM~08L)LHH\$0H H{htHD$88D$ fH !2L¾HHʋJHt$HNRTLH+D$ ILD$P1ҹ LLT$I)LMB LT$Hd$`IIDBt@IIDBuLLHT$HI]HHT$DBILMLD$XL)1LI) LT$LLL$(A LT$LL$(:D|$hLLL |$`L|$`oH8RHD$889Ht$H|$0DHt$ DѾD HHD$!Pzf.Ht$H|$0(H 28AD$H=#( 1sLL|$ D$E1H\$pH=;( H1LD$sLD$ AD$H=' 1sH|$0 LH|$0LAt$H=' H1LD$1sLD$AD$H={' 1 sH=' HL1rH=_ 1rH=- H1rHD$88H=' 1r@H!2HD$8@FHD$88H=# 1drqHt$H|$0 LH=t' AHH1*rL|$`USHH҉t$  IH= HHӸ8u H[]fDHt$ HL訳Ht$ H H蜴HHH!28H=w H8tWH=T H8t7H=: H8tH=  HHH[]H[]1fH= HH1p7WdAWAVAUATUSHHHHhH7HHHH褸mHq CHk0CCAHԿA(HO DHcHHDHH))H 莿AHs2A'HD$w8VA(H- DHDT$ JADT$ q@=A 0DуT$ WE1ACCCD$(HD$8HD$HL$H( E1E1DHD\$$DT$D$8\HIT$8;T$ DT$D\$$v+L$ A|?A| -9uHL$H E1E1HDD\$$DT$D$8ܲHH+T$8;T$ DT$D\$$v*D$ |D$ | v9uHD$8NAu@ARAWLDL$8EHDH2XZH28@E11E1L{H{L{HH[]A\A]A^A_HQ28tH=M# 1m@H128tċsdH=R# 1@mf.H2H= 8iHD$H=<# 8K1Am<@HD$H= 8#ِHD$81MHD$8T$8H= LH DH^AfDH= l@A(PHD$18H= L6H= D1plA(HD$8HVHD$8HT$8H=i H0Ht$t)l$HHr1t`8tH=D 1cHQ18tD$HH= HHHD$@p1HL$@c|@8oH= 1qc\@H18H@1fH= 1BhH1L$L8HD$HH5 H\o@HH=+ 1bf.D$HL$LE1#fLHA1D9t$HDLH4HHt$@I !tH= 1YgH1H|$@?pH$Ht-pH$HtpfH=6 gHܱbfD$H* HD$LtH 619}AE0tD$L% =1E1t$Lt ?t$LtYtUH18yHdoAE01tIE`@t D$MGEO EHӰHd18H|$@nH$nH$n(H!18Hx1fDAE2 tyH1A8CH= 1@`+H= 1:eHH= H1HL$ _HL$ Hq18OHȯNAE0A EH|$IFPHT$0H)H)H4LH=HNH1HAV`HIKH H9v0< w)H$@HsIL9A< vIGHL$H9H5 LeHL$IGH9HYwII9H5 LeuH<186H= 1^#H5 L1 AAE2 H5H18XD$HwAE12uvH18$AD9|$HAGvAAGLH4HHt$@H}nH޺HUuA]0Att$L1fH= 1r]j1H=B 1S]L|$H=j HD$H13]XH= 1 ]H18EH= 1\2HجHi18H|$@jH$jH$j1$H= 1\H=b 1\IGH18H=o 1V\AAE2 H= 1-\PH5e H H= HD1\YH=O 1[%H= 1[H=A 1[tH5 L!E11#E1AWAVH AUATIUHnSHHHHD$@HD$HYHZHLHI)gHLd$ XHHHD$(*HD$8Lt$@L-a H$HD$(HD$HD$0HD$HD$ HD$H=g LLd$ Hl$(H\$8H\$0 VHIL$HL$HHT$Ht$8ZHD$8H9tFH)HDVLHfLshHkhHH[]A\A]A^A_fDLfIM.MM1@c^L|$P8LWH= LL1 _f1Lg1AWAVAUATIUSIHHH.H9v)WHHH9HDB uH9zWH0IHDFHSH9HT$v3HCDF u'HCDH HDN u H9HHD$uH9tWLt$Hߺ LdHH-H|$H9vBIFI.HxH9uLHX[]A\A]A^A_LD$ SH8K>LD$ LBDWL)MTBDWHt$I46DwHL$8Ht$(LD$Hf@AD$G*aHL$0H9L$HLD$H@HLLHJcHXH[]A\A]A^A_AD$ LHl$HFH\$LH}sHL$HALLLHHl$HbHH}pRHIHHH`HbafAD- HHDAD- HHDAD- HHyDAD- HHaDAD-HHIDAD-\HH1DAD-)HHDAD-(HHDHLa1/1La1Ha1AD-HDf.AWAVAUATUSHHHG0H|$Ht$LL$ HD$(H)HG8H9s(H181H[]A\A]A^A_@MIMLOIH@H9rHL)HD$tM1fILL)H;l$sLLLQKuH;l$zMLML)H9s/|PHILML)H9v I$DB uH91HD$M4HT$4Ht$8LLt$8(WA$<<<(IM9Ld$8L)t'H\HED$8HI9HD$8)uHD$8HI9HD$8L)Ht$H|$HhLHHHI`H$t%HaNH$HHt$@HpHt$ LH-HT$8H fDII1H= 1"Q1H\$T$4H|$HRHHH9E d]H|$1H EgH]H1PA4HT$@ƿKH\$pH7HsTWHIHHDHH;D$pHINLH0 fDHBIHL)L9HHDF Hu؀(<Ht$H|$LL1HHH$t%HLH$HHt$@HpL]DEDH DHu]Ht$ HDžHqHD$8HH@Ht$(ID$HHD$8H)H9v1A|$>t)IT$DHRz>tHHH)H9wHD$8H9L)Ht$H|$HHL1HHH$t%HKH$HHt$@HpHt$ HH^,H|$H"D%CHBHU\HDž11HsKHIHLHYH$ADH$Ht$(Hp@tHt$8L)HrKHHHT$8LHL)HYHD$8L)H$DHD$8H$L)HHt$@HpDBHAH>[HDžL+[1HE1E1$Ht$ LH|$(HXZZJHHIu}JHHkLLHXH$B+ H$Ht$D(Hp@AL{HtkATUISHHu%Jf.SZHk HGZHt*HCH;t u2f[L]A\ Z@@f.ATUISHHu'gt;tFHk(HYHtEHH;YCuH{YH{DH{D[L]A\tYff.HAHAHAWAVAUATUSHhD&Lg0L9HBHH$HL)H99<wy<mHE1E1DHL)H9v,Ea<\E1<)AHHL)H9wH9,$;>{> Ht$0H|$(LD$HI#HHHD$MoL9HCL5 Ld$@Hl$8HD$HD$XHD$ LIHHHHI9_HDB uI9KLc1M9MLd$XXGH1fDIDJ H6 H9,$Hh1[]A\A]A^A_<tH<(t4H9,$Ar<>L`HAIAAfH9,$r:CA<>`McH9,$Ar1{<AfDAL;|$w"IM9L|$XLHD$HHtHHD$Hh[]A\A]A^A_M9tLH)H'FHItHD$X1LH9r"NfDHAHD$XH9v2H<#u߉L HD$XH{HH9w@HI9v)EHfDHI9HEDB uI9E<<B<[<(FtHI9HD$XuHt$ 1HH|$XH)H EHI+HT$XHHH)NHD$XHD$H)AH\$X1;/1HfDHD$0H8MHHHt$HFHB HFHtHP(HD$HPML:LbLHT$CHT$HBBI9bHH+D$@H9$v}Ht$HjHBB5C1HD$HHBHBBfAWAVAUATUSHhHHL$HHLt$HM}.Ho0I9rrLH)H9sgAE1ɀ[u[[twfD](1]t{ILH)H9v(tIEHl$HL9HD$@HL0HhL[]A\A]A^A_DHHE1jLL$(1HL$0Ht$ H|$HHD$XHXZtE1M(,HHIID$I$?LIIHtH MtLNMELm8LD$HT$ HHt$H|$1"HD$HHHZHH+D$8H;D$( }<LD$HT$ HHt$H|$HD$HHI112@MtAEM}IEqAEImIEXL#AUATUSHHHtPI1LfH;LHH[ Ht*{uH H= H1LHDH[ HuH[]A\A]ATUSHHtHHLftCtfH[(Ht)CuHKHH= 1HUDH[(Hu[]A\HH= H1,DH{HfDH{Llf.AWAVIAUATIUSILH(EHD$~H=HAL=51HumfDH[(Ht^{uHH=K HHsHtA?tH=+ 1DD$ U>DD$ fDòL=1AAvHUHL$LDHHt|A?H}LHD$H]1A$H([]A\A]A^A_fH= H)HSHtA?unI} Au(DAfA?tH=~ 1=DAL=15fDA$Ht$H=p 1Q=:H=( H1DD$ 6=HSDD$ nAWAVIAUATH USMDF1HHHH$EH01H Ht$3HHt$  EHD}AA~LDtW߃TgO$ALHIIAuLDfD$HHE1FLHFLE1HF널H18x H$hLhx2HHD$~1E1AAwCIfD<>8DHt$ AE~AD9DI|< uE@H c@H 18 LD$`HL$hE1HT$PHt$(H|$gAAD9t$ AA)AA9s^HD$E H= E11DT$A?H= 1j0H$AH@LHD$(H=$ p1@30H18t"H$H= DP1D)0H$Hx=Ht18u H$HL$E1HHhH= 14AoDH$Hx=H18 H$HL$XHHHt$(H|$AE1E H8H= D4H$AH@EH18H=7 1.H$8H$8H{H DDD$P1d*DD$H= 1\/A1H$8H$88HT$PHt$(HMLEAL HcD$E1EP L|$ Dt$f.$u^D IwPH=0 E11L;LLc1H HDŽ$ A H$IDH|$@1K7? D$ErDt$E1H1D+$8A$ :H=S 1DD$(DD$ DHt$(H|$A`E1EHH<18H= 1(wH H H,$L|$AHDH18HD$(t$8H=A D$P1K(D$H,$L|$H E H=) 1(PH=9 1(H= 1'xH= 1'hH= 1'@H=Q 1'pHD$(H= p1'UfD H1A8T$B43H=~ 1DD$0D)G'DD$0H$H)H18#jHt$(H|$萕H18TH|$@4A(H$H= LP1&)D$E1EL|$ Dt$D$Eu^D IwPH= E11LLL9.HoHDŽ$ A H$IDH|$@ӽ(D$ErDt$E1H1D+$8A H= 1DD$%DD$TfDH=v L1%jH|$Ht$(&H|$@l3L<$I3MoA_E1/H= Dt$n*A)ADt$E AF1HlHD tHH9 u޹H$HmHo18Ht$(H|$RHC18H|$@AXH= 1$H$H= ދP1s$H$H=S P1W$oH$t$H= P19$IHHtiL|$@L1HH5T pH)LH$A)L$DŽ$ D$)7Ht$(H|$SH|$@11$E1H!18iH= 1#DT$H= D1DD$0D)[#DD$01JH|$Ht$(ƑH|$@<L<$I'1MgA_E1H$D+$H= DD$P1"DD$>H=J Dt$'AADt$H$H= DP1D)"H= D1"H$$H= DD$P1_"DD$H= 1G"%EttAF1H\HD twHH9tL uH 19HL$(H= ‰1DADE!HHt]L|$@LHLH$H)L$DŽ$ A)D$ Ht$(H|$H|$@ $E1H,$L|$E1HH$D+$H= DD$P1!DD$HD$(H= D@1DE H$$H=? DD$P1 DD$BHH= 1 E1WH 19HL$(H= ‰1DADEL iHD$(H= D@1DE$ AE1H= 1 RDt$$Dt$$[HfAWAVAAUATIUSDHxH:1H|$t$DL$H8[McKHM|A -HAwAW HHt$T+IAHH)Lɀt,LL-HŴ18 Hx[]A\A]A^A_ÀuˁuH1D8AG =1tL9kH1LI9@H9@@JH9A6H%18HDD0HAH9uAG H2I9H2LI9@H9@@eH9\&H1D&8t4H= Dֺ1HL$(LL$ DT$HL$(LL$ DT$1"AA42D0HH=AuAfH!18\H= 1ILp+H18$H= 1JH= 12DH= 1H= A1HL$(LL$ DT$DT$LL$ HL$(L*HN18H= 1vH=n 1HT$0DT$(HL$ LL$DT$(HT$0HL$ LL$ H18H=J 1HT$0DT$(HL$ LL$/HT$0DT$(HL$ LL$D$AD+)A9r0L*H{18H=; 1D21I9tTHT$Ht$21‰1x1AAD уuHt$HAAW A)H|$LDD$ LL$9'LL$LD)AGAHc|$L\$H)HL݃LH2L9AACfCfCȉCCfC(fC*fC,fC.CCfC0fC2ȉCC ȉC C$ȉC$HC4C<fH18H= 1MMt A8AAtE1IT$PLs4H4v?Lj1L$I 4LLAT$`HHL$tLL L$A8H=V 1DH11:MH5 L3fDL11A8`H=& 1LD$$O$LD$HHC HC(HHC(C0ȉC0H= 1LD$$$LD$H= 1yH=P 1LD$$^$LD$KH=y 1LD$$:$LD$ff.AWAVIAUATIUSEH8H1Da,HT$8fAv'MtAE0@u{H8[]A\A]A^A_AfED$t+t'fy* thH)18tH= 1@1HD$HX H81[]A\A]A^A_@H5c LqMDI#H18iA DD$(DL$HHD$ DL$DD$(uwH=H 1 H=q 1ADD$HL$fAHL$DD$H'18H=W 1H180IoPDAĉH9H\$ 1fDd$(ALHDt$DAIDD$,HfDH)HwgHH1HHEP`HLHt HHHv18dMLH|$ AE0@gD1ɺ HS`HtRH MIHPIWHPIWH@IGt H18u,AE9'HCPI H9,EW@H=~ 1D7H18|$A7tH=c 1 H18t|$AwtH=U 1Hg18b|$AwtH=j 1H<187|$AwtH= 1H18 |$AwtH=< 1eH18H= 1GfHD$ Dd$(1Dt$DD$,T$HH(fD9r y 9r7H fA9Eu9ry fD1fEHD$ \$HHP)ӉڋXH|$ MH18t$H= 1lH18H= ډ1JDH|$ >H18?H= 1,A DD$(DL$HHD$ DL$DD$(kHD$ T$HH+P@H= D1DD$ DL$DL$DD$ mH|$ H= 1DpMtH18H= 1MlE1KH=ѡ 1DD$(DL$(DD$(DL$fAWAVEAUATIUSIH8Hz1Dy8HT$8fAv'Mt AE0@H8[]A\A]A^A_HAfEHD$t1Ht,fy68tmH18tH= 1{f1HD$HX H81[]A\A]A^A_@H5K LmMLa cH18A8DD$(D\$HHD$ D\$DD$(u~H=/ 1fDH=Y 1ADD$ DD$HL$fAHL$D\$DD$ H18H=4 1eH18wInPAljI9\H\$ 1fD|$(D\$ADD$,HLMIމDH)H7wgLMI1LHHLAV`HHt HHHZ18MH|$ AE0@c1ɺ8HLAT$`HtHH8MIHPIVHPIVHPIVHP IV HP(IV(H@0IF0t Hˊ18u.AD91ID$PI8H9Af.H=F 1DH18|$A6tH=+ 1HV18t|$IvtHH=U 1H.18_|$IvtHH=h 1H183|$Iv tHH=d 1UH։18|$Iv(tHH=X 1)H18H= 1 fDHD$ D|$(1D\$DD$,H|$HH-DHH9rHQHHH9r1H8fA9EHuH9rHQD1EH\$HHH)HD$ HHPHH)HHXHHH|$ HKMH18Ht$H=n 1H18H=x HH1fDH|$ H_18H= 1A8DD$(D\$PHHD$ D\$DD$(2fHT$HHH)HD$ HH+PH@H= L1DD$ D\$9D\$DD$ H|$ 'oH=3 1D MtH184H=u 1!E1H=j 1DD$(D\$DD$(D\$aAWAVIAUATIUSHH(H1Y08HAfvEtH([]A\A]A^A_fDMAfvbEufy.(ulA E$fHD$H|$1MfA<@EtfA\$fy.(HS18BEGAF0@18<$AutH= 14$H= 1DD$ xDD$ kDH|$fEI<$TI$H=ȿ 11EtH18H= 1H= 1DD$ DD$ H=D EI<$I$NH= 1AWAVIAUATIUSHH8H 1Y<8HAfvEtH8[]A\A]A^A_fDHD$fD$v\ufy:@ugELI(@fHD$(H|$(1HfD$;|$tf]fy:@HC18BEGAE0@wT$"HJ HcHDtH= 1ptH=Һ 1XvfDtH= 1@^fD?fDsYfDH=^ 1 DA}SH= 1@L$"f>H HcHfDA}H= 1f.A}uH=F 1wbfA}UH=ú 1WBfA}5H= 17"fA}H= 1fA}H=* 1fA}H= 1fA}H=6 1fA}H= 1fA}uH= 1wbfA}UH=n 1WBfA}5H=7 17"fA}H=6 1A}H= 1A}H= 1H=u 1f.ATUISHHPH#v1D$D$8Hl$HL$LD$1HH\1|$DD$HLHu<'uk1|$DD$HLHt+HP[]A\fKfH= 1UD뵐HAUATIUSAHF}HHDMl$PL9}I)LL9LF1LAT$`Ht_AAEtAA9Du/1DЉу9ֈ wHH[]A\A]Ht18H1H[]A\A]Hat18tH= 11fHH{HHDHLHLHH)ALH)HƉHFD1ËDDD*H= 1[^DDfD@AWAVIAUDATUSBHDH(HHt$HD$W`HIEtKHAEE1IL,BT5C44HHItHHs18u;LIM9uHT$Ht$HSxH([]A\A]A^A_fDC 4KwH=K FD5L1LT$]LT$fDHr18tH= 16@AVAUIATUS Hv' )HD;AE1 []A\A]A^Ë LwH)Lt1ɉ΃<29A<6r Hs)HL`PL9thtdL9woI)HL9LF1LP`HHtRLH|cEIcx; BD%  vHSL;E11f[]A\A]A^fAWAVAUATUSH$HGhD$d"D$h#D$lHDŽ$$DŽ$$DŽ$$HDŽ$xHXPH$pHH Ht$HCH|$11HHP`HL$pHI|$rH1t t  f Ht$$$$$H$xD$LBHH$x$$$$>$$҉$$$$H$xH$p1H)‹D$LḦ$); $$Mt$E1f$$n$$)AL $$$$L$L`)AT$$҉$~l$$tN$9rQH$x|$LH)ƒ)Ḧ$;fDD9|dt/AAu@E1H$D[]A\A]A^A_Ë$$$ ƒ;,m$$9K)H$xDŽ$$DŽ$$AA|$Lo@;O$H=ϻ 1|$L/$$H)Lt1ɉ΃<09A<6r$$L$pH$x )AIhPH9H9H)LH9HF1HAP`HDHI|H9HcD$$A/$$$$H$x1ɉf.)艄$$11부;K$H= 1D$LHH)Lt1ɉ΃<29A<6rD$$L$p H$xD)MyPL9L9DD$I)LL9LF1LAQ`HHD$LI|EIcD$$C8$$$$dH$x1H=ر 1~E11Hj1D$H=g H1|$LI|$H)Ht1AȃF 9F rD$$L$p D)IPPk H9b H9H)LH9HF1IAP`HHDLI|EIcqD$$DD$$$$LH$x1N$9$Ht$L$$E1$$Ht$(Ht$PHt$0Ht$THt$8Ht$pHt$)AL D$$$$L$L)AD$$B$$$tN$9zH$xH)Ḧ$D$L);F$$$$DhD$$ $$)AL $$L$L)DA|$$B$tND$HGA9rCH$xH)Ḧ$D$L)W;<$$HHȉ$$Ḧ$1DŽ$$DŽ$$H$x1It$H)Ht1ɉσD89D>rD$$L$pA H$xE)I@PH9H9H)ELI9LG1LAP`HHDLI|8EIcD$$DD$$$$H$x1ɉ;e$H=ǵ 1D$LD;$H= 1D$L$$It$H)Ht1҉׃D89D>r$$L$p A)H$xMhPL9L9)LALH)I9LG1LAP`HDLHI| EIcD$$C/$$$$H$xD$$111E11뼍NHIt$H)Ht1ɉσD89D>rH$pD$$ H$xHHPD)H9H9DD$ H)HH9HFI1LP`HT$ HI|LEIcjD$$DDƒ$$$$EH$x1~It$H)Ht1ɉσD89D>rH$pD$$ H$xHHPD)H9H9NH)HH9HFI1LLD$ P`H(LD$ DHI|LLD$ EIcD$$DD$$$$H$x$$1T$$$$)AD$$$$HHpDjpD$$)AD$$B$Z$$tDFLF$EA9>H$xAL);HԈ$$ ƒDFHpA9&D)‰pD~D$$)ADW$$D$LnD)AL$$B$~TtF$I9rDH$xH)H$D$L);h$$DnDHĈ$11D$$DŽ$$AUDŽ$$H$xF$It$H)Ht1҉уD9DrL$pD$$ H$xIRPD)H9C;H9w~H)LH9HF1HT$ AR`HtaLD$ DHI| L LD$ EIcxr$$L$pH$x )AIPPH9H9H)LH9HF1IAP`HiDLHI| cEIcJD$$DAL$$$$#H$x1k1111It$H)Ht1ɉσD89D>r$$ L$pH$x)HIl IJP"H9H9H)LH9HFI1LAR`HrLHHpEIcX$$Dƒ$$$$5H$x$$1$H=5 1&$$$$$$H$$s$$)At H$$ tI$$FI11aHVz1D$H=U Hʉ1D$Lj$$HHpD~pD$$)AD$$B$tD$$EtAH$9YH$xDH);H$$ ƃr$$L$p H$x)HIl IJPH9rjH9wdH)LH9HFI1LAR`HtFLHHEIcx0$$Dƒ$$$$vH$x1m$$pFI;$H=\ 1{D$LD~DEIt$H)Ht1҉׃D89D>r$$ L$pH$x)HIlIRPuH9lH9PH)LH9HF1IAR`H1LHHEIc$$D$$$$H$x$$1It$H)Ht1҉׃D89D>r$$L$p H$x)HMl IHPH9H9wuH)LH9HFI1LAP`HtWLHLEIcxA$$Dƒ$$$$v"H$xD$$1"11$$D~D(1111막‹$$It$H)Ht1҉׃D89D>r$$L$p )HMl<ɉH$xIxPH9H9H)H9HF1HILAP`HHLLEIc$$Dƒ$$$$H$x111-DŽpAwHt$(LAtS$$EFI$H= D1@$$$$$$IE11PHt$0LuHt$8LuD|$TEu$$H;pV􉔄pt,DD$LH+V H5xL$PH= EHD1HL$H|$H E1En{$$Ht$H= H)$x$$E11Ƅ$oDŽ$$DŽ$$$ ƒ蛄t$$FIA$$$ ƒH9t9H9=H)LIL9LF1LAP`HLHLOD9|$ |$LH$x$$$@D$P9r"Ht$H=j E11葃D$PHt$H=H E11ɉm|$PH|$XHI$$Ht$XLL$}LD$ D$ t/;tH= 1脿L$$FIt$PHT$XH9tk;tH= 1IH|$1BSAT$XLY;D$XLtuDó$$FI-;tH= 1޾듀;tH= 1ɾL$$FI$MHD$XRHt$DrADt"9]Ht$H=X 1qA$$$<@H|$XPff.AWAVAUATUSH$HGhH4$L0IVPHv3HZHCwX1ɾHLAV`HHtH$HHHS18OE1H$D[]A\A]A^A_1IDLAV`HtHPHH$HPH$H$HPH$HP H$HP(H$HP0H$HP8@@H$$Cfbv(HR18AH= 1E1.fD담$1KT-LAV`HHJ<HHHD$(tO1H o1HHH9vXHTEfcvHH= 1E1WHQ18H= 1E11x@$HQ1HD$m8$r $>$fD$n$f$HD$ H$E1L$Ld$01D$dHD$XH$D$Lt$McHD$xD)HA,HD$8Z w5Hr H k HcHHD$8tH= 1fD1)ÃD$$L$9wH|$(2fD$Hu D)HkAD$h D)HE D)HE,* D)HE4 D)HAD$8XD)HAD$hcPHx HcH$D$H7HD$8tH=Ж 1D)HkA9H|$Ld$ )HoPIL9P L) LH HC1HW`HLHrH1t t  f HtI,LcHD$ HD$8tH= 1f HcIcH)Lt1҉у49A4rH|$Ht$ LLgPL9 I))HL9LF1LW`HAAEtAU0DLd$ 1LczHD$8tH= 1D@1D)H$kA;Hx DHD$8H|$DDHItHD$8LT$8H|$HHtHD$8H\$HH<[HHHD$PHt$PL$HHHH$HHD$pIH\$ $Lt&D)HIAAEM9HcI)Mt1ƒA49A4rH|$M$LOPI9KLA HA)H)McI9LG1LLL$ W`HLL$ AAEtAA$D̓LLc1*H AHn 5H )H} Hi HX HG H7 H! HE DHD$8H|$(E1H|$PfDHI|$HI$DHLILI)C !L)HHHcI)MHt1AAHH9rHL$ )LaPL;d$ dHt$ HI)L9LFHD$1LHP`HI0H4@8>uI~HELDLsfDM9'I9IC} tH} uI9rL)UwtH * v AFAAVA6QLq2=w>H 9 H 9u-H 0H@:0uUHpI~芖EyMpAEcL9XH)PpFH z tDGFADDOBLI2ʁH | Hc1 9H 0H D: PHqHǕf.H=S LIGH=2 LIGWH Q6x/HPLxLDLbI,fAVAUATUHSHHC t?L%#1A<$H5U H踙Au!A<$C 1[]A\A]A^@11Hމ HIHILHHD H=w L1ɒL蹛HHҏHDž[]A\A]A^fH(/{HHHts@ @H=Ix 1B.DH=w 1*A<$H58 H=w 1 DH=Yw 1ۃf+H$xH=c H1wH$)$f#$f$RHHt$H EjHDLL$XkZYHÐ1f.HtKSH%HHtAHHHH[p%mDf.H=yx {[f.HtHHt~f.f.Ht+HHHtSHuH[NfDf.@ATUISHHAH H 18u8H1HtH1LjHLL$( jZYH []A\H=w 1L$ uDD$ Df.HtSSHHVcHHt:HHHH[pkfDfH=w Tz[f.HtHHtj}f.f.Ht7HHHt(SH3tHHwHǃ[fSHqIIt)HTHI@2HH@wJL9u[@AWAVIAUATIUSHIHtHtwHIHtHtsHIFLHCLHHC4HtnH@HHE(H8tTHPHtHZHX1H[]A\A]A^A_f.H=Qv 1xH[]A\A]A^A_fDHL} LLHMwLLu I6H}(Lc{HgHE(J\0HE(J\0A}/ HjI1M@111fAF`AF61fAVbAF$fANPfAvRAFAF AFtfEffAF6fAF4fD;vfDHK4$`HIMt"1 IfALf PHI9uH}HI^@IF8L)u=HH w LLg1\DA}L}0@HI6YtHLJt1HHL"tH=t 1v1f.AWAVAUATUSH1HhIH|$8Ht$0t>.IHEMH1H΀;.HHt$PHMnHHHD$@=n$EHAH$Ht5Ht$A t HEHD$1H|$wHh[]A\A]A^A_HD$HHHD$(HHHD$xHT$@Ht$PHpxAHL$@ /ED 1$"HD$D/L|H1A8L$111ALTl9HoHHú HyHD$8HT$HHvHL$pjjjj1jAVHHD$ht$HL$LHHPdH0H}LjHD$8H|$(H|$x@0LDE1L|$XD$LHD$@HHD$`HD$0HHHD$htyH_EH\$pHtJH{HE111HtsLHD$pH|$xAHI$H@HD$pHtHGHD$x1}H|$xHuD$LHcD$LHL$8HHA(EHH\$pHD$LH{H_fH;HkMIHD$ HH/1MU0@ALD$(ME҈T$K@t$LD$E1L$XlL$H8HT$KLD$t$IBHHHPIWtK 2Mt3@< u@IC<2 tIIK 2`Mu< uDIC<2 K 2t@QE1H=s H1LD$LT$H $mH1LD$LT$H $0HD$@H$HH| uH>jH9D$(H10waHD$X< tWƒ/tMtI@tHH=p H1mHD$pHXHH\$pyH|$xE11L9|$vLt$M)M @MUAMME҈T$Kl@t$LT$E1L$jLT$H8HT$KL$t$IBDHHHPI"WtK 2 Mt3@< u@IC<2 tIIK 2Mu< uDIC<2 K 2t@IFMHDA<.t< MAMEAL9t$@BLt$`L+t$ Lt$PA>.)H|$0[hHH18HL|$ Ht$hIIH\$0LHmH1B;.8Ht$0H=p 1 kMAIFEHD$ WHH=mp 1HjHm183Ht$0H=`p 1jHt$(IM H=m IUM1IL$jH 1L$0LE1@Mt 9IFMHDAE1H=o H1LT$LD$H $3jH0LT$LD$H $0M*9!1AHwEHl01Ҁ8H=zm 1$i$H@4$fI94$wBD5IM IUH=l ML1IL$}iH0L$0H=n H1YiH=El 1VnLE1@H=n L1iH08H=n 1$h$AATUSH1HLp\H߃(H{HLL@ͺ k[tH[]A\fDHL L.^uHP^uHD$ \D$ @HtkSHHtx ttHu08uPH 0H{Hbu'H(D$ σ lD$ H[fD1DH=m 1gH=fm 1l뿐f.<tAUATIUSHHHzqI|$(HtZI|$ tDE1DLHHHt!H;Hk uHHuHuI|$(IM;l$ rtID$(It$@HtEI|$8t01fH,HHlI$HhI;\$8It$@rI$hL.I$gHI$P[]A\A]gf.<f.AUATH([/?].*)US?//HHH8IHD$%fT$-D$/HD$fL$#bH HvCMlHt$% Lk^u H AE/Ml,Ht$ LG^A,HC8Hs@HHPHS8HUHHC@H SHHHS8HC@HHLHlHnb1҅u(H8[]A\A]HAE/kf.HD$ $kD$ H8[]‰A\A]ÐH=h iH=h 1if.AWAVAUATUSHx $ <HDL$,DHL$8H$Ht$ H|$H$ sH=lh 1UiHH0{:&HD$ HDd$qH[HIHD$P%HD$ HHH4UHIAP HD$ fAV8LPHD$ H(XAWt fA~8 `HD$ H-QHIFD IH|$H01HqLL輶H=Eh 16hI>&qI~qLqH=i D1 h@Hx []A\A]A^A_ÐH5a0>.HD$PHl$p@D$0E1HD$@HD$ \$4H(HD$HDH$ H$ H{HHAa|$pt˾:HNaHIH@-HHD$dHHD$HXMf @_IUHIDPI9MrH^HL$IL$"fD_IUHIDPM9uLl$H|$1 AEdbA}LcHD$HfI9v)H08H=e DH1MafH;D$AfHD$H(HtOHL$T$4HH=:g H0Ѕt/H08_H=e H1`If:HD$0ncHHiL`L]H="DL$,I/ADED$pu.L_H OHD$P8WAHE08tH=d H1]H\$ I6H_HL_H=c D1wbH\$ H\VDH=vc H|$HZ(H=c $D1b$ Ff.fSH jHtH@HX[H=zc a1[fATUHSHtAA jHttHD H@HhHXtHEHtHC[]A\DHt3Ht6 djHt,H@HhHXHHH= c 1a1fHt[SHrv+uHH1H9tiH[iHH{H[iD@f.HATUHS iHHEHCEtML=A` AIcLIUIELrI9IEMuIELIuH|$HPӅH([]A\A]A^A_DIuIEAnHVH9IEIU@,0IFHtELIA>ZLLfI~H9tHL$MHLsH(1[]A\A]A^A_I~11HЉHHHHuHE1IItI~LHDsImIEDHUH9wuIEHIU 0I~LD$MHLL-ImHI}L9IBAL\HcIUMuIELrFDHI}D|$H9HB‰HHT$k\HkHT$IuIEL$IUHVEHI}H9HB‰HHT$#\H0HT$IuIEIUHVHYAWAVMAUATIUSHHIHH[Ht7tv=w 1MMLHHxDfD1H[]A\A]A^A_uH{MLLHL}ZH[]A\A]A^A_fDHUHEHZH9w+HEH]HELHuLHPAԅnHH}H9HBÉHZHtHUH]HEHZL}H{MLLHWL}11Ðf.AUATIUSHHIHxHt$HHD$^tkHt$11҉lj) HIv`HIHt$LH‰ H=Z 1LHH.H1f.USHHHHKH=0HHHH8H@ft|f=vVf=0@f=@ujf=RtdH5j &C#CxC;Hf  HHuHC HCHt-HH[]H.HC1@1HLtlv:uzutHS ~HaZ HDDH=P 1 FgH=P L1EH=MQ 1E]fAWAV9AUATIUSHHHGL`I@wHtI9wIĺLH=H0Iŀ;YIFL96M-E1HI6IL$E1LHHB)Ѓ 1Ѝ1i 1H!HHLDEt;ML9HHHrH!HHLD EuH7HIH2HzI6IM9FMH1FJHM.M~MfHH;IVt)H=` LL12DH=` 12IH[]A\A]A^A_H=5` L1CA@cf.AVAU9ATUISHOHiH@w%HtH9wHH!0;H9HA$AHIV;E1I}I}Ld HuE1E1E1fNIL9HIxHSHϸfHHЉ)‰Ѓ 1Ѝ1i 1H9uH!H@IH:t:HfDH9HHHJH!H@IH:uIIHI@HBI@HBI}IIM9UOPHHMeMuE1ImHH;IU[D]A\A]A^fDH=i^ 1AFLO[D]A\A]A^H=i^ H1AF른H=] H1AIM@H=] HL1uA^H=9^ 1bAf.D_ATUS)H_ 1Ѝ 1i 1D!ىHHLEDtJH/;ttQA;tLt4HLRL!H‰HLDEAuD AH4G []A\@f.USHHt|H@9@wfHt`H9wHHH=HHEt.HHH]HEHH1HHEH[]HHUSH9@HH@wHt`H9wHHH޺07HHEt.HHH]HE1HHHHEH[]HHAWAVAUATUSH(HLgLHHHÉ)؃AA D1ȍ1i 1I9uMD$HIHt$L-` L!H[L4DHHEL!H[I9L4rYHI6HtNL9tM;~uHD$LD$HL$H9tLH6HL$LD$uH(L[]A\A]A^A_@H(1[]A\A]A^A_ûG1f.HtqLWL)MJ 1Ѝ1i 1L!HHL$@9t$HHOL!HHLI9r Hϋu1fDHtkLGMtbHteH+7HI9vQHVI9vHH7IxHH!HHw!4HH!HHv HI9w1@1fH~AWAVAUATIUSIH8HGH9GHL$(Ht$HD$L ^ HD$ N(MM|$HT$DHHÉ)؃ 11i 1I9uIGH!I$H[L4&@HD1HII$L9HHRL4w~I6HL9tMM;nuH|$LLL$LT$4LT$LL$uHD$(IFH8L[]A\A]A^A_IM|$Lt$ L9vf.H108LLL$LT$LT$LL$H=Y 1C1cf.HD$ ImHHLELt$ [IHHHt$HHBHD$ HL$(B+HHHLhID$H8[]A\A]A^A_Hq08uDLdH=X LL1LL$LT$:LL$LT$HWHH=W 1:1H=/X 1?1jH.AWAVAUATIUSHIHHGH9G E1AUML$Iq)Ѓ 1Ѝ1i щ1H!HHHI $*E;EH1HIHHI $L9w!DEtYAuML$IL9vH!08HLAEH=W 1AD%IEIUMLDIIV1ID$H[]A\A]A^A_fH08u9HLI@IEHA1H=V LL18[HWHH==V 18@USHHtH8H-Z HH9tFH+H[]Df.HwHtHAUATIUSHHGHHt7L%Y 11@H<)L9tHt =FIMIEHHH9wHtH@1HH+IEH[]A\A]fDSHH?HtHS1H+HC[Ðf.SHGH;EHHC[@f.SHHH39HHC[Ht HGfD1f.Ht^AUATIUSH-X I1HIUH[HHH9tHtHPH5W L1AHI9]wH1[]A\A]1AVIAUH=*U ATUSI,H=W ,H=+U 1Li)I~tc11L%W )DHHHPH=W 1:)HHI9^v-HIH0HtvL9uH=lW HHE,I9^wH=BW 3,H=T L1(INIVH=T MFL1(H=W +[1]A\A]A^fDH=V +]AVAUIATUISHHl$H$Ll$ fLH@0HtkH5V LHH14Hڋ H!%tLDHJHDHcL$ @HHH)H[]A\A]A^ÍBATDUHS<1HvH|0AP8H@9wHH9wD@H<HLH(\(uDEE ILHHU$BHHEHEt+H߾H 2HHE1HtU[]A\H=iS D9[]A\f.DCH<_H=R 13H}AH=OS 18덿A?@@Df.AUBATUSHHIDH<1vH0AP8H@9w HH9wD@H4HLH(\(}DEE LLmILHHU$ HHEt4HLHx*HHE1Ht[H[]A\A]H=aR 7H[]A\A]@DCH4WH=~Q 12HuL4H=DR 1u7넾A?@@@H0SH8uXH{Ht7H3O4HsH{B4HCHC[f.H;?H{?DWw H=Q 11fAVAUAATUHSH0w G$V9H0:HMHu1HkdIE1AuCDEHH9s2HEHDHE LL$HD HD1#LL$AAgfDAyHlD H5bD LL$H=D HD1"LL$H=D Hu^D\$ EuCA?D$ tEQHD H5C H=D LL$EHD1h"LL$AA7H=C Hu]DD$(EuBA?D$(Ay HC H5C LL$H=:D HD1!LL$AA KH=LC Ht$$uJA?D$$AI$H%C H5C H=C LL$HD1!LL$D$$AA$MH<$H=mE 1V!A?L $H=) 1:!L $sH=B HT$,uBA?D$,AA(H5qB H=JC LL$H_B HD1 LL$AA((Df.AWAVIAUATIUSI1H8 H\$0Lt$,HCHD$HCHD$HCHD$LL H9H!H߃H=B H*H=B H[H=B HH=qB HH=cB HH=VB HH=EB HPH=5B HH=(B HH=B HH= B HH|H{H5v_1LIT$,P(H8H|$H51_1L:IT$,HH|$H5^1LIIT$,PcfDHdH|$H5^1LIT$,P2fDH`3H{H5Z^1LcIT$,P HH{ H5^1LrIT$,PHH{H5]1L*IT$,PHH|$H5]1LIT$,PnfDH@oH{ H5:]1LCIT$,P>H>H{ H5\1LuVIT$,P HH|$H5\1LuIT$,P$fH=q@ 1@!H8 []A\A]A^A_fH*HFH=_ wf.1f.SHHu>HLJuLJǃt0@1H[Hu勓)хt 1#HH 1HCHCHhtqϹ)DHHHHD;HHDADH߉D$ laǃD$ #fu@H5ɕ1f@SHH DEHHHD$HHt H9HT$E1HT$HHHD$HHPLD$(dHT$(H)HHHL$ H)HH^_t8H)ʅHu.HuEH [f.HD$AitH [Ð1H [1|$ uDH 1HuDAUATIUSHIHHG HwHXPH9tLw,H)HH9HF1HP`HtHHL$y6HEH[]A\A]fD11HIt$HE1@HcIt$Hߐf.t;r)uHW HHBPHGH1fHHG1fDHHGHGH1Df.AWAVHAUATIUS1HCH$HtHt$pHDŽ$H$1H$HGhHH$H$PHHD$ =51Ht$pH$tHĘC[]A\A]A^A_@H$pHl$ H95H$HIHD$,H ڒ1H1HL-D$D\$ED$D$hHD$xHDŽ$EH0D$X1D$\D$4L$PL|$HD$(H$HD$8HD$xHD$@HD$hHD$HH$HD$P@9$PHt$AH=; E111LHDŽ$HDŽ$HH$A{uHSHt$H=: E11D$0wH$8H|$1LQ,IŋD$4A9~)=C|-Hc#HI\Dl$4H|$LLMc ,ML$}1L H$AFHL9rH$B(HD$(8xHՐ1PHې1Pt$`H$PLL$XLD$`HL$hHt$@H|$8+D$4H NDD$X{tCD$0HKjAD$81PH\$H$HAXAYtD$\C2 8A|$HD$(8t$H=8 1fH10E1HD$(H|$H511)|$HD$(N|$|$|$8[@AG2 tt cDXL$LE1~DHD$HT$lH$H@ Hx iAHD$(8H$Ht$xA$|$lHH;$m|$ldHD$H@ @(H$ HD$@2 tAfDEL|$Ht$xH=11H|$H51m(|$4tL3 T$\L$ÅHD$(8H=!7 1DHD$@0tUHD$(8Ld$H5 7 LsAt,KAD$2 tD$\AD$XZAD$XDDAG0H08HD$(H56 LAL@)8H=6 1H$H=f6 1mt$H=6 1fH$ct9H$L|$A R8YH=K6 1FH$E8H= 6 1a 8H=6 1EHt$|$lAth|$lHD$H@ p(-H$E/fH$H=[5 1H=4 1D$\ L|$AHH=94 1=L|$A%1H=܋1ދ1H|$H5ʋ1%H08}1E1CLH@Ht H1f.@f.HHHGHHGuHfDUSHHHHHHtHkH[]1ff.SHHH7HPHHC[f.DHHGHGHGAWAVAUATIUSHHHHWHGH)H9r1L/I|LHHkH[]A\A]A^A_fDHIHIIILI1MtHSH3LL{H3LAVL+HSSHHH7HPHHCHC[H҉t'H=B3 H2H3H9uHHHHDHwH;wtHFHGf.SHHG,tC(1H[fH+wHG0Hw HHt$PC,HC0HT$HD$HsHHT$C,HCHH HCHKtHPHS뙐HAWAVAUATIUSHHHL|$I7fDLl$Mt^H4$LLML)LHUu*HtOHLHBLHHD$UtH[]A\A]A^A_H[]A\A]A^A_@H1[]A\A]A^A_1ff.HW1H9w)!tvtt 1fDuDAWAVHEAUATUSHhKHHD$0HL$`HD$8HD$@HD$HD$XD$\HD$PtHhK[]A\A]A^A_DD7AN>wDAwLl$pMLHL2jH$KDLk¸tDLIlHnoHD$0HHD$ ntO|$Xu@E1Mu Zu!BD5IM9ty5Dt(H~yHEHcHH[]H1[]GGGGGÐf.HHGHGHGHG G(G,G0ATIUSHHHt8AD$,t/1I|$HHHH)HA9\$,wI4$HUIt$HUIt$HUIt$HUHIt$ U[L]A\3AWAVIAUATIUSHHLHHD$XHt$XAWtH[]A\A]A^A_L$ LLuHu11 A8LgHHu瀼$uLc$Hc$Lc$D$D$I I Hc$I I HD$XH EHC8 MLLH I9H$D$HDŽ$LHD$HAWLt$XH$I9Iv H9KL5 H9LFH$HLHHD$¸H$LLAH|$H9DLAfDLL Et1#H$HDŽ$HDŽ$LHD$HAWH$LAWH$H$LHAH)A)պHDO1McL)H$H$HAWuH$LLHHD$jMDAE@Hc @uHc4uIL$IH|$A)I McLH1҉$Ht$LAWD$nHc4l뗸H$LAD$A9 H$H$H<$H$H$H$HD$`HHD$(蔩AH|$`tH|$` AH$HHD$fLt$HDŽ$HDŽ$HDŽ$Lk8LD$xHL$xH$WULUH$PH|$ L$L$ǫH AuL$$AH|$HH$HUH$HUH$HUEHH|$L$H<$HD$hHD$pHD$xLHDŽ$HDŽ$HDŽ$D$PD$TAu7H$H$H$Ht HtVAHt$hHUHt$pHUHt$xHUH$HUH$HUH$HUH<$Ht$TAuD$TE1C0Lk E1D;|$TDAHLL$L+H$LHD$ 6A?Ht$ H|$HARULLL$0L$LH$H$AY^A},Ht$ H$gA;E0DEH|$H$H$Ht$(H<$H$H$H$H$,AWHL$PPUATHs@HH$PH|$ L$L$ΨH t0AHt$H<$˥uH$t)H<$iHC8HC@LH<$蝥H<$L臥H$L<$D$ Dt$LHD$H$HD$(H$HD$0H$HD$8HCpHD$@Ht$L"9H$Ht$LH$H$H9H$HcH9t:H)H$H$HLHA$HIMAwH5 HcHD$TLL$pIDt$LL$1H$Ht$h1D|$PLT$x$LL$19$;MAE#EEAEHAEA9AÃN MMG EMLL$GE]HI 둋t$THT$(HLlH$H{HH$H$HPH$8HDD$TH$IE1A9  ɈH HH A iHt}AB<AEIEAEAE+AEC,-HCHC(HCPC,uyHCXC0uHC`AEH4LA$HHC`111;s0HHHS DBEu5u1HS`H4LA$HHCXs9C,RLKXA4Hk8HSz4H4LA$HHCPE11;C(HsPHH3HH4LA$HHCH11;S,HsHЃ Hk8HCH(HS`EƒHk8HS;J41t$THT$(HLQH$HHH$H$HPH$81;T$TH$HH L@ɈH HHH$H$HPH$8VLqAH|$@LLH{hD$TH{pH$L$H{hDL$TLL$H11A9v&HH98A<@u A|@HމH9HH$I9L)L$H$pLHA$HHChS1H$HHH$H$LNL$6 0 uH$HUHDŽ$D:t$ HT$0HL:t$THT$8HLL$TH$1D$ 9<\$ H1H$HHH$H$H~H$6 0 u@1H$HHH$H$H~H$6 p udHH@SHHCHHCPH{pHCXHC`HCh[DUSHHHHwHHSHuPHSHuXHSHu`HSHuhHSH}pHHHKHH[]]f.HGHHOPHG@Hf.HGHDHHH)Hwv(tBH?DAHAHf΃HrA9uH1f. 1fDHGhHHLHH)Ht(HHpH4 t1HD4Of4JHH9uf.USHHHtHH߉D$ D$ H[]ÐHG`Ht9W0w @AWAVAAUATMUSLHH8F,HD$pL $Ht$AHHD$xHI8t D;)@EHL$JMLD$II)L{LH{PItHCHHt D;k,LD$r H8[]A\A]A^A_s(B94s1DHLT$(LD$ HL$H$HD$D)I4$WHt$H|$I$]uLT$(H$LD$ MLTHCHHMLBH$HL$M$LT$ H4HT$(ZYLT$6A,t!I<$LA;W0@HD$pHs HHCXHD;k,E1B9v#@ЃHHC @HHD$p9HuMHD$xH $IJHsH0HD$pHHH;{u1zI$H;Ct_H$HL$I0WH$HL$D)I$H1)H$LLT$HI$LT$LD$ AUATIUSHHHHw(HW0H)t0Lg81H9UvHUHs(LIuH[]A\A]f.H}u Lg81ՐHG Lg8HG(HT$HD$@LHHT$HS0Df.AUATIUSHHHHw(HW0H)t0Lg81H;UsHUHs(LIuH[]A\A]f.H}t9HG(H}@vHE@HC Lc8HLHHUHS0fLg81Hw(1fHG0HG(H HGfDHHGfDLG(HG0HL)t8ATUHSHJt8IHH9HFHH](1I$[]A\DH HDf.HtzAVAUAATUISHHHLl$@HT$Ht.HH)t6H\$LHLA$tH[]A\A]A^HD[]A\A]A^H1[]A\A]A^1@f.ffDHHD$HT$uH|$EHDH1Ht$Ht$WH1H:uATUISHHHHt$uHt$HLdH3HUH[]A\fHHtzAVAUAATUISHHHLl$@HT$Ht.HH)t6H\$LHLAT$tH[]A\A]A^fHD[]A\A]A^H1[]A\A]A^1@f.ffDHH"HDHHRHGHHGHLHGHG0HG(Df.HHDH)HDAWAVAUATUSHHD$L$H$(L$0HT$HHL$LD$LL$HD$fHfHH9uLH$ I9HD$HL$IGE'IH9HPAA L9u1MTHD$E1A11HHHD$HT$ILI)H)I9LGMDHCDDD2L7fHIH9HEAӈTAADAuDƒuHAMI9DHALAL\$LD\$E D AEA9sOD)AAEȁfEL;|$^AIAAWHA @AA)A)E)AfEwL;|$AAAIA AH\$HHH\$H\$HHH\$AHXA)DI9ވTtpL@AAM9DLtVL@AAM9DLtAHXA҈THH\$NCfAHLf1L9H[]A\A]A^A_H\$HvHH\$H\$HHH\$/HEH@1HHHGDBHLLDHAL9tSxuP x A<D)…EHAA APDP@xL9uH@f.1HAVHAUATUSHH9LLEEAAuL\EDӃuL$HXAAAE,$H,AEDmA E E E EtZADEAADA AA$HEHDUH9Vf[]A\A]A^fDA)뤐f.1HHHGHLLHL9xAAAuDEAAuDPAEDPAAE E D D)ׅAEHAAAAHD@AAD@AA@xD@L9gHfD1HATHUAS"@@AAAH9H(@@uEIEAuEYAYAIHE#D D#AD A AA,A)ЅDEŃDAAA?@A?A D@(DADAAAEH9P[]A\@EIEEAABHAWBAVAUAT1USHDIνD$HD7A HAAH9rHH9 uHH)HH)HAAH5K DL I A4A)A< Ic42t@veDEHSAAHHH9wHH)HH)HJAAE[]A\A]A^A_E1f.rNvL$rDDL  DAE AD)ADv&DED)AD1A 3D)EEEu@rJJJHSfE1E[]A\A]A^A_1f.f@(tB@@σ ‰щF1@~NV‰ِf.@(v@HI@LT$ ILuuLɺLL%Hf@(v@HI@LT$ IL%uLɺLL%HfLJLJLJLJAWAVIAUATL USIHHMHHL9HHt$8ADD$Ht$ Lk0M9uDL$EPvUHEI9t4HIL$HEA$mIcLfDA1HH[]A\A]A^A_DHuLL)LAH)L9HL$8I9tI9/HLT$L\$H{0H{HLHL$ sDHL$ HK0L\$LT$S C@)H9SDIE1mH9HL$K4)LMHL\$LT$ HL$8HMHS0)IL))LT$A H L\$u$HǃALL$8LC@HD$8K@HEI)ǃЃfwkAЍ4)ƍ4f 4A)AD@GBf)@Cf )@ǍD@ I$f. BwDEuf똄҈trǃffD MD B'D1@q1ǃHLT$ L\$LL$@HL$8LL$LT$ L\$I9fDHD$8CfD1ЃЃ@ƅ<tu~u upHLT$(L\$ DD$LL$ǃǃǃHL$8LT$(L\$ DD$LL$A1ffDA1fA@3CǃfDǃǃAWAVIAUATIUSHIMHHLM HD$8HDL$,IHD$ HE1H)I9w DD$,I4L$HL$ LHL\$LT$D$(HD$8LIHM0II)H)H]HHL$HHL$LT$L\$DD$(II)I Eu5HtHMtCH]0Hu8Ld$8H9UHE01FfDHHD[]A\A]A^A_fDHH1[]A\A]A^A_Df.AWAVAUATUSHL&A(H$L1HD$0HH|$8HLd$XvH[]A\A]A^A_DELL$HAHHT$LiuL|$ H$LLuL$HT$HL3ELLSHD$PHEuH$8DH$L!Kf.O\DQAw~HG0UHAS1LGL_8H)ŋWLL9s )ƉDV)wDtLw@΅ɉ_\w@tSHH1IHIHI)H9IBLI9B AHu[]LW0DO w@D)9rDODIDAWAVAUATUSHxHo Lo0H|$@Ht$pHT$ H\$@CDD$C@D$ HD$pHD$HD$@D$8HXHHH$XHHDH|$h\$XL\$XP\$4XT\$PXX\$HHøKD$0D$TH؋LpP(މ\$`HX8@,HH\$(HϹH)H|$XL$dDDL$0D#L$ t$H<$DHHL7EDw}H A9D)H$fA L$LlT$ t4t$TL$`!։MIMHDL$XA4L$dRM$TL$@F)щL$ fDD)ׁfA9wM΁M tEDwuH A9wL A)D))fA9vD$ C .IL9l$v H9l$ wMH H\$@|$ C,D$8Hk S(Lk0{@C\D$CLD$4CPD$PCTD$HCXD$CHC 9wCDLt$pH\$@LHLk0M9< HD$@Hh H9l$ ( H\$1v H\$@C\Hx[]A\A]A^A_f.A))D)H<$fA L$L NEDwMH ȉ A9EڃD$ D)fA:H<$LdA:wUH Љ 9AA)AfA2OTJD)D9߉fA1sJM JEDwMH ȉ A9w|?A)D))D9fA1r|$ F<'AH<$AFHO`DGDwMH ȉ A9D)AֺfwIEEwuH A9D)AfEсLOE EwMH ȉ A9*D)AfEցLwE DwDEHD AA EA9D)fA2ALOE DwMAH D A9UAE)ADfA24L WEDwUH Љ A9D)fA9@AA AH4ALt$8I)Ll$HLAAHt6L,$IMEED)AуfEtUDM~MEEw}H A9wAD )E))EfEG\uLt$8Ll$H|$N9t$ |$P|$|$H|$4|$P|$L$|$4D$HL$AL9uL)AD$8L9s )Iȉ|$8ϋt$L\$(LH)I9IB|$ HJ4I9K4.ZJ<L)MDHDFH9u]fL$Ht$@LAH)I9͹HBL$(HVD L$ ҃)щL$*fDD)A!AщfE EDADN D!ljL΁MtE:EwuH A9wA))E)L A!fE @A))D)fA:|$ |$ H<$NTEDwMH ȉ A9BD)ׁfA:H<$L7A8wUH Љ 9)t$fALH)I9HBt$(LD$  1C .I|$Ƀy |$)))AzfA2wUH Љ 9AE1)AfArOJ@LL$(Ml=K<.EHAI9IDHDFH9uA))D)ǁfA:H<$ND0A8wMH ȉ 9j)|$4fAT$|$T$4|$҃z |$H<$Lh @)))IfAAADA))D)Ǎt6fA9 fDAA))D)DfA2t@AD)D)D)΍TAfA25A))E)ȍTfEfDA))E)уfEgA))D)ƉAfw9t$JHx[]A\A]A^A_fD$ V)))H<$fA0NDHA8wMH ȉ 9)|$PfAT$|$|$4T$4|$PEf)))fA01fDA@wMH )Љ|y!AuH<$DFDwMH ȉ A9AD)H<$fFH|$hDEwUH Љ A9D)DfH|$hDсL OEDwMH ȉ A9ED)fAH|$hN WEDwUH Љ A9D)fA Al$ \$85)))|$HыT$fA0|$|$P|$H|$4T$4|$PgA))D)GTfA9BA))E)AfDL$A)D))ȃAfAFiA))D)ǃfA9'HD$@HL$pP@@ L))H9vLT$ HD$CHD$pT$ HD$0HD$@H\fAUATUSHO_Ho@D_(LWDO,H!ALAL$EBw1H9AAHA D DE9IlH@tHODLgDك!HO0HHAAD)ōDmMB0AwKAAUF H8u IH:HHPuz@:zr3DRDJDBJ@zDDRfDJfDBfDRxH@r@zfF @D4D9E9@@Et>)19DfCs&tfHE@SSfPHH+U@SPw*҈P1AsfEfC@xxDElHMP@HEHH)9wWHHUHHuH(H[]A\A]A^A_DD=lH}P @HEHH)9wFHHMHHtHu@1HDT$DD$D\$DT$DD$D\$fDHDT$DD$D\$HT$DT$DD$D\$HT$돾HHHEHE5H+E@HUfBfBH([]A\A]A^A_HEH]F<"F1HD$HADL$D+]@4HE@fWHGu @HG@H;GXwHGHHHG@E11I 3D@ƒ9@uBLlII&uHHLHHHHƆ)ƆƆI@HHHƆƆƆfDuQHH9uLljHHHdžHdž)1HHHHHH)HDSHHHw@HPC4HC@[@f.ATUSH@t9w4t@HIHL)ЉCht( A$HHC@tk4[]A\[]A\fD1ff.Sw$H1ƃƃ@f[Ðf.Hf=AL_@A)EAFINDAIGDA)BXE9AE19O(AEA9HLJ YHI0H)1f8@ HfSHGH@HfBP:Pv9D@8pHPHPDD@@xfpfHfD@HSx|w H[HH[Df.SHWHHRH9W,W f@HWB<|BvH[(HOAЈAG,G ff.SHHf@HWB<|BvC0H߉C,[nf.@G1DG1҉GDATUSHG HDgHCAD k=CwHC Hc ʼnk[]A\fG)wWv @f.GSW9vw1ہw[[))WƉGf.ATUHSHG GGH1҄u+]AHE H A]u1҃[]A\f.HHHHGH4HGDf.AWAVAUATIUSIH Hf8XpH_@LAUs9;M$AD$ AHD@H,CDH9CHS 9sLAUI\$LH []A\A]A^A_ËHHw@P HcIL$ A AL$,At$(@ AL$ AL AHcHHID AUv Ѓ )H| f f ?H$AD$HD$HH@H@H@H@H@H@H@H@H9uI$PAD$ 0DHl$ A|$WIL$@HI$9uAT$@u޸@@)1E1H8H|<!AΉ)HH9uHL@t$ ILDt$ AUA9{T$ 9eD)DLAUD$ fACHHDuI$0AP9ID$LAAD$(AP)AUHD$H$HH@H@H@H@H@H@H@H@H9uEHDI$0VHRHH)HOHUH9DuJL1AUI\$L& L獐 )f I$HPIT$X9H$s9rdH$HHS<29sLAUAOwAouAfA'AGAGI\$L?1f.1fD‰AHHɀH uADD1HGHGHGffSHHHwHPHCHCHC[D1ftVUUU)f7t9 ttfDGSHH=7 ЖHC[f.HGSHt5 t t [fC[HHt[ѢHHC[Ðt9 tt1@W҉H1HtH|HÐHGHVHDHHH9uf.L.11HBוWlDHHHHH!H1ȃuIHHufDHHt(H=.1HfD2HHH3H9u@f.HHHHHHfHHFHHGGG$tHt4HЃHuG 1fwH HcH¸uO$1DtftfHGHGHG(t f.H,7AWAVIAUATUSHHL:I8H$HHL$IMLD$ DL$,H|$IF(HHM,HD$0IF,HD$82I)HM9MGLLL]M.LmM)I6MnL9uINLA@H)LHINHL$轔HL$HD$Ht$IIFI)I< I9LGLHT$ LLl$L)l$L*IvHIvt+AFH=Լ HcHIv1I96HH[]A\A]A^A_fANAV$LPIF@AF$HL$, IFIFfANAV$LpIFf.ANAV$LIFf.ANAV$LдIFf.AV$EFLHL$0諶IFZfHAvLH|$8Av u_$IFIF/ANAV$L@IFH|$u,T$,t$H$HH[]A\A]A^A_HH1[]A\A]A^A_ffDH HD$PDL$0謾1Ƀ|$HT$8 H(fD黸f.USHHHOHCHHH[]f.Ht @6HDH HwSAtHHH yPH#@DHLƃHH 2EyD9|1ÐA tøfDHNHvUSHH0AHHHH¸Ht5HZHUHEHHEHHEHHE 1H[]f.H7HGGHGpHLJHLJHLJ@US1HHG~/fDHuHtHcHHDHxpHtPx9]HuEHtHEHPHEH[]fDUS1HHOQ~"HD8HD DH91~HcŃHHHxp9kH[]Df.USHcHH!HTPtH[]HHHHTHHHBptvH7HZxH\HHHHHH@H@H1[]HHDHHH[]HDpHO@f.AWAVIAUATMUSIHxHHt$HL$DL$@HD$8IHIHD$H$Hu7HHHID$uHx[]A\A]A^A_f.AD$HL$hAML|$HHL$ HL$`EރD$HL$(HL$\HL$0$Il$Ml$E11D$DJ@HT$I+DL$@HL$HT$hP9tTHu H9uHII9*tHUH}EMH)J:PIL$H|$h9uH|$HHD$8Ht$H+HD$`HcL$t$0H$IWHT$8LD$0HxpL$l^_DDHT$hL$uRIHT$A|$W9HT$`taHU HEAMu^H|$`uH|$htD$DAD$HUfLHD$`It$Cf.H|$HHT$Ht T$D_1EH$fDUSHHHFV fH~|;Ct H[]f}H҃[]Ðf.AWAVAUATIUSHHH(.D,LV|B;+tH([]A\A]A^A_@DsLAA@Et$EDIE1D$ HD$H$DLD)H]tB<8H$)IHBjL|$AƉD)L9TIJI|$ DE|$HLA莔EI D9l$ }D9v.DAG< t f<P9u1fDAuH{LI$HIEt$IIT$H<D)]AEt$AWAVAUATIUSHHDnAADuD;wLE1FEt$DLD)HHHTuoAE9EHCM$IN|+$HD$E1I~I $D)LHHT AuAI(I L;|$uL$1H[]A\A]A^A_HOP1f.)HHHDH9u HA9A9OfSHHXC1HCHHC(HC@[f.HXAWAVIAUATIUSHHMHHDL$8HD$IHIH$H$H@I0HD$ HD$PHD$(HD$HHD$HD$@HD$L<$I)tdMwH HcH@CHCHHEIuC}Iu HL<$I)ufHD$I+L|$HI HD$@$D$@H{XHE1LPLD$ HT$(HT$PHLAHL$XHT$PIMHKIHIHS EX^H$8kH  IuC]CEL}@IE@$ LCIu@}vC@C1Iud@{A A)DI9sELH|$ HHDD$M9s9 IA uًOuA IHGH9wf.HI)LGDA GIEH딐f.AWAVIAUATIUS1HHHFPDn H$HGHD$ELD$I)M9MMGMtQ1LHLAT$`HtPHIIBB3uHt$$THxAE1l@L$aL MH$MLHQ Az L9& ML@t$HDHH9#H=P 1HE(@H+fD$O'Ht$OH V@BC| MpM3KD xM@B wHHD$Mr M`K7@Hͯ Ld$PD$X D$\HHD$P@LHHuH]8Lm0HHE0DD$O"#fDH]8L}0K7B[@HT$hHt$`HmHRDH$Ht$x1H|$Hu8HH$H;$w~H/8H$HHHu0HH$(HE8H$fHCH$^H=O 1DHt$ H|$Hu8bA|A|( HXH$HIx hHD$`MI9L{HHt$1HHH$LHHx t!M9vIx M9HuI_HGL9sYHIHHHtHLHHz t!M9sIz M9HuHI_1L{H$LD$x|$OEfDx L MLLD$LT$HIDLYHIHLI LT$LD$t (HH9uLLT$LD$LIM(LD$LL|$`IXLD$xH$bLT$HD$h$LD$MIL96IPI1KLD$H$HHLx t&H9v!fDHx @H9H@uHBHOH9HHLHIHHHHL$`C|8 @ HE0LD$LT$HH|$`rLD$LT$HD$hIXLD$xMH$H=K 1\Hu8EHt-L$bH8IHt$(H|$IHt$(H|$M`L~@f.USPHHtsHp HxHvHtVHCPHCZHHC(tH"/8uEHH[]HkH H}{&Hs&Hk&H1[]f.H=KK 1BHf.SHH?,&H[#&f.tDUSHHHt5H%HHEtHH[]1HD1@AWAVIAUATH=USE1I͉H8Ld$L$AoM7tT$A\ HL:S &HD$ 0D$!1I.D$"2D$#3D$$4D$%5CAGD$&6D$'7D$(8D$)9D$*aD$+bD$,cD$-dD$.eD$/fHD$AOHAL 1 AL LCHуL LCT HHuC<AoMAotHCIECPSH8[]A\A]A^A_fD$HAD HI:P PHOID$HD$fDH|$Hs xHHuAUATIUSH=E1ỈHHL#AEt$A\ H1HI]:S tH[]A\A]fDHHHs HPt HHu1MtHCI$CH[]A\A]DHaU HODI)1DHTHH!‰DHDfHHdt&H5/X 4A9wD)ʈHHPHwDd1S1hH@HH1Hcȸ1H $AHHDŽ$8HҺ@E11HH"HH$0HtEH$HxHHHHH$8H)H)ˁ@HH8HH@[1ff.USHHH(HtHHwHHuH0HH[]H@AVAUIATUE1SH(HHuSIMLtGHE11HuLmHHHHH9vH|H)cHH]LIMIuI811H@HHHI0HH@H9wH/:u4[]A\A]A^DI<H)Hu/HI0:tLx*fH*YtW H=R []A\A]A^HfHH H*XHt:t4HHt(H(11HxHHHHuH>H øÐf.AUHATUSHHHHHU HH!HPHH)PH[]A\A]ÿAHHH(t4H0H+8H9wHGH+GH9H?HuHBH=Lm1IHHLE11A"LQHLhH@HH(HHH(DH[]A\A]rDHf.H=P 1H1HM1ҸE1HHALHISH=P 1Lp1fHt!FHH)FHQHHHH HPATUE1SHHHt HHHtH1HIL[]A\DHHAVAUIATUHSHNcH5R ȋHtwCHH)L4L9wHtK1c~oHHH9w6HL!HItiL9LHHFH4HLiL[]A\A]A^DH=O H1'[1]A\A]A^@H1ff.USHHHHtH[]HHHD$HD$ff.AWAVIAUATHUSIHd HuMILIM}L(HHtXHHLRt]B+HH[]A\A]A^A_fDH=QO HL1,H1[]A\A]A^A_H=aO 1L1HL1뜐HATUStOIHH HXLHzHtHHH[]A\fH=O 1H1H=!O 11fDAUATUSHHtiHHHH0 LhHILHHt&LHHB#HH[]A\A]DH=O L1DH=O 11fDHATUISH H߉nHtH5;H Ht;tMu9Hq Hp LEHHtMH5HH1 H[]A\ÐHL[]A\qH=1R1fD1DH=121@f.AUATIUSHIHHuAHƺLHHjHHtJHƉLUHt>HH[]A\A]H=aN LH1H1[H]A\A]@1@L 1@HHHAWAVHAUATUSHT$wH$H!D$HD$D$HD$E1D$D$1E1E1ALh@1AL9E1AE|$%fDE9tSDDD)L9sVQD1BMsD)A@8uARfv'A@ARfvBJD)у ؃ ADNCL )Ӊ);D$s @l$D$|$c@u@:l$sDAAEHH;D$DT$HT$AAL)HLF11ItlfDHBDADsEAAD!ˆL9r̈́t/s![]A\A]A^A_ø[]A\A]A^A_øD$<D؈\$fDAWAVAUATIUSHDFNHt$0DGȅt>I11A9\IqHHA<8Eu|Euw@ti@u@t]@8t+ @_v @`DCfDD$@fE9vD$HfT$ f9T$Pu EɻEA{Ѹt$PZDfDT$L$HL$@11Ap‹ A9AFtzA9 vAH$D$8D$`D$TMHD@H\$XHH$H\$X1D$pMCC$$;$BH\$hHƉD$xHHH$HHHދ H$$wEHH Hc4HD@D9DNLF Ef.D$HHH$H4)H34(9߉\$|$tHE1E1(H$$4*$)HH$\$$\$9AH$D$D$H$H\$H$HH\$ H$H$D\$PH\$HHD$H\$ HDD$H@EýADE@DEA9wof.9rXEf@tE9t;Et9t2AAE EC&AC&Aǃ9vAA9v\$P\$D$;D$$\$D$9D$tD$HD)D)ꃼ$uɍ@@Eƃw )T$p\$p9D$T}YD$T\$8$\$`T$x;$HD$X MHD$XH9$|$TD$8D$0D$`D$D$t\$`D$ H\$hHH< H|$@|$t )HHH\$(H$f|$PH  (f9f\$)AH$f\$ (HH$f\$ *L$f\$pAEA\$ f9\$4H$DH$DfD$THD$@HHD$XHD$(HHD$HD$fD$D$$HD$xHD$XHrH|$HHH\$xHnD$H,EDAEDE@EDEȉE9rT9wDDfEtD9t'Et9t EEDtD!A49vAE9s\$Tf\$D$f9D$ -\$pf\$D$f9D$PD$D$9D$0D$8H@1@YE1`H\$ D$H\$E1E1D$H1EE1H|$H$Hl$HcT$THD$0H=B Hp81H|$@D$8HvH|$(jHD$@X D`fA9f\$PM@ H\$(D{Dk fD$0D$ЈD$ fE9HD$(H\$@DDd$Xx DK LH@|$x AHD$`f|$MIH|$` 8HH<EADD|$@EE‰D9wh|$H|$T9wQfD$Et9D$Tt:|$t9T$Ht-f L$EDT$Dt @"|$ A9vA9sfl$fA90fDd$0fD;d$PD$81EɾY1W@L$X%-D$HuHEXDAHXfxB$+u=X HƂƂ92HUC B\A/HD$0H=? Hp81]1H$ `Ƃ9ff@9ƂƂƂuH9vUAAw)9ADDA9DGʃ9t AADXD9rnAtKvFLH1+D9stLcO<B;sHc׃H 9rՃt HRI ʃHRIDBD )rAPD9DLm9?AD3\ff.HLvHHAD AuF1DLB AG  AuLLAI9uHHIHC1f.Ht;HGHHt2H9w-Hw@x'HHH9uH9}HHG01f.@f.f.HtH== 1fD?v DuH=q= 1f.HHGHuWHH)HtaHt\H9rWHxRH 2HAH9AuD +9wE1MuTE1HA9\1DL\$LD$DT$8DT$LD$L\$jf.DDT$L\$C LLD$LH;HC8LHD$ HSHLD$L\$DT$xRIII)R@M{ C9t:I%-?C$DDHCH1HHtIDHT$(3LD$DT$DT$LD$H$H9CH=R: 1ofAՋCADII4Ɓ??fH$HH=: H1H[]A\A]A^A_HT$ H=: 11L H$8HxH=Y9 H1H=9 1WM`1{3f.ATUHS__ L%˄0_LHHt[L]A\@H=9 HH1L[L]A\O$w =1Ҹ@AWAVAULATUSH( W)D$DILG1ɅufD;OsHITƁ@uߩ?tD$_L$ ;OD$rD$"Ld$ HE11MtDH9u4u IHM9A$U] ADHHHuHtSL=[0LT$Ht$LLT$Ht$E1A2L)LHLu IIHM9qHLT$Ht$tIL=0LLT$Ht$E1A2L)LCHLD$)E$H( []A\A]A^A_t$DA9IFA?A9s/DʋT AT?A9r0t DtPIЋT HAT?A9r؉L D$A9D$H/8H=:8 1"H/8$H=8 1f.AWAVHAUATUSH(LGHHMI)I9LGMAM9AMHI HAL9AL9f(Ht$IHT$oHHAN 1IHD$HH1HIAID4HD9D$LEDE9AV H9HG1H߉Ҿ LH)HAD;|$wQA^ A~1ɺADHL tH(1[]A\A]A^A_HD$H05fDH\$Ht$LHkHt$B#HL&H([]A\A]A^A_@HHtHD$L|$H)HLH$Ht$ALHH([]A\A]A^A_HD$Av 1HHH׉)H9HGDf.AWAVIAUATUSH(HHt$AHGHHH)HHH9Ht$HHT5HH9H9fA(AGD$AO HD$1H1HHHD$AHD$HD(H9AACDE9AW H9HG1H߉1LH)HAE9w6A_ AADHLtEnD;l$rDLAIE9vH(1[]A\A]A^A_HGHHHH+T$H9v H@HDLD$HD$H([]A\LA]A^A_Aw HD$1HH׉)H9HGfHLGHML9AUATUSHHH_@HH@L9@u|L9}wf(AHIuOA|$ 1H1H1HHD+HL)EPu1AD$HHL[]A\A]f1DH1[]A\A]Ðf.f(tHLGHMtwL9wrHHG@xiH L9@H@uSL9}NATU1SH H1HƉHAH9Awf.H߃SA9s[]A\H=2 1fH=y1 1fAWAVIAUATEUSHH(H<$HL$vMEI1DAAI9#HI991҉E1AA11ABADAA։\$EHHDl$1HDaH$11fS(L{8HC@HkPHHD$HkHDcDkDs HCH2C$fK*HCXHLHC`HaHChHFHCpH HCxfH~/1ۀ8H(H[]A\A]A^A_@H=0 11hfDH=z0AE11A"LLT$HHLT$ HLHD1H8H=1z0,Ht{H$fDk(L{8HC@HkPHkHHHD$DcDs C$HCD$C1fC*HfDH=T0 1DH=y0H=k0 11\H=20 11@f.AUATAUSHHHIHHHD$0|HHH?H9HTH9HunH9}iH IcAHHHtgHT$XHPfP,HĘ[]A\A]ÐHH)xHe|/8uJAE1@H=*/ 1:HĘ1[]A\A]1fDH=wtIAHh IHcH[]A\A]A^fH=+ 1?AE1fDIFL0qfAFf1fAF11t@IFL4PL(A9nw݉cfDSHIDHAAEA9`E9DЃ<`u411AHH E9vjDAAA`tH=l 1.1[H=k 11[fH=* 11[1D[@D1[fAVAUATUHSLGHILNʃEA9tH{0HC(-{H4@4A9D$wIM`IR`H9H|$H AD$IR`H9H|$H AD$f AD$ 9ET$1҉EfDI}PAIJ 9D$ 9$ ;у`D$|HDŽ$҈T$#D |$#蓴HH$D$|D|$X Hу@P~9|$  `9 у`u211@HH 9 AAA`tH=@ 15D${ fwAff wZAH= 1D${D$|D$}@H= 11ȺD${T$|f.fAiAs1D$||$,1fT$|T$|1nDD$|D$ AF I~8pH迯HIF8 T$|4HDFAAD9D$ "`n#A9!у`u111fHH A9r!AAA`tH=z> 1E1葹IF8D${AV H HT$|B9D$ E9)փ@`D$|f"f(D9AN AANAF D$| D AF I~8pH臮HIF8T$|4HDFAAD9D$  `#A9 у`u911f.HH A9l AAA`tH=:= 1E1QIF8D${AV HHD$|H9L$ 9(ƃ@`L$|fy(fD:AN AANAF D${@ AF I~8pHGHIF8t T$|4HDFA~AD9D$ `?"A9 4`u911f.HH A943AAA`tH=; 1E1IF8D${AV HHD$|H9L$ #9 'ƃ@`L$|ffD:AV BAVAF p @ AF I~8pHHIF8_T$|4HDFAj AD9D$ ` A9у`u111fHH A9AAA`tH=: 1E1IF8D${AV HHD$|H9L$ h9%ƃ@`L$|ffD:Av FAvAF HeH=9: 1SD${1A"A6AV1틌$9IV,JfH=9 1D${H= 1 H=? 1DմD${1A&xA6AV$9JIVJfE5L$|HHƃ@@4 H= 19D${1|$|1D${A~H9HzH= 1D${1[H= 1֧@ @0E H}8pH?HHE84T$|A4HDVALAE9`A9Aу`u211fHH A9|AAAA`tH=+ 1HE8D${1ҋM H HD$|pA99 Aǃ@`t$|ff)E PEU L1|$||${6MH9H*H=- 1nD${ @ @0E H}8pHכHHE8=T$|A4HDVAAD9-` A9:Aу`u:11f.HH A9AAAA`tH=* 1E1蠥HE8D${M H HD$|p99GAǃ@`t$|ffCD)E PEU +1|$||${MH9H H= 1D${H=) 1HT$XݤHT$XD${ uH=) 1趤D${D @H=\) 1蒤D${1ffH=O 1hD${H= 1HT$XKD${HT$XiH=( |$|1H=( 1D${D${uffD)D${H= 1ΣD${HE811DT$|Hf C AF I~8pHHIF8-T$|4HDVAeAD9T$ `bA9у`u/11ɃHH A9AAA`tH=' 1E1IF8D${AV HHD$|H9L$ v9)4@`k L$|ff D:AN AANAF D${ AF I~8pHHIF8/T$|4HDVAe AD9T$ `A9-у`u/11ɃHH A9AAA`tH=& 1E1赡IF8D${AV HHD$|x9|$ *94`|$|ff D:AF |$|PAFAV ) AF I~8pH诖HIF8T$|4HDVAs AD9T$ `pA9 у`u/11ɃHH A9 AAA`tH=l% 1E1胠IF8D${AV HHD$|H9L$ l 94@`RL$|fqfj D:AN AANAF D${H= 1D${H=$ H=a 1ҟD${H=$ hH== 1讟D${VH=`$ 11蔟D${H=% 1DyDT$|1[H= 1UD${H= 1=mH=# }H= 1D${|$|1H= 11D${?H= 11ߞD${|$|H=# 1D${D|$|1{1|$|1|$|JH=a# 1{D${DHdH=8# 1RD${1D41|$|H=# 1!D${D$|DH=" 1D${1D[H= 1E1ӝD${HE8.1DT$|I9|$ `? 9 у`11ɃHH 9 AAA`t1|$||${ANH9HH= 1D${f D)1|$||${sANH9HH= 1ȜD${1|$||${r ANH9HH=L 1荜D${|$|1|$|1+|$|1HD${"D${D${DT$|E1H= 1D${fifD9fhfD:H= 1ԛD${fEfD:H@Ƅ$f%fD:H=I 1D${gH=1 1gD${MH= 1OD${ffD:EH= 1$D${H= 1 D${H= 1D${H= 1ܚD${H= 1ĚD${H= 1謚D${1|$|11|$|j1|$|1DD$|1D$|H=? 1\D${|$|D gH= 18D${1DH= 1D${H= 1D${L)H= 1ݙD${1DH=I 1躙D${H= 1袙D${|$|D H= 1~D${'H=I 1fD${|$|D AH= 1BD${H=  1*D${1Dt$|9T$|HEH= 11DD$|I|$|ft$l|${qHD$(D|$lHxpA_QH= A1腘D${+f D:f SD:j1DD$|Ip1DD$|IH= 1E1(D${IF8B1DT$|+1DD$|IH= 1E1D${IF8H= 1E1ϗD${IF8H= 1T$`LD$X誗D${1LD$XT$`f  D9Vf KD:f cD:1DD$|IEH=) 1E1?D${IF8H= 1E1 D${IF8Z|$|f|$l=9D$8D$|Hl${Ld$|T$8HHL|${IAw9H= 1訖fDAGAEAG 1DD$|E1DD$|E1fAfD:H= 1FD${ ffD:H= 1D${H= 1D${H= 1D${H= 1ӕD${iffD:3ffD:DD$|E1NH=R 1舕D${.DD$|E11DT$|1{ffD: ffD:DD$|E1 t$|q1|$|D${A~H9HH= 1D${1H= 1ДD${H= H=; 1謔D${KH=# 1蔔D${WH=c 1|D${H=K 1dD${H=3 1LD${ZH= 14D${H= 1D${H= 1D${]H= H=o 1D${H= 01|$|D${RA~H9HLH=V 1藓D${1-H=B H=6 H=* bH= 1TD${H= 1HIF(1H[]A\A]A^A_HHIF0A?HHIF 11A?tIGALT$ K,$B4`$\L!IF0BIGIn B4`fET$ A9r{H-@H=A 1XH[]A\A]A^A_@H=I 12H[]A\A]A^A_fDH=Y 1 H9wvwHGH@pf?w@HG pfvlffHG0HO(H1DH=A 1蒋HH= 1rHfu2HG0HO(1HG0HO(f1D1@HG0HO(1@f.H= H1H@AWAVAUATUSH8H(0L-0IUHH|$011E1D$IH|$L|$$HHD$(HD$-DHtH/8KIUH׉HT$I}LH8T$$tHHT$ہT$A9DLHD$(I}sI,$LI ID$HT$ID$D$$D$ID$jHct$H\$H ՠA DNH H L } H | H5 1APH j DPH j Pj1{HT H0L T H T H5: 1PHT j ADPHT j Pj1={LL$pH0MhfDfMH*xyfI*^HH5 j R1j sAjH DH zLKH0MHSHyHHfHH MH*XyLLfHH H*XoEH- DHH= H1H= 1\H8[]A\A]A^A_f.H0H8AWAV1AUATIUSHLIH IDD$ HGHLJHH)HH/8MA$u3Mu.H= 1A:HĘ D[]A\A]A^A_DH$LL HUHHTH=p HƄ$)DEt*H=[ 1A趆H= 11覆gDŽ$Hڋ H!%t$DHJHD@ǍFHH)ڃDND9`N A$ƒ`uSу`]Sփ@`EDŽ$ ʃEfA$]0H /1It$HIt$HDIt$HHLHIt$HH HHFFuAT$8$I|$HHJ9OH$L|$@Ll$HDt$8AHD$H$EHD$I$HD$(ID$8HD$09E D4D<`A$$AI/H AHcHAuEE`HHE**LL$HL$EHt$(H|$0HHD$ 跮LT$ fA$ A.EEAD$8APA9$DHIl$HJA9H=E 1{Ƅ$H=> 1A{HEEEt$HULD$(HuEHL=A^X$FmIH= D1A*{-DE$4H~- A9= ` 9 `u211@HH 9n AAA`tH=s 1EzƄ$EH=E D1Adzg1AEHEHUHuEt$ELD$(HLAZA[$H= D1Ayf.D$AD$1H> /:H=n ƺ1tHDŽ$]qƄ$;DA;SD$f.D$ 11Dt$(HHHD$D$ HىLDrЉD$HD$ID$@PA9s*4$LLH9HH8sDp PDDt$(9H+ /8j4$LLH߃HHrD$;SD$4$LLH谌{HA0H;NL=0A7}Ml$xMH/8H;FA$ALA_A7H;ALFA$ASA$H=$ 1wADŽ$H=i A1wƄ$H=J 1dwƄ$1fA$H= DE1Az8IL$@D$(DŽ$Cƒ`DŽ$H$I$HEL\$ H|$8HHI|$8H$HT$HIHD$05HT$L\$ fB$H!`T$9!у`u211ɃHH 9U!AAA`tH= 1rƄ$1AD$8$H~9`$9`u211ɃHH 9AAA`tH=" 1ISH9$u:*u5<<:H= 1AT$1H$H= 1AHH TH=n 1TƄ$1Hc|$ L\$@ MHT$HL\$@HBDt$@Lt$E1҉l$HLl$XMՋl$(L|$PLd$(L\$`O|-N$8$4HDNA AD9`;A9#`u211fDHH A9ƒ`tH=m 1SƄ$1fA4$$P9ra9 `u0$t MMFfAID9l$ IFH= 1SƄ$H= 1RƄ$H= 1RƄ$1WH= 1RƄ$1:1D$+D$1$Dt$@l$HLd$(L|$PLl$XL\$`H= 1AZR$ D$H= 1.RƄ$H= 1A RH= 1QƄ$1H= 1QƄ$1H= 1QƄ$=1$H= 1QƄ$H=^ 1wQƄ$14H=$ 1ZQƄ$11$AT$ H=ǟ 1LaH= QAH= 1PƄ$yD$lD$\E xD9:<$DL$YHID$DL$7$A9Fу`uP`uFLǍNH A9ɈWv_Fփ@`u Ή`tH= 1L$PL$Ƅ$LXy$D$u DLeARDLL€:OH= L1L$OH $HXƄ$H= 1}OƄ$$1.HL$0Ht$8DHL\$ $~gHT$L\$ B$H=K 1AO$A$r=$1A$I$D$HHQHI$`H|$@AWD$ H= 1qNƄ$$$AL8D9t$H>.ALLHH HT$xHHL$p+NHL$pu HT$xH=I L1MƄ$H=Y 1MƄ$1$$1H= 1MƄ$1$EH= 1kMƄ$H= 1PMƄ$1EAT$t$ H=ٞ 1 H$H$H<$ HHHʼn$H$8e$H= 1AHLH= L1LLE1UƄ$H= AzL DLH= 1\LƄ$H= 1A;LH|$(L\$ WG G ʉWDHT$HL\$ HB0HL$0Ht$8HDdH|$fG$H= 1AKUH= 1AKH=ʙ 1KƄ$A|$s0H= 1HT$ LD$>HT$ LD$ff.HG(fAWAVAUATUSHHH<$H?KLH{BLH{@HDKv7DHIFL,Au<3HvI}AKI}KE9>wI|$(AD$9wiKI|$0_KI|$8UKH$Hx@H $D$ D$ 9A<2KH$HPHHt>x8v0fHH|Ht KH$HPHH$9X8wHJH$HxPHtHI1HHB@L-S.A}HLHAD$)>L4uTA}u}H<$:H<$DHAH= t;H= 1\;:H= H1?;lH= 16WH= 1 6p@AWAVAUATUSHhDNEu)Hj.81Hh[]A\A]A^A_LJHH~IA,AAH HcHfDAfH.8H$~H= 1L5kA.H.8H$FH= 153H.AH$H$8@H= 1 9AdžHNgHH/g)L$ Af.H$8Jt$ H=p 1D010>H=Q 14DH= 1/H H5 H= 14D@3H H5 H= H1q4{hwD$ DAu1҅t(fDIMHHH@hA9UwH$8(H= 1.AH=X 1.rAw0H= 1AGh:7H=̪ 13H=T 1.DD$ H H H5 H= EHD1Y.H=} 1V3H= 13.qAuH= 1.:D$ {hD$ pUSHHH1HHGHLJH1H)HHH-.8uǃH[]DH{H H5ֺ H=~ HE1c-1yfHwHHF8FPG8HG8HGx1HAWAVAUATMUSHIIHHHXDHs.8BLHG7HEHEpHHE`AFD$D$(D$LtIPHD$HD$8HD$MHuXHH.8LAD$2 HDKHI9HHIPLfDU8u AD$ t~1fDID$8H=n ރDmH Љ1DIA9\$ wH= 3H=ԡ D1HH=Ϡ []A\A] @H= 1ADATUSHHDA3wqDO H /DIHHLH 1DA1RHŭ H=ͭ L1L3AXAY3-H HcHW H=- Dƍэf )1H[]A\DKSH=p s1KSH=A s1KSH=h s1KSH=, s1qs@KSH= s1QS@H= 1:<DSsH= 1SsH= 1SsH=| 1HKSH=Ĭ s1KSH= s1@KSH=k s1y{@KSH=> s1Y[@KSH=ګ s19;@KSH= s1@KSH= s1 @KSH=` sDC1 SsH=4 1 HM K ;L.HcHHAT H=* HcHDS sH=1 11Q C"u&$@H=! 12 C"9HS94uH=Ȫ 1 H=V 1 EfKSH= sDC1 KSH=h s1 @KSH=8 s1 @SsH=M 1l nSsH= 1L NH= 12 4DKSH= s1 @sH=\ 1 fKSH=$ sDC1 KSH= sDC1 KSH= sDC1 KSH=n sDC1u wsH= 1_ E]fDsH= 1> E<DKSH=W s1 EfDHKSH= s1 HKSH= s1 KSH=d s1 @KSH=Z s1 @H=X 1z |DSsH=% 1\ ^KSH= s19 ;@KSH= s1 @K H= ʍf )1 HSsHz WzWDJH=Y DI1 AZA[HSsHSzWDJH=̨ DI1 ]A\HSHsH= DJDI1U WHsH=Y I17 9HSsHWzWz WzWDJH= DI1 H HSHsH= DI1HSHsH=ǧ DI1HSHsH= DJDI1HSHsH= DJDI1acHSsHWzWDJH= DI13AXAY1f.) H=R 1H= 1fDAUATUSHW<9HHG@H= L$1AT$H= H= AD$D$ tiLl$ 111fDH=J 1`LHID$0H< < A9\$v;l$ t % l$ DH= L H[]A\A]ÐH=A 1H[]A\A]f@vZfDwfDATUS߃EHcHH.r9v<u/HC8C[]A\f.GfD1@CtHk1LdE}HcL9uAWAVIAUATUSHHHF(H|$Ht$HDŽ$HDŽ$HD$H HDŽ$HDŽ$HDŽ$D(IDl$0H'.AILHT$8HL$@IOAHH$HDDHDxH.8HIL9AFHD$tA~ HAEVAED;$vH$DDT$ HHIt$D1L\$(H)HHI<L\$(D$DT$ L$"fL|$8Hl$@D$0DD9$HD$LD$0-HH$MDL XH.8`H$1L-̬ E1HD$H4ׂCE1D$PHD$8D$@iHH$HHHH?HH)HH$Hi@BHD$(H$H)HL$HHD$0DU B<IcDL@H=ɧ DDH1@H$DHdHI$D1H)HHI<L$D$T$@LH$HD$8HLxDpLXhL YG$LGLL$8HMHIHM9hH)Ht$8H= I1L\$?L\$MwID$ HD$AOD9L$ ML\$8h$H$rT$PIHFHL\$8hT$PHL$H$D$AI HHHL$ HI l$@Lt$PHICLd$8DeE1HHh(E9#EDYщ i҈9H|$01L\$ I%HD$(H;$|L\$ HD$HH;$H=ѥ 1MH-.}jH$AHH$HH$;fDt$@4H$HD$8HLxDpLXhL G$LGLL$8HMHIHM9gH)Ht$8H=w I1L\$'L\$MyvID$ HD$AOD9L$ ML\$8P$H$rT$PIH.HL\$8fT$PHt$H$D$AI HHH0L$ HE,PA9Wv~NfDH[]A\A]A^A_H=w Af 1)H-#.H$Iǀ}AueHH$pH$HuH$VH$IA5eDLE#PA9W/'Ht$fD$ D$@ H$HD$8HLxDpLXhL ;G$LGLL$8HMHIHM9PH)Ht$8H=P I1L\$L\$MID$ HD$AGD9sAV9gA]|$ HD$DML\$ f<.fDAsH=& DL1 A1LZH$H$H+$H+$}H$H$*Hi@BH= H41 EgPA9WHL$ EqPA9Wh`Ht$9EA9GFHt$E1AH(MEUPA9W Ht$HHD$ DL$@EH$HD$8HLxDpLXhL YG$LGLL$8HMHIHM9uH)Ht$8H=) I1L\$L\$MID$ HD$AGD9LAV9@A6H|$ HD$DML\$ H<$AOH$rL$PT$8IHHL\$ bT$8Ht$H$D$AI HHH0L$PHcEPA9WHL$D$ D\$@EhH$HD$8HLxDpLXhL JG$LGLL$8HMHIHM9H)Ht$8H= I1L\$[L\$MID$ HD$AGD9AV9A|$ HD$DML\$ <^EŗA;GHL$D$ D$@hH$HD$8HLxDpLXhL gG$LGLL$8HMHIHM9:H)Ht$8H= I1L\$[L\$M4ID$ HD$E9w|$ HD$DML\$ @<uEA;GHt$T$@D$ |H$HD$8HLxDpLXhL nG$LGLL$8HMHIHM9H)Ht$8H= I1L\$oL\$MID$ HD$E9wL$ HD$ML\$ B 0}UH HcH}UHݤ HcH}~UHӤ HcH}`UHɤ HcHEAfA;G0DE1E1IM_(IkEqA;GHt$EpA;GHL$1‹EA9GHt$E1EqA;GHL$ UA;WHD$1ȋUA9WsHt$E1+EoPA9WKCHL$HEoHA9O"Ht$HH ‹EHA9OHt$E1HEPA9WHL$EJHA9OHt$ ‹EHA9O{Ht$E13}aUHޢ HcH}CUHԢ HcH}%UHʢ HcH}UH HcHEPA9WHt$EHHA9OHL$1‹EHA9OHt$E1AEPA9WaYHt$HEjHA9O80HL$HH1‹EHA9O Ht$E1HEPA9WHt$EcHA9OHL$1‹EHA9OHt$E1fFEHt$\UfA;WANEPA9W80Ht$EkHA9OHL$!‹EHA9OHt$E1}UH HcH}UH HcHEPA9WzHL$E)HA9OYQHt$ ‹EHA9O6.Ht$E1f}UH HcH}UH HcHEPA9WHt$HE}HA9OHL$H EH9~cH.A84H=͗ 1L\$ AL\$ E\~A;G3Ht$E~A;GHL$!‹EA9GHt$E1EPA9WHt$EHA9OHL$!‹EHA9OHt$E1f8EA;G[Ht$E'A;G=HL$ f;E_H.A8H=o 1L\$ L\$ fEЃPA9WHt$HE3HA9OHL$H EH9DbH.A8;H= 1L\$ HL\$ fD}FUHc HcHEژPA9WHt$H EPA9WHt$E1H E8A;GHt$EA9GHt$E1jHt$U ;V<HF@HL4E"A8wANH$Uq2HDFUDHB UAB $f|f$HHHLHɉpUHD$8Hq(LYLyQDaHq HAV AFL\$8HL$ <H)H<Iv8|$@'HL$ L\$8HQ 8A>PE111LL$lfSfu@H}B<DWE9WZ@PM9A;F<ǃL:A>HIH9֡H}1fUJA9OHL$E1fE'EA;GHt$EDA;GHL$ 8‹UA9WHL$E1NEqPA9WnfHL$ EcPA9WF>Ht$9EA9G$Ht$E1ErA;GHL$EglA;GHt$8‹EA9GHt$E1~EQA;GHL$‹EKA;G~Ht$8‹EA9G`Ht$E1E^PA9W80HL$HHЉH H{9$mHHH$p9A9HڧED|A;GHt$E1bEEPA9WzHL$HHЉH H@y9$cHHH$p`9XA9HEzA;GHt$E1E]vA;GHL$‹EgA;GHt$8‹EA9GHt$E1CEpoPA9Wc[Ht$E*_HA9O;3HL$ E9:Hi.A8H=*l 1L\$ L\$ @EUCPA9WHt$EBHA9OHL$ f;Mf6Hh.A8>H=k 1L\$ KL\$ !ESA;GCHL$EA9G-Ht$E1E!FA;GHt$U>DA;WHL$‹UA9WHt$E1EiqPA9WHL$ E^oPA9WxHt$f9EA9G\Ht$E1EKA;G7HL$EGA;GHt$8‹EA9GHt$E1EtPA9WHL$UiJA9OHt$ 41EHA9OyHL$E11EJPA9WQIHL$H E:GPA9W( Ht$HH9EA9GHt$E1E9PA9WHt$HcE@2%A;GHL$H<E@u7%A;GHL$H4DuL\$ AFA9GhA^Ht$L\$ B6E1 EJA;G.HL$EA;G2HL$ E=A;GHt$4EA9GDHt$E1 EKA;GHL$E:EHA9OHt$4EmHHA9OHL$ ExA9f^EHt$E1f EAPA9W0(HL$HE?HA9OHt$HH‹EHA9OHt$E1HE;fPA9WHL$H E UPA9WHt$HH9EA9GeHt$E1EHPA9W=5HL$ ECPA9W Ht$9EA9GHt$E1EOhPA9W˿ÿHL$HM]QA9WHt$H H231HUJA9OriHL$E1H ElPA9W@8HL$M3TQA9WHt$ /1UJA9OHL$E1EGA;GHL$EBA;GHt$8‹EA9GHt$E1;PA9WHL$HHЉH Hn9$HHH$p9A9HJEoHA9O Ht$fE1鸿E3PA9WؼмHt$HEHA9OHL$HE1HcE@>$HL$P%H H E@V&HT$P%H H ЋUrA9wMDHH)H H 9Ht$@EE1EfePA9WHt$HEuWHA9O׻ϻHL$H EH9.H"^.A8kH=` 1L\$ xL\$ NfDEfPA9Wh`Ht$E]HA9O@8HL$ E9,H].A8ֽH=_ 1L\$ L\$ 鹽fE$DPA9WкȺHL$ EQ=PA9WHt$9EA9GHt$E1>EePA9W^VHL$EZHA9O5-Ht$)‹EHA9O Ht$E1fE+:A;GHL$E8A;GƹHt$)‹EA9GHt$E1fEZPA9W~HL$ ETPA9W^VHt$9EA9GPA9WHt$f9EA9GǸHt$E1ECcA;GHt$E0A;GHL$3%EA9GfHL$E1EThPA9W;3Ht$HEaHA9O HL$HHЋEHA9OHt$E1H霺EKAA;GHL$‹EP=A;GHt$8‹EA9G~Ht$E16EaTHA9OVNHL$D4EMʍf 8%EPA9W DuHT$PHL$H L E1H鰹E5HA9OжȶHL$D4E"ʍf 8"HY.8EDuPA9WvnDuHT$PH|$H I L4E1EPA;G8HL$‹E3PA;GHt$8‹EA9GHt$E1鯸E>PA9WϵǵHL$H E:PA9WHt$HH9EA9GHt$E1:EOA;G]Ht$EHA;G?HL$ ™EA9GHL$E1ӷE.A;GE.A;GHL$!EA9GôHL$E1zE=A;GHL$Ej6A;G|Ht$ E?A;G^Ht$4EA9GHHD$EE1@0ETPA9W HL$EHA9OHt$E1飶E=PA9WóHL$ E7PA9WHt$f9EA9GvHt$E1.Eu=A;GQHL$ Uy8A;W0HD$UA9WHt$E1̵EA=PA9WHt$EHA9O˲òHL$fE1fvEYPA9WHL$ERHA9OnfHt$)‹EHA9OLDHt$E1EuPA9WHL$UA9WHt$E1鶴EyPA9WֱαHt$UA9WHt$E1pEPA9WHL$H@+MHHUA9WcHt$E1E}PA9W;3Ht$UJA9OHt$E1ʳE7}PA9WHL$H@+MHHUA9WHt$E1uE|PA9WHL$UJA9OulHt$E1$EtPA9WD5Ht$H4HAH Hx9$HcHH$DQE9bD9YAAE9H1RAI wDAE9GLD$EAIyDIE9O{rLL$M LEH Hw9$߀HcHH$DqE9vE9mEE9VEL LHL <.L\$ D H|$AUJA9OҟɟH|$E1L\$ |HMFyrA9wHt$4QxDBE9GofLD$AIwDAE9GD;LD$A HLo;.L\$ D H|$AUJA9OH|$E1L\$ 鮡LEA|JA9OʞHL$4AP5|JA9OHL$ L$ HL\$hT$ L H:.H|$HHD$`L\$h'|$DpD$hD9wzD$hH|$`HH$H8|$ xH@.8}MI EPA9WH|$E1L騠HL\$ T Hs:.H|$ЋUJA9OHL$E1L\$ ]HUzJA9OzqHL$4t$ HL\$ht$ T H\:.H|$HHD$`L\$hoz$DpD$hD9yD$hH|$`HH$H8|$ xHc?.85{MI EPA9WӜ˜HL$E1L邟HUxJA9OHL$4HL\$ T H9.H|$ЋUJA9OaXH|$E1L\$  LMAQqJA9O&Ht$A qqA9wHt$H4HAH H|p9$|HcHH$DQE9|D9|AAE9SH1Ht$ 0|AIpDAE9GaXHt$ EA ENqEPE9W5A+Ht$FEIEpEQE9WAHt$F HL7.L\$`D Ht$ H|$A‹UJA9OH|$E1L\$`kH}B<DWE9W@E9A;FlǃD:.H}B<DWE9WH@>E9A;F)ǃfD:1H9"M@T)Ɖwf$GL\$HH$迴L\$E1~HD$H5A H}\H$H DF$H=? 1L\$ ɮL\$ HD$8AH9P@T)Ɖwf$O_L\$HH$L\$@TQPA9WݘHL$HH‰H HxhW9$rHcHH$re9eA9@H=A*f.UQPA9W:2H|$H mRPA9WHL$HPPA9WܗH|$HH‰H HwT9$_tHcHH$r99e0eA9?HA)fMRPA9WC;H|$HH‰H H}wT9$\rHcHH$r9``A9H+A鉙f$MPA9WHt$HH‰H HvS9$qHcHH$r9 ccA9HAfUPA9WHt$H@THA9OؕЕH|$H Hȉ׉H HvS9$kHHH$D@D9AYD98YAA90HHAH7.A8H=9 1L\$ L\$ ݗ1ɉЋUA9WHL$E1鷗HX7.A8H=j9 1L\$ 计L\$ 鄗SHA9OHL$H Hȉ׉H HqttS9$nHHH$D@D9bD9aAA9HHAfD1‹UA9WHL$E1鼖H]6.84nʍf 8>EPPA9WHL$HEHAH!HHЋUJA9OulH|$E1H#H5.86]AH5.A8H=7 1L\$ L\$ Օ1‹UA9WHL$E1鱕HR5.8\A閕1ɉЋUA9WHL$E1pH5.A8ZH=6 1L\$ gL\$ =H4.A8'H=7 1L\$ 4L\$ nRPA9W-%Ht$HHЉωH H sQ9$pfHHH$D@D9YD9YAA9HH8~Al@1ɋEA9GHL$E1G1ɉЋUA9WiHL$E1!H3.A8 H=5 1L\$ L\$ EOPA9WHt$HMAqA9wH|$HE1HH钓[PHA9OHt$H HȉH Ho[O9$jHHH$x9Z9ZA9HHAf.1‹UJA9OHL$E1f鿒H`2.A8H=J4 1L\$ 趜L\$ 錒1ɋEHA9OHL$E1`H2.A8JH=;4 1L\$ WL\$ -1‹UJA9ONEHL$E1fHHEHA9OHL$E1HΑ1ɋEHHA9OHL$E1H頑HA1.A8H={3 1L\$ 藛L\$ m1ɉЋUJA9OHL$E1>HHUJA9OaXHL$E1H1HЋUHJA9O/&HL$E1HݐH~0.A8ǐH=2 1L\$ ԚL\$ 骐HK0.A8H=]2 1L\$ 衚L\$ w1ɋEHA9OHL$E1fJH/.A84H=1 1L\$ AL\$ H/.A8H=1 1L\$ L\$ H/.A8ΏH=1 1L\$ ۙL\$ 鱏1HЋUHJA9OьȌHL$E1HH /.A8iH= 1 1L\$ vL\$ L1ɉЋUJA9OneHL$E1H..A8H=0 1L\$ L\$ WIHA9O Ht$H4HH Hk[L9$FbHHH$D@D9eD9eAA9gH0AQIHA9OskHL$H4HAЉH HkK9$~fHHH$DHE9gD9gDAA9ɍH0ԹA鳍HD$H@(HD$JHA9OHt$H4HAЉH HekuK9$aHHH$DHD9^E9^DAA9H0AHD$H@(HD$~ZCHt$J9HHcH|$r9ljH$?Ht$J9HHr3ELL$yA9NFIH =H|$r9 Hҋ顦AHt$J9׈ψHHJ@Ht$J9HH +DH|$q9_WHɋF>Ht$J9$HHALL$yA9߇Iɋ 駨%HL$;H%AH|$q9~vHHSvAHt$J9B:HH%DAHL$; H%>HL$;ކHΎH9H@T)Ɖwf$DGE/HL\$H$vL\$сH|$q9ZQH Ų%KHL$;#H9%HL$;%5HL$;̅H  %?Ht$;H龺с˥H|$q9jaHH zx?HL$;2He%X?HL$;H%Ht$;քH ";H|$q9Hɋ@>Ht$J9g_Hҋݥ%<HL$;2H`%<Ht$;H4H|$q9ЃȃH  %W<HL$;H _4<Ht$J9f^H鍼%7HL$;0H7Ht$J9HHvn7Ht$J9HH5h7H|$q9|HH6Ht$J9H@HH6H|$q9 H%P6H|$q9ЁȁHH66HL$;H馻;6H|$q9e]HHU%5Ht$;/H`5H|$q9HD4"X5Ht$J9HH鑕R5Ht$J9{Hs4Ht$J9G?HH04Ht$J9 HHҾ%4HL$;HĹ%5HL$;H%,5HL$;yHdS4H|$r9E=HHE%Ht$;H x%$4HL$;~H G4H|$r9~~HH飪q3H|$r9q~i~Hҋ顬@4H|$r96~.~HH.%{3HL$;~H {%3HL$;}H'%2HL$;}H%3HL$;v}H2H|$r9B}:}Hҋ%2HL$; }H1H|$r9||HH騸2Ht$J9||HH l1H|$q9a|Y|H4騺1H|$r9%||Hҋ% 1HL$;{HH%1HL$;{H驸0H|$r9{{H0Ht$J9R{J{HH N0Ht$J9{{Hҋ 0H|$r9zzHH,-0HD$;zHkP0H|$r9pzhzH|%L/HL$;:zH%R0HL$; zHW3/Ht$J9yyHҋ q%O/HL$;yHc.Ht$J9oygyHH %+/HL$;9yH鈩n.LL$yA9yxI t%.HL$;xH閛-Ht$J9xxHH q%.HL$;dxH-%-HL$;6xHN%-HL$;xH?%-HL$;wH0-Ht$J9wwHH %,HL$;pwH-Ht$J9iHɋrF"Ht$J9 iiHҋ5r$Ht$J9hhHHk#H|$q9hhHv%$HL$;^hHv%"HL$;0hHWH|$q9ggHɋ 鸠%Ht$;gH &%Ht$;gH ޤH9**@T)Ɖwf$DWEhlHL\$H$1L\$Il%"Ht$;gHB%!HL$;fH~H|$q9ffH ,H|$q9}fufH uRH|$r9Af9fHҋсH|$q9feHɋ ޖ%HL$;eH鲯%!HL$;eHa%HL$;teH%HL$;FeH %HL$;eH?%HL$;dH钗H|$r9ddHҋO%Ht$;dHtxH|$q9MdEdHH mHD$;dH颌: H|$r9ccHҋqfсH|$q9ccHH %z%HL$;pcH R%WHL$;BcH%HL$;cHdH|$q9bbHD4遫%<HL$;bHD$ hʁ1H|$r9rbibHH Ǣ:H|$r95b-bHHiHt$J9aaHH 鰈H|$r9aaH鄉%HL$;aH  %HL$;YaH @1H|$r9%aaHHt$J9``H 鮔jH|$r9``H鳐Ht$;v`HH|$q9B`:`HkH|$q9`_Hȥ%HL$;_HH|$q9__Hɋ%XHt$J9a_Y_HҋCHt$J9&__HH鴄%HL$;^H1Ht$J9^^Hҋ -Ht$J9^y^HҋD$ b%HL$;H^HQ{H|$r9^ ^HҋhHt$J9]]Hv H|$q9]]Hɋ T%HL$;h]H~Ht$J94],]Hҋ%HL$;\HL$H[Ht$J9\\HguHt$J9\\Hҋ鑋=Ht$J9O\G\Hҋ yHt$J9\ \Hҋ {^H|$r9[[HҋnvH|$q9[[Hɋ 5u%FHL$;i[H%HL$;;[HzсH|$q9[ZHɋ PH|$q9ZZHɋ4c{%HL$;ZH {Ht$J9bZZZHH 駙%HL$;,ZH}SH|$r9YYH~Ht$J9YYH }%Ht$J9YxYHҋʁwH|$r9EYy%HL$;{UHll%HL$;MUH颜'Ht$J9UUHҋnJH|$r9TTHHȆHt$J9TTH;HHt$J9fT^THҋHt$J9+T#TH y\Ht$J9SSH 6~ʁkH|$r9SSHH k Ht$J9vSnSH%\ HL$;@SH~%< HL$;SHDHt$J9RRHH qUHt$J9RRH  Ht$J9fR^RHҋHt$J9+R#RH y%HL$;QHkHt$J9QQHH 邃%W HL$;QHT~% HL$;]QH鈉 Ht$J9)Q!QHH~g% HL$;PH!y Ht$J9PPHҋ% HL$;PH x%RgHL$;AgWP% HL$;4PHr% HL$;PHtts Ht$J9OOHH鎗 Ht$J9OOHҋ v Ht$J9[OSOHҋ i% HL$;&OHtu Ht$J9NNHҋ*f%HL$;NHv9${$HHH$N9$o$HHH$H=@ 1L\$`HL$ HT$AcHL$ L\$`HL$8P9$$HHH$9$(HHH$%} LL$pA9MMI4i9$(HHH$ls H|$q9lMdMHHs H|$q90M(MH% HL$;LHH= 1L\$=bL\$IH= 1L\$ bL\$IE H|$q9LLHɋ鶎%Y HL$;WLH顃$H$HL$ HT$E~uIH`HHT$HL$ ] H$D$HHHDxDH fA~KM^(H D$@HD$PMHT$HL$8E1IkIAcN1J1v1ɑACN1``1錅1ivA#NE1靔1-1xm1Hm1A111>`1h1y16s1Vy11p1e1[1o1n1霆1x161^171!1du1А1.1111]1Z1Ƌ1v1Sv1U101Tm1*m1D11~1}~1S1f1a1yz1r1T1s1>1`1<1†1ن11Qz1Ȑ1!h1u1nV1fk1W1i1]1g1-^6 Ht$J9jIbIHH龲HD$H@(HD$LH= 1L\$^L\$fH1߂1]1鶔1n^1S1U1LS1Oa1S1cHD$H@(HD$O11M\HD$ K1^1f1W1[1<[1\1P1#S1P1N1d1-VH= 1L\$]L\$G1 T1tU1]1$^1[1P1黎18{1fQ1{1`{# Ht$J9GGHHޯHD$H@(HD$M Ht$J9|GtGHH鎮1锊1I1$1j1退4Ht$J9GGHH 释1|1p1dr1|1$t15s1P1Q1W1t11x1Q1xD$ K1ey121鸃D$ L1T1ƅ1lAI1'g1`1駍1-111ӊ1]`1e11f1m1 z1z1UHD$H@(HD$`G1N1M1N1 g1z1f1>gHt$J9EEHHu1w1r1x1n1pu1v1i1l1m1p1m1b1x}1'i1g1hSXHt$J9DDHH镭1H1je1h1_1u1nk1f1a1g11_1a1B1Z1[AG1|1!1q1~1j1W1Bs13w1y1w1q1]1^1zHD$H@(HD$I1aE1铌1fD$ D11]F1{1O1n1F1j1-1+g1k1$R1'k11i1Qs1b1k1 u1O1g1%\1܈1ptcHt$J9CBHHF9$HcHH$'ELD$qA9BBIH4銶9$HcHH$@LD$qA9@B8BIH4Ķ9$HcHH$Ht$J9AAHHʰ9$HHH$H|$q9A{AHH 颫1ty1S]1闃9$tHcHH$锨9$"HHH$顰1dx9$HHH$鈬H|$q9@@HH H|$r9@@HH1l-H|$q9E@=@HH 釯9$HHH$%LL$qA9??IH4H|$r9??HHt1e9$HHH$顳9$HHH$H=F 1L\$ ATL\$ A9$ HHH$釴1zH= 1L\$KTL\$CH= 1L\$.TL\$DAyA1 H= 1L\$SL\$?H=f 1L\$SL\$?A-AH= 1L\$SL\$AAAA@H= 1L\$SL\$AA@11mA@A@A@A@A@1aA{@Ap@Ae@AZ@AO@AD@H=U 1L\$RL\$qCA@H=- 1L\$RL\$IBA?A?A?H= 1IhH= 1L\$XRL\$CH= 1L\$;RL\$CA?t-Ht$J9<t.Ht$J9<14Ht$J91%1fHt$J9v1n1H酅Ht$J9:1-1D1Ht$J910%JHL$;0H%HL$;0HrHt$J9z0r0H5%WHL$;D0H'~Ht$J900%HL$;/H %^HL$;/HHt$J9/ju/DyHt$J9N/KA/fHt$J9//HH%%?HL$;.HHO}3Ht$J9..fD%HL$;|.H|4Ht$J9H.;.%HL$;.HHt$J9--Hҋ %8HL$;-H}Ht$J9-w-Hҋ~~Ht$J9D-<-H~%oHL$;-HԀ%HL$;,H%(HL$;,H%2HL$;,HH{%HL$;U,H}7Ht$J9!, ,@%tuHL$;+H,Ht$J9++111}11ӃAJ.A?.131|AA1Lt$EPE9C+:+IEB ׏9$ HcHH$J1,z΁GLT$DFE9**IH41̎сLD$qA9**Iɋ ^EAHt$ErD9J*A@*LEG 9D1юA,A,A,A,EAt@Ht$ErD9)A)LEG锎fD1锍E1A^,E1階AK,A@,A5,A*,1A~1AALT$EHE9.)%)IEB Bf.9$HcHH$鶆AALt$EPE9((IEF΁yLL$DFE9|(s(IH41f9$KHcHH$1^9$HcHH$΁MLT$DFE9''IH41順@сLL$qA9''Iɋ AAXLT$EHE9b'Y'IEB fDE1飆сLD$qA9' 'Iɋ 饅AALt$EQE9&&IEN MfDAm)AALT$EHE9&v&IEBցthLL$DFE9@&7&I42鞆fD1A(1鱄1o1霆A(1_A(A(A(A(Ax(H= D1L\$ 2U L\$ nAI(1 xA7(с+LL$DAE9K%B%Iɋ =fA'1{15~A'1sH= L\$ O:L\$ 運A'1~1uA'Av'Ak'A`'сtvLL$DAE9x$o$Iɋ TfDсt=LL$qA99$0$Iɋ4 11րс(LL$qA9##Iɋ4 ?DH$DL\$pHw8HHL\$pn$D1L\$xHL$p)HHH$HL$pD$L\$xH$A&A &A%1;H$DL\$pH7HHL\$ptG$D1L\$xHL$p)HHH#HL$pD$L\$xH$驅E1ׅсLL$qA9""Iɋ4 t$ сLL$DAE9T"K"Iɋ L$ 髃fDE1сtCLL$qA9 ""Iɋ4 6D$ v11?D$ 5A}$Ht$`H= D1L\$h.L\$h餄AK$9$vYHcHH$]A!$Ɓt;LL$DFE99!1!IH0A#A#A#A#A#A#A#A#A#Ay#An#Ac#AX#AM#AB#A7#A,#A!#Ht$`H=K D1L\$h$-L\$h"A"A"A"A"1H=-H|1|A"A"A"A"A"Av"Ak"A`"AU"AJ"A?"A4"A)"A"A"A"A!A!A!A!A!A!A!A!A!D7@t.SH@@xH=H O.Ht_H3@u[AWAVE1AUATIUS1HXHD$@D$D$D$HD$DIFhHHXPH9s,H)1HwEHHHP`HtH|$ HH6D$D$HX[]A\A]A^A_fHHP`HtHHHLeLHL$(HHf@HT$ HL$0fD$8u>EH-D$8yH= 1o*ff.E1fqBHӿ-8SD$4fH-E\$6T$8ff ӄjjADL$$Ht$E1LLLZYED$&ff%f=H&-8tDcLD@EtfIFhADFHHhPI9}EtI9cDL)DD$H9LHHF1HP`H:HT$HDD$HrH1@t @t fH@tA9H|$A@DDD$LD@H-DD$_Ht$H=J DDD9vFڃD)HE+\$6T$8 ӄ6H= 1%(!HfqpH-A8D$H= D$1'1ff%f=H= E11LLD$IFhE1LLHH8D$AF2 tUD$AF2 t9D$b@Ht$H= 1'H-DD$zfDH=q 1&HDHY-8uD$H= 1&f.AWAVIAUATUS1HL|$PHl$DD$,D$$D$IG;D$(HD$HD$@HD$DIFhHL`PL9s,I)1IKwMLHHP`HtH|$PLH1T$,D$$Hĸ[]A\A]A^A_f.LHHP`HtHHHLkLLHL$XHHHT$PHL$`HHHL$hHH HL$pHH(HL$xHH0H$HH8H$HH@@HH$$u D$GH=; LL%-A<$BHt$H,HT$H5(F1HD$JM$D$@IVhLIZPI9=ALDFL)LEDD$ I9LL$IF1HAR`H~H$HLL$DD$ HrH1t t  f Ht  A9#A@HDD$ HT$K\ ƄHA<$HT$DD$ H= HָED$D$D$@A9sD)HIwA HT+HT$!HϪ-8>H= 10+D$h9)f.MFPL9S I)I/1L|$0LLD$LAV`HyLD$H$HL \f.H!-8H=y 1D$PHMFP I9 I)I7Q 1L|$0LLD$LAV`HtLD$H$HLH-8 H|$!H:AG0@*H5L|fDD$P$@LL$(1ɺ@LAV`HLL$( HEMyHH$HPH$HPH$HPH$HP H$HP(H$HP0H@8H$H$$H|$ H$L$(L$(D$HuHZ-8l u1HH1-8H= 1DH|$H4D$(H HHD$ MfDL$MVPttM9M)IO1L|$0LLT$LLAV`HtLT$H$`HLH-8H= 1DM9_M)ICB1L|$0LLT$LLAV`HtLT$H$HL|f.1ɺPLLAV`HHHH ALP(H|$IPEH$`HPH$L$H$hHPH$pHPH$xHP0H$HP8H$HP@H@HH$H$KH<"HIHH!L!HHHHH!H HL!H8H( L HH8L!Љ$HM! Ƌ$I( D ȉwG1҉$)1ֺw Ht$8H|$ D$Hu.H~-:HL$KLHϛ-8HH[]A\A]A^A_f.Dd$D$AfA&Dd$A H}-8EHSPHvCAL)1HILHS`HtH|$ LHH-8AF0@7H5xLDfDDd$D$&fDH= 1"1f8H=8 1LHS`H1HIHT$ HP@HT$(D$0D$t]L$(D|$,AωL$(H -D|$,8uJE1DLHA9HSPL9L$(D|$,DH=W 1DL$ H-L$ 8tH=I 1Hz-L$ 8kH=> D1L$ QH=D D1DH=Q 1f.AWAVAUATUSHHu-H-1ۀ8H[]A\A]A^A_f.HGhIIHջL(HG Hx ~HHD$tHǺ1B0ADA] LLH9HG1HAU`HHD IH)uHA-;11D HtNLDDIIG @(H|$xH= 1ZD;tH= 1=H- 8tH=ެ 1ufDH\$H= 1HH߻ mH|$V E=Ht$H=~ 1Df.AWAVAUATIUSHHAHGhHHD$H-8HD$1ɺ HHP`HP P P P P PT$$D$H$HL98HD$H9Lt$(H)M)I9Hj-8HD$(tD$jE1jH|$HHLAhAXAY3H5J LJ3H)D$fuzMeH5â LH|$8HD$(8HD$ H\$PL$HD$8f.l$ H= H1IG0LHH)I+w@LLAWxLd$ H|$HLI?tAHD$HHtHD$@ADHx[]A\A]A^A_DH= 1Ht$0 L@HH@HL$H=PA}EH$H4I9+H5~ gt$DHL$t.HD$H8HP1H9B9uD$DH|$HHL$H4@IHcHHD$H HD$(HL$8 D$DH|$HDl$DH@HljHL$ HXHHL$D@HD$@2 %D$@@T$DH|$8H-8HD$E1H|$8t*HD$8HT$PHt$8H|$aAL$D 1Dd$DLt$HLl$L|$)DHUHuLA9A?H@I,t̋uH= 1s빐L)AGl@Ht$ H=| IMHL1Ah@E1hH|$8H|$PHD$HT$PHt$8H@hL(LAU`HHD$ HD$ IU0p HHHIE`H)I+u@JLHH1-HHD$i8HD$ 8ISc(^IE0H HL$ H)HI+E@LHAUx] E(D$`IE0\$0],H\$(H)źJLHI+u@AUxt$`H$AL$D$DŽ$MHD$XH$Dt$dH$@t$(WHt$8LAW`HH@>L$0HU"]:D$pMH\$MMHt$L9Ht.1HIE0HHHtlHH)HI+E@LHAUxM9Ltm1HIE0HHHtGLH)HI+E@LAHAUxH|$hMD$dHHD$AML)H)AMLL)H)AHD$L|$pHl$xH$L$8ZH=1 1GHD$L|$pHl$xH$L$8H= 1HD$L|$pHl$xH$L$8H=_ 1`HD$L|$pHl$xH$L$8H= 1%H\$H\$hH= 1M MMHHH$H$MH\$MMH= MH\$MM8BHt$hH= 1x*H|$hu+RHD$8H= 1? H|$hMH\$M M%PHx(9v HHtHcHHH@HH5t -T1HfDHAy-8u1ÐH= H11HDAUATUSHHLHuIH@Ht'HDI$H1H[]A\A]H1RDf. u ﾸxV4u fUf. UUEff.AVAUATUSHGHHH6` AIHhPHw@H9H9wxH)HcHH9HF1HP`Ht[HHL=AtVHS@HHcSHDLXHk@[D]A\A]A^Af.Hqw-8u,H X[D]A\A]A^E1H= D1DH= 1A HH5= Q_HH5 AQA@USHHHHr1udG8H9}1Hv-8H[]DHcHx׋E8H9|HHھRH]@H[]HH5 QH6v-8tH=" 1fHcH_@U8H= 1HlVHu-8uHH5- P-H= 1+fUSHHHHHHھVHwu-8u H1[]ÐH=ޔ H1H1[]fDSHHiQH*u-8u 1[fH)u-H5o [H81UDHwX1fAUATUSHHHtHGHHtHHPPHw@H9r%HH5@ OH[]A\A]fH)HH IԺ LG1LP`HIt"1HDHjHt HC@D)@HIt-8uHUH=Ɠ 1@AVAUATUSHHĀLzGMt9LH/%t0h$?hw[1]A\f.H0댋hw1fATAUHSHtv'0H@HtHt DHH[1]A\fhw1fUSHHHtv0HHHtHHH1[]USHHDG8HHL$ D$ PDËD$ tH.o-8u H[]H=a 1@f.AWAVAUATUSHHXHGHHt$@L$HHHD$(HC@HD$+zAՉ|$L H¾AE)JHH\$@D HOHD$PHD$8HHHD$f.t$L$H99ȉ) H|$(HL$0HWPH9HHt$0H9H)H9HF1HD$ HHHD$(HP`HH|$8HH#A9HD$@HtzAD AċL$LLt$8D$HD$ A9ʼnHL$v2HfDL`HT$Ht$LLL))t~A9wMt$ALHHu|$ |$fHX[]A\A]A^A_fH|$(D$HWPHD$0H9tɸHHD$0+D$8f.HT$ H|$8A=HuӋ|$ |$KHl-8uHH5n LGWH=ۏ 1fSHGHHtt[HHPHH1l-H8uHH5 F[H= 1yATUSHHHtqHHAHHHCHH;hPs+1ɺHHP`HtH[]A\f.Hk-8u4H[]A\fDHqk-8tH=z 1@H=! 1DUSHHHxHtRHtEH[]fD+HHHxuHj-8u7H1D1fDHHD$DHD$H[]H= 1fHH9v7HHHHHHPHVHPHVHPHV@ F 1ATUHSӍC=_ HI9}G8H9G@D)AtOHcщH9EJ4L9H 2LH9@I9@H9LID)HcH9IcLL9HLH9I9H9H ASHWi-8HH5 D,H)i-8HH5o C1[]A\fDHh-8HH5] CfDHh-8ulHH5O C[]A\Hh-8u_HH5ň YClH= 1=DH=܈ 1H= 1H=_ 1H= 1"f.AVAUAATU SHHqIL%g-A<$ 1HHt .{<11ǃ 0HA<$LMAF4{SHtH[؜[fShHtH[[fS8HtH[鸞[fHHt@ HfHfDUSHHHt{HC9t1H[]Dt.H4HHzHtHH1[]DH|HǃfAVAUATUHSIHt[DkIHDH4@HHt?HDHRHL0D`@@ []A\A]A^øLf.AUATUSH9w8vkDmAHHDH4@HZHtEHDHRHH@D`@ H[]A\A]fSHHu Ht9w/8Ht3H8t5H P)9ѺF[HcHvHHu1[@H{HtHS819s̍ )9 C[Df.ATUASHHHHtu9wEt$ t$ HHt>HEt1D9r,HUHt3EH[]A\H@HcHRH,H1[]A\DH{HuDHG`H[]A\SHHtu9w`HttH8t^H P9vd9r&pP9w(9r$@ @1[fDpʉH9v1[HcHvHX1[f[fHHHtu9w/8Ht3H8t-PH )9ѺCH@HcHvHHu1HfATUASHHHHtu9wEt$ t$ HHt>HFD9r1Et,HUHt#E H[]A\H@HcHRH,H1[]A\DSӉHu Ht9w(9Ht4H8t.X H9sX 1[DHcHvHH 1[Ð[fSHHtu9w"HHt#H;H1[HcHvH[fAWAVIAUATAUSAԉHH,Htu 9DHHIHtDu E9DHsIIHHAIE,IHkI1IxLEhpE`tA@xHII@hH)pHpLtH\-:DH[]A\A]A^A_fHcHRHH@Hi\-8tH= 1IcHRHH1\-8tH=} 1y@H \-8`H= 1eM*H[-8/H= 14H=1 1x[9,vSUSHHHt;HcHHt/Cpt'CttHt"CtCpH[]f.H![-8tHs0H={ 1AWAVAUATUSHJ9,>HH.HcHHCp{tAHspHCAstHHstC HA7KHCS H;H{xt#H Au5H&Z-8Cx1HA{xuDD+SspHD+S stH.AtHAtzAu"HY-8tH=z 1"AHD[]A\A]A^A_HY-8uTDHAǐHaY-8uDCxDHH=) 1DH=z 1HS0HsH=~ 1zH= H@11HAVAUATUASHHHtu9woDWHtrHItquHIHHHDHHD`L(Ht>[]A\A]A^HcHRHHuH!X-8ut[]A\A]A^fDHHtlH@ Hx 跻HHtHtHW-8u:H:lH=} 1yD1HH=x 1Lյf.AVAUATUSL9HHHcHHst}H;twHWsAĉHEItWHtRMt!DH= x E11L踄u,sDHVH;DL[1]A\A]A^D[]A\A]A^f.9|USHHHtzHcHHtn{thHHHt螅uJDžH;HH;H;aCH1[]Ðf.H[]@u fDffɉHH*H*^Y= f^9 f.wX,Hf\xfDSu׸@t [f.ff**yf*Yff.wX,[D\fDu fDfSfɉ**^蔱f*Yff.wXH,[\@f.u fDfSfɉ**^Tf*Yff.wXF,[\8fDu fDfSfɉ**^4f*Yff.wX,[\رfDHAVIAUATUStxHHtpAudDEuWHHH4IDHo4DHDH>Ht2)[]A\A]A^fDIH5pt -[]A\A]A^øH@t$H|$Ht$ T$D$ ZtD$ HÐf.USHcHHHHH9sH DJ HuH9t/<+t<-t'DBt H9v'HKH9t CHոH[]1fDHATUStu[]A\HAHH1"3HR-8tH=Vs HD1bHtuÐH Q-19uÐHHQ-HҾHH@f.HtÐATU1SHH\$HHBHLHDH9ufAԋD$HH$$fH9tXHtffH*A*^f(L$ L$H9fW | Y^ | X $ $u$Yn| H[]A\H,DAVAUATUSt^DuHHAADHHt9DHHDDHǹҌ[]A\A]A^[]A\A]A^fx,9v$HHtHcHHt f.x,9v$HHtHcHHt 野f.x,9v$HHtHcHHt wf.x,9v$HHtHcHHt ׎f.x,9v$HHtHcHHt ׎f.xL9vDUSHHHt5HcHHt)H茎9uHH[]骎f.1Z1[]xH9Hv=HHt1HcHHt%USHӉH蔎p9t1H[]DtHHnHtHH|Hǃ1D+f.]f.H@0DHH@ @Ð>w1f9|SHtL<11XHHSHHHHSP,H=M-ǃ8u61[fH!M-8u^tDHK-8uPǃ[DH=r 1ҵH=r H1>@H=r 1誵USHHGX4tHK-8u]H[]@Ht1>^tdHJ-8upt?DžH[]@H[]fH=Qr 1듻fH=ir H1n@H=Qr 1ڴAWAVEAUATIUSI11H(1E1fDA9sD9sDAA:TA9u D9XA9Ht$HL$D9JHDADBHljEDBDBLA9HL$Ht$r4fD9v&0H4AHcH4wDA<-8uO\DH`&=H1[]A\A]A^A_H=Yh 1躨H=h 1D袨H1DUSHcHHt"tix9wH=-8uiH[]DHHHtH谠¸uH HH[]DH`tf.H=g 1ҧAUATIUSAHHcHt*x9w'H=-8H[]A\A]HHHtH¸uHDHHD9H}ALcHLLCD%HC[]A\A]@HpUlAT$HLHc}IcADHD[]A\A]fDH=g 1貦&f.USHcHHt"tAx9wH;-8u9H[]DHHH[]A\A]fHtIHB Ht@HHt4AVAUATUISHH@0tHO6-8H[]A\A]A^HBhHHtDfx*t=zH6-8tH={h 1lf.BHL$HqHt(IT$ fHHBHuHrHAHP HA0A8HHAHA HAHHAtHQ(HP(HA(HtHQ0HP0I;L$ttID$H9tHA(ID$HtHH0IL$HA0H-0-_@HAHID$^H@ QfH=9d 1 HA0ID$fAWAVA AUATUS1HHFhH|$H=<L I\$PHIu@H MHLFL1LAT$`Ht=LHLL)L uEHuHt$LH1[]A\A]A^A_fLxH []A\A]A^A_@LXH=c 1 H []A\A]A^A_H[]A\A]A^A_fAVAUATUSHHt/HF Ht&Ht@0HIt(H!/-8H[]A\A]A^@uHChHK Dk4HHhPA$HHHLs L:jIT$I$HHHT$HSH$qHCHP(HH0Ht-HGHQ(HJ0HSHB(HSH@(HP0HCX<1LA9@wH8.-8A9Hc AL$AT$H=b A4$PAD$PAD$PAD$ PAD$ PAD$ PAD$ PAD$ PAD$PAD$PAD$PAD$PEL$1ED$H`DH=b 1mDL谣Hq--8PHb 8H=b 1ʜH;--8HSf.DAWAV1AUATUSHHHLmHHGHLJHH\$H)HHM,-ƅƅƅƅ ƅƅE EțE]E٣@HLyE\HmueHlinux-gnHDžuHDžHHDžHDžHDžHDžHDžƅH5H=Ba ԟHIu(Cf.H54a HܜL⾀H贐HuLgE1H5.H=` D$ iHIu!@H5` HHL⾀HPHuLDHVDDL=*- AAD u  ËEDu E ]A D eA?De3HĨ[]A\A]A^A_@L`H5*H=` mHIt@HT$ H5E% 1L*L؃t AA@mH+HLAԛkH@HHH @ƅśHHa@ƅ`覛HHƅ@臛ƅH=_ 1͓A?H=_ 1DD譓A?] HEWWWWWWH=p_ PPPDM1DE8HPA?H=_ 1A?H=`^ 1LA?Hu]H=U^ 1A?HH=G^ 1ƒA?HH=6^ 1角A?H H=^ 1舒A?pHaH=^ 1iA?QHH=^ 1JA?2H=] 1+A?H=] 1 A?H=^ 1D$ ,1ۃH5 H=\ MHItBHT$ H5%" H11 LLA讕8 HHt%vw.HH9ÐuH2H8`H6H81f.US0H詎Hts@HX @HcH@A}%D9kwxH[]A\A]A^A_H55U t@HEU {L--@A}CtL5]X 1I4ׂCf{HSHlCIcLA}MHH=,U 1z5DA}%H2H=T 1R DH:A}IL0A}HH=T 1D{H1T L-n-A}@kH{mA}HHH[]A\A]A^A_顔fHS {@HS k@HS [@Hy= K@H3H=J%1?{kSHV HcHA}HKH4ׂCH[H=S HH]A\A]HHi@BA^A_H)1ӅA}HSH=fS H1[]A\A]A^A_馅A}cHsH[]A\A]A^A_H=S 1yA}6HSH=R H=R 1HA} H=L1,H H=R HIHHi@BH)1HH3SH=IR 1݄H=UR 1ȄA}H=fH1謄w(tFUSH1H @9](v'HUH@H‹HtH9](wH[]ÐAWAVAUATUSHHHV;W(H @HHH;U(HEHHRH,H~Ef9Cu L+L;mH=S 1IH[]A\A]A^A_A<$E]<<u!A<$tHUH=(Q 1vfDH[]A\A]A^A_@H5mP HfH5UP T$1T$DDcMA9EtAH-8tH=P 1DL#1f{D{HUHsADM1L%"-A<$Aw4H:S EJcHA<$HSH=P D1U}]UH S HcHA<$HsH=O D1fA<$[HSH=sO D1fDH{D茈A<$HHΏl<IH}^A<$HH蠏#A<$HuH= O 1tA<$HE@B1H= O Hމщ1BA<$HUH=N 1fAEEE1D$fEADN4LHCLHUHH$dAtvL$uL%6-A<$AHzQ EH oQ JcHL%-A<$YEMLE<[<oDcAD\$E9ND{;L%-A<$tH$H=M DD\$ H01D\$ MLE}wEH P HcHL%[-A<$\H$H=fM DD\$ H1D\$ L%%-A<$&H$H=M DD\$ H1uD\$ pH$DD\$ H8L%-ID\$ A<$LD$9D$-L%-A<$I@B1H=L DD$Hщ1~DcD$L%d-A<$IH=pL D1D$~DcD$eL%--A<$OI0H=L D1D$~DcD$.L%-I8DD$A<$ID$LD$IDcD$L%-A<$IH=K D1D$ ~DcD$D<tD$T$1H3H=K D$ 1}LHCD{D\$ H$H=K L}DsD{H=K 1DD$v}A<$D$*H=L1V}D$H=J 1D<}A<$D$H=֞L1}D$H$@B1H=J DD\$ HHщ1|D\$ H=[J 1D|A<$H=kH1|HC@B1H=RJ HDщ1|/H=J 1t|A<$H=H1X|AVIAUATIUAV(Sw(9tH-8un[]A\A]A^E11ۅHt@MH@HEHt pAԅuLHAŃ9](w1EÉ[]A\A]A^DH=K 1{Ht G,G@1f.HtNfDu@SHLHHC0t,1HC8C@fSD1fKFCH[øø[Df.HTH?JH?GDfUSHHH-]-}HK H=L AHsDFff{FSHfu ;S@&HC8DH)HSHS8HCHk HC8S@HHC8wS@sFHK HɍVfSFfSHf{Du t;S@HK0HH9rHK8HHH9XLH)0OHCHfHcHDHH2HHCHSH@ƾDfsDCH1DH3HAHCHH3fDKD1CH[HH2HHCHSH@ƍDfSD1҉CH(DH3HHHCH3+@?ACHfD[DfSF1f{Fu@HttftxHH HCHHCHHS0HC8HCHk HH9rHS8HЈC@HC8=wC@CFHK PHCfSFHuf1fCD1fDH=I 1|H[]fDЃIF AHx zmHHH$H荁H -8IF x(t @0IFhE1LHLH8)QAzH? -8IF x(H<$蟁1fH=YK 1s~vH=FL 1AasH=MK 1HKsH-H$H$ HHH$H$ H=TK 1sH$L$Hv-HIHL$H$[H=)K 1ArFH=K 1LrHNH -8|H=K 1AgrH=K H1awHQIFhHHhPI9s"L)LHH9HF1HP`HtH9tPH=S 1wIF x(H<$ADuH=L H1qH.D 1A"HwHHD$0^H$E1D$PED$HD$ HD$8HD$pHD$(Ll$0Lt$HD$@Lr0u ELltLt$E1H|$0E1zH$H\$(HD$IFhHD$0HD$pHD$@EHH$1Lt$ D$AE1AHHD$(AD$D$8HCHD$HEA9DH5 -Hk(H\$ LCLKHCHS Iȉ >IHHLCLKHCHS rHCHL$(H9/HC H9"Et6Et1AFHL$AHk(HDH9CsHw-E18HS=m.lD$J*L9UHbH)-HLt$ 8AH;}HkH~}Dd$8HH<$xgL3b'AO;DPH|ADDPALa2~HD$@1LhHHAcA=AAL5V-A,A AEHACH4$H=H 1bnhH$L$HIHL$H$+I9"M9IFhHHhPI9s%L)LHH9HF1HP`HItH9t*H=N H1Ar"H<$9wH<$1HHHLxL{HHH $H? HL1raH-8tH=G H1Um1HamAx\LnvHH9t4H=@G 1)rDAaH {^ASDaHzq8H$AiH=F HH1qHz=r=t"HH-tT8tH=J D1elAIH-8tH=#K D1)l€8tH=J D1lH=J 1llH}-HLt$ 8TH=I 1AkARH=;I PD1DkXZqEHLt$ uH|$H Eƺ(uH -8M|$HI9LH== E1H 1L.AtHH-8H=J D1kHSH;yHkHxHHl$H $H= E1H^1HƄ$jAH -8tHT$H=J D1}jH1E;ExHL$Hk( HH ,9?EnHt$@8AfHt$H=C H1nIH=LI D1E1?r0H=H 1i|$t M7H,8tH=H 1iE1AGIDP5IH,E184H=C 1Bi!H,8tH=C 1#iIF x(u H<$rH<$A wH=F 1hH5; HZ]Sl$PADD$P95H5(; H%]l$TAD$XD$T9t7A;l$XH5: H\uʼnl$\AH5qH\ul$XAH5: H\tXH,8tH=E 1gD$`D$\9tAAL5,Q;l$`uH57_ H;\ul$dAL5V,"H5H\uLbLit2H,8tH=-D 1VgL5,HAA LqHItnH59 H[u6H,8tH=9 1gl$`AL5,LASHf,A8tH=D L1fHA,8ZH=C 1fGHF,Lt$HE1hL5-,;l$dA;l$hH5HD$hZt2H,8tH=A 1)fL5,HAALdH,8tH=@ 1eH5HVZ[L6aLEgt+H1,8tH=mB 1eHAATL=pHIt.H5FK HAYu l$hALAH,8tH=$B 1-eMHLt$AE1L}`gLfHt,8H=@ 1dH=qE 1dHHHCHHLx H,HL$8tH==7 1wdMtIFh1LHt$HHP`Ht9DHDmx HI9yH=D 1A5iHH=>D AlHHSD(AHEDXIF x(EH|$UX DE+EEuLD>AHKDL-AHrHKH|$0D*AHTHKH|$0D(AH6LmHHD$=qHID$H|$1D$pmD$qiHD$rsD$shHHLpKvHHzHT$HpHIHT$HLD$8LH|$HJHetBH&,8tt$H== 1bLpL5(,H|$ALppH$wrH,8t‹t$H== 17bH-,H|$ALt$UHULpH-,H|$ALt$UHUHt$@Lht'HN,86t$H== 1aM<$IGHIGI$HBHHBI$HBHHBI$ȉH,8I$u3Hk(HH;$L9oI$HHHPH== HpD1aI$Hk(HH;$v Hf,8tt$H=.= 1`sHD,8tt$H=<= 1`L5N,IH|$M|$AHD$ HtL`ID$Ld$ Ld$(fAWAV1AUATIUSH"HWhL$ DŽ$LL:HDŽ$HHDŽ$HHXPHHv11 HP`HHHHH$HHH@H$H$H$=!rax$tvH,8tMH=N 1_=D1HHP`HHtH$HEkH,8H"[]A\A]A^A_@H,8$$1H$H$f$ȉ$IEhfHHf$H$HHH$HP`HH$ H{$(lHItoH5[pL牜$@H$8`dH5,>LClfDH=A 1"^DH,8H=A 1]Hq, 8H=\A 1]LkvWH5/,>VH=A 1]AH=K 1v]YH=bA 1\]L/kt*H5,>H=tA 1&]H$HH9t%H,8 AH$HH$Hp,8 H$LLHI=t(tLjDfAE2 XIE x(tvHx H$H$atH,8tH=?A 1X\똋$LecH$$I} +]HJ 1ɉA LaHHH$Ld$HD$H$HD$IE HD$ O@H@QHH&H5YJ HNt H)]t$H5=J HMMHVtH$Ld$1Ll$DŽ$IHD$xH$HDŽ$HD$D$pH$H$D$4Lt$Ld$@H$H$H$HHDŽ$DŽ$HDŽ$DŽ$$V 1L|$(D$ D$HD$8E1E1AfDH5HLtH[0H5_ HLtH[4H5a! HLtH[8H5H HmLtH[TH5H HILuH5H H6LtHJ[H5H HL?EEHTHNHDD HZt/HE1E1ZuH5G HK EH5H}KH,E1A8lH=F 1XYH5H:K1HJZ EL|$(|$8ƒ|$H|$ $x#H$HtHD$Hx 'q H$$H$HD$`H$Ht$hHH$HD$ HD$H@ Hx |]CH,8$H=YIŋ$H=XHD$AAIGPH+D$ L$L9LF1b;L;$HD$8sL$1H|$8H$2H|$H 1ɺ Ht$ LAW`Hy MH$HDŽ$ t$ HLP&H|$H1;+ H5J,>tH=f? 1VHt$81:D$pH$HtH8,HDŽ$H$HH,qHWH5D HWHH H5E HH% H,A8 H,HqH5MHALHTH\WC H?,8QHT$xH$Hq#H,8:H$H$HD#H5LHGH,E1A8H=C 1)UH$HD$PY"T$PET$8T$8|H$HD$P1"T$PET$HT$HTH$HD$P "T$PET$ T$ ,D$HD$8D$ Ll$(Lt$Ll$AH$$I} #H|$(H$$H|$(H,$H|$t$H|$H$H$Ht H,H$Ht H,HUH]LaAD$4AED$pHE,8tT$pt$4H=A 1SYE1E1H,A8 H,8n D$pD$4,H,8H=8 15SrHTHYHH HOAH,8tH=8 D1RIcLHU3UIU z( Hg,D$(HD$(HjEIGPH+D$ H$H9HFHD$H@ H@@HtH9HG1HHt$ LAW`HI M Ht $Ld[A 1H$$HL!H$HtlNLIċ$M   H$HcLqX H*,8tH=>< 1QL_H|$ H$$HH|$H!H$Ht Ht$$t  HD$E1tHD$bH= FRHD$LE1H=(RIH|$@1H5pH|$@VH#,8H=8 1PH|$J$H$)H=F< 1OPH= < 1ALt$H[,8tH=1 1LH$$I} %[HD$ HD$P\$(H HD$ ID$HD$XHt$ I;wP.HD$`H$H$HD$hH9 HD$8HDŽ$Ht$ LH$HD$XH=HF1H$HAW`HIH$>H|$Hc2D$tIL+$AL)D$XLD$ L+$uH2,8Mt MH|$tMuiHt$8$DTxoLt$PHt$H=: HD$PE11Hu |$t\$(H|$H1Ht$81/p$Ht$8LH|$wyH,Ll$(LLl$Lt$8tH=r4 H1JHt$81A.H|$H1,Ll$(H$Lt$N8HLl$GH,8tHT$ H$H=<3 H1ZJHt$81A 8.H|$H0H,8tt$tH=23 1JD$p$LLLj_L$H$H=1 H$H$1IAH=,Lt$8H=0 1ImLl$(H$Lt$M8HLl$yFH,8tHT$ H=1 Hپ 1BIHt$81A -H,Ll$(ALt$Ll$8H=/1 1HpH57 HT;t"Ha,8tH=e5 1HE1H57 H;tKH,,A8H=^5 1HH,8tH=4 1hHE1H57 H:tdH,A85H=05 1)H"H=4 1HH=J1 1H1L$GL$HH5(7 HJ:HS,A8H=4 1GH*,8tH=n2 1GD$4&AH,Lt$Ll$8tH=2 1\GH$$I} H,8tH|$ H=2 H1GHD$@2 ALt$Ll$H=- D1FD$pD$4H=E, 1FI$HHLr$HO1Ll$(L$Lt$J8LLl$lCH,8tHT$ H=$0 LH17FA H,8zH=+ 1Fg;H,8tH=d0 1ED$4LH\,Ll$(ALt$Ll$83HT$ H=/ H1E?HË$Ht&tiuH$HcH%Lt,H,8tH=f0 1GED$4HBSH,8tH=j0 1E׸Hz Ht$HT$oJt.AHy,8tH=+ 1DH,HUHN,8tH$H=+ 1D$DHMxDH$$H|$ AE2 t;IU z(PH ,HH,8tH=* 17DIU z(AH,HAH,85H=T1 H1E1CfAWAV1AUATUSHHHGhL IT$PIt$8LAT$`IƸ MYHE P(It$PH)2 1A LhIHH-Ld$H>H8HtH=2 HuHDuHIHItH?E11LHLwEHIHt$HvtHNHHGȸDHH9sKA|%HuA߀Pu'AT߀DuAT߀Fu A|-t`HHH9rLE1iPH ,LHLDH[]A\A]A^A_E1HKHD[]A\A]A^A_HL"LA PEH,LHx HT$Ht$Ml$P@G41MuSHI9vD|$LI4H)LHyE8 tً|$E6H|$ 6H|$yOH,8u9|$6H|$HLO1H,LHt$H=s0 1AfHG@SHHDIDA MLI9HH9uf@Ut#HT,8[f.1HH1HwH!,8tH=0 1@H,8tH=/ 1Y@H,8tH=/ 11@n@H=/ 1@WDfG@f.HwÐUSHHXHH$HHD$HHD$HHD$HHD$ HHD$(HHD$0HHD$8HfD$@dD$P5vHHBHX[]Ðf.ATUSHPHt[HGhHtRHHvHt6L1IhHHHHtRH,82HP[]A\@@H=3 1CHP[]A\@IPPH9v(H)1HAIwALAP`HHt HLwJH,8tH= / 1m>nBLAP`HtHHIH$HPHT$HPHT$HPHT$HP HT$ HP(HT$(HP0HT$0HP8HT$8@@fD$@D$P5HHL@H=. 1HH=f.AWAVAUATUSHHtjHGhIHt^HIL~tBL1IXHHIHtVH,8>HĘ[]A\A]A^A_DAAfH=1 1BIPPL9v0L)1HAHwQLLAP`HHtH$HHHP,8qH=P- 1<^BLLAP`HtHL$LH$HPH$HPH$HPH$HP H$HP(H$HP0H$HP8H$@@f$HLLIFhE1L1LH8BAV0D$0tIF`@H9, IV 1L1E1H$@L|$AD9H $v=Eu{AAHAIV H,D9wH,\$08H=/ 1;H=Y+ LH1:<QEHL$D$ HD$D$4HHD$(E IIHHL$HHD$8LIHHEhHt$HIHt$HXPH9{H)HAwiHHLHI1P`HtH<$HH/FH,8 AV01ɻ D$01ɺBHP`HHH<$H$@HPH$HHPH$PHPH$XHP H$`HP(H$hHP0H$pHP8H$x@@f$d$@$Pf$Ut,HLIH,8H=) 1%9H,A8L $E11ۃvnAy IuH|$tHE D;\$4AV0rfDH,8AAu)AbAOAA[<A AAAAAHt$(Ht$AQ HIIHH;D$8?HEhA%HLL$HD\$@H87D\$@LL$HU0@Ɖ @D$4U uA%IFhLAIH8IAF2 tFuAD$0IF \$0D9 tu D$0MHD$H=T) 1LL$HD\$@s?D\$@LL$HH=+ 1D6HT,8PuH=+ 16H2,8.uH=+ 16H,8 DE MH=I( 1LHMI\6A3AADEAAHD$5D$ H=.+ ƍX16H,8X$H=+ 15\$ Hc,8H=' 15HLIH0,8pH=% 15]@H=* 1LL$HD\$@n5H,D\$@LL$H8A1H=D* 1D\$HLL$@85H,LL$@D\$H8AqH=* 1 5H,LL$@D\$H8qEA AIH=& 1LHMI4D\$HLL$@>IHD$H$LH$BD$x1HHD$&H$1L|$ Ld$(D$4AHHD$xLl$IHD$`H$HD$AEHHD$hIF 9vAl$@uYAIAuH|$L|$ Ll$Ld$(B&D$4AF2 wD$0AD$AL$ Ht$`H|$HHD$H2&t;xH,8NH5v$ LAF2 D$4u@=H|$1Az%H$@E1L$$D$8AHD$PHD$|LHD$XD)D$@HD$HH4IFhHt$HHt$hHPPH9H)HAEL$$1H$HP`HtL $H$@HL>H#,8%H|$$AF2 DD$4VH=H% LL$HD\$@1:HD$D\$@LL$H LL$HD\$@H=% H=U% 1LL$HD\$@:D\$@LL$HHLIHLIH_,8H=% 111AV0$H=n& 11H,1ɺBHP`HHH|$PAH$@HPH$HHPH$PHPH$XHP H$`HP(H$hHP0H$pHP8H$x@@f$$LHt$XHH|$#tCtHU,8H5! LeAAF2 u$T$XHtIF D;cDL$$H|$"|$8D?H=" 1LL$@D\$8D\$LL$@HH=" LI1~81AV0AF2 HD$8AT$@t$|H=$! 1/L$$HLIH/,8oH=# 1/\H|$L|$ Ll$Ld$(!H= 1_/H={ L|$ Ll$Ld$(T$4H|$$!$St$xH= D1/L|$ Ll$Ld$(H{,DL$$8{H=t 1.hHLIt$ H= # 1.\$ H|$L$$ L$$H|$$ |$8$DL$$HGOPGPG PG PG PG PG PGPGPGPGPGPDO1DGH=# -Hhff.AUATIUSH\HH1\$@Ht$0HD$@LhH*9t%H&,8H[]A\A]DD$8Ht$0T$<\$@HΉD$8HTRAP IFEHt$0H9t"H,8tH=# 18-롐\tKH,8tH=# 1-wH=# 1,XD$DuX1LHt$PIH|$HHHH9uHt_HuH9tTH-,8H=# 1,@H,8H=)# 1b,LD$XLT$`M9wkII9$$1H|$xALIHDI9w}I9rxH,8aH=# 1+NH_,89H=" 1+&H7,8H=# 1+I9w6I9zH9r0H,8H=\# 1]+Hvˁt(H,8H=d# 1%+IJHI9s#H,8fH=l# 1*SHE1LHHP`1H(9$t(HB,8H=b# 1* 1fAWAVAUATIUSHH-,H$H4$}HH$$ȉ$ID$hIT$ H4$H9$@HXHH\$F$@H$8L@PI9vbH|$0HL$hE1D$MH|$ H|$@HL$H|$(LEIII)1IwELHP`HtH|$0LH5}AHĸD[]A\A]A^A_fHP`HtHHT$0HPHT$8HPHT$@HPHT$HHP HT$PHH(HHL$XHp0Ht$`Hp8Ht$hHp@Ht$pHpHHt$xHpPH$HpXH$Hp`H$HphH$HppH$H@xH$H9H;$H;$ HH $H9L$}XH|$HD }IRLW6}HD$XHt$PA%LHPH$H)HHIEhH8stAE2 ) D$$DAIA9t]IEhLHLxPM9}/@H= 1A'}tH={ 1'fIE 9Dd$}H= 1Q'H=U% 1>'}H$H=B% 1'}$H=6% 1&}H$(H5$% }$@H=% 1&}t$DH= % 1&ZH|$ H5(% =}>H|$(H5% "}#Ht$`H=% 1U&}HL$XH$H=k Ht$PLAHHL1 &H=$ D1 &H5H=H1%D$eALUS1HHW`HH-f$ HƸH8u H[]D1ɺHS`HHH8t1ɺHS`HtSHH8t1ɺHS`Ht HH8SH1[]fDAWAVAUATUSHHtZHGhHHtNHHt^L%',L1MhHLHHA<$H[]A\A]A^A_DH= # 1b)H8pL%,HA<$[H H= 1$)DIPPHsH9VH)1HAI%BLAP`H/HL$LH$HPH$HPH$HPH$HP H$HP(H$HP0H$HP8H$@@f$E$<v<H= 1+A<$jHEhHHPPH9s0H)1H[IHHP`HHt H|$ L.A<$]H= 1"JLAP`HHtH$L.A<$H= 1"H=Q HL1l"\HHP`HeHP8Lx@H`HH(LX0I)LLHHT$`H$L|$hL$HPPL@HxHp LxH@XL$L$H$H$D$t$HEhL$H$L$L$H$HD$xL$LL$LD$H|$HHt$ HL$(HHL$`L\$0L|$HHT$PHL$8HL$hHL$@L$tL$XkH`A<$HEhHHPPL9v.L)1H[ILHP`HHt LL,A<$oH= 1 \H=I H1 H= 1 A<$XHEhHHPPI9s.L)1H[ILHP`HHt LLN,A<$E1E2HE`@AH`H$HHH H`E2 AuH`LHHHH`tE2 G>AAuAiA<$tH= 1H`H$H$H$HD$H$HD$H$HD$H$HD$ H$HD$(H$HD$0H$HD$8H$HD$@H$HD$HH$HD$P$D$XHHNH`ADX$tH=  15'$u$u$dH= 1'QH=9 1&>\LHP`H`H`LHƹL$HLHH|$xCH`A<$H= 1A<$wH= 1d\LHP`HcH`LHƹL$HLHH|$xH`t+A<$(H=t 1mE2E1$9D$xZA<$E2cE1A<$H`HHH$H$H$HD$H$HD$H$HD$H$HD$ H$HD$(H$HD$0H$HD$8H$HD$@H$HD$HH$HD$P$D$XH`tE2 AA<$PH`LHTE2E1A<$H`H$H$H$HD$H$HD$H$HD$H$HD$ H$HD$(H$HD$0H$HD$8H$ HD$@H$(HD$HH$0HD$P$8D$XH=L 1uH= 1bA<$#H= 1IH= 16E1=H= 1H= 1H= 1A<$H= 1eHE`@AH=2 1A<$t5H=e 1RHEhHE`@GA=E2uE1:AWAVAUATUSHHHGhIHHHXPH>1HQ1RHP`HHPH0HT$xHPH$HPff\$rH$HP H$HP(H$HP0H$HP8H$HP@H$HPH@PH$f$H ff=REfD$pt$tHޮ,8tuH=j 1A=H= 1A4HD[]A\A]A^A_1HHP`HHt H|$pH$Hi,8uLA@IEhHHhHH9t8H9,8tH= H1AlH=q 1fD$ HPPH9s2H)1HIwJHHP`HtH$LH$H,8CH= 1A HHP`HtL$HƹLH$$ʉ$$ff=MPf$ʉ$$ʉ$H,8H= 1AkBfDHXPHv8H1HwOHھHP`HtH$HH #H,8/H= 1AHP`HtHH$"$ff=MPf$IEhD$ H*Mf0H5 LtOH5 LtAE2 D$0LHl$Lt$U|$0ET$ t$\H=U 1EH=X 1A?thIvH=21A?Iv0H=Y1A?$H= 1_Z$H= 1EA?ED$$H= 1LHLHA$dH= 1A?5LD$ HL$0H= $l$h1 H={ 1DA?tHt$8H=&1A?H=Q1HtA?$`H= 1THl$Lt$LT$|$0T$uAdLHl$Lt$rAGHl$Lt$LQAH= 1 f.@HHG1@f.USHHH?Ht HoHkHH+HuH1[]fDAUATIUSHHHHHGAHHuoHxH9wH@HtVADH8H9|~H9vAHt=HLhHUHPHEDHEH[]A\A]DE1HuH7,8uHH[]A\A]H=+ 1 fG3tSH~~1[Ð1DufDH= 1B[Ðf.USHHt%HHtM1t.H[]DHq,8utH[]fDH1H[]DHtHH1V 1H[]H,8tH= 1y v@H=i 1b yf.HAVAUATUStsHIItAt[D]A\A]A^MMtRLzHE1uHH HQ,8udA[D]A\A]A^fH1,8tH=m 1A hH ,8tH=  1Ah @H= 1R H=Q ANfHLH E1f.AWAVAUATUSHHt}HIIA|t%AtHD[]A\A]A^A_Mt{MtNDLHE1uHHf @H,8u\A@H,8tH=% 1AH iH,8tH= 1A AH=y 1 H= A fHLHE1f.HATUSt'HI:tet+[]A\@H,8[]A\@ HuLH= 1f []A\f.MtS HtHLH1DHH 1kfDH=) 1mDHi,8XH=9 1%AWAVAUATUSHHHII+t$At"HD[]A\A]A^A_M HIDHILH HILL LL E1vLH fHi,8ADDH= 1A &H),8tH= 1AH= 1A| LH= 1Z LLAH= 1=LLHE1vDf.HATUSt'HIjtet+[]A\@HA,8[]A\@HuLH= 1 []A\f.MtSHtHLH1DHH1kfDH= 1"mDH,8XH= 1%USHHt5D$HHdD$tit/H[]fDH1,8H[]f HuNH= 1 H[]f.HtS HtHHH1HH 1gfDH=A 1mDH,8XH=Q 1!ATUHSHHHAHtEtHT$uC^HHD$tNHtH'uEu=thHD$H[]A\f.H|$HD$u1fHT$HHHT$HHu1Ht$H뉐Ht;SHH5 HtH1H[[f1f.1ATUHSHHHAHtEtHT$guC. HHD$tNHtHuEu=thHD$H[]A\f.H|$HD$u1fHT$HHHT$HH u1Ht$H뉐AUATUSHHHHtEHIAGtZH*,84H[]A\A]H,8(H[]A\A]fDMHLHH17H[]A\A]f.H,8tH= 1@ExSDHHtCHDH]tHZ,80H=- D1fDHH}WH,8H= 1mH= 1RDH=A 15ATUSHHtCHHAtGH,8GH[]A\Ha,88H[]A\DHEH11HtHDH tH,8tH= D1clfDHtCHT$HH# H,84H=d H1H,80H= 1Ha,8H=A D1DH=I 1DH=a 1DHH13|f.@H` HFH=_ w HT @1DH5-H`wu4Hu-HztHfD$ WiD$ HfDH@f.Kwf.USE1HHHXHHHHHPHD$H`HD$H@PLD$wHD$H)XHHHD$H)`HP@XZuH[]fDH~u⃻@t+H|$uH<$u1DfDufH`u@AWHAVAUATL$7USHHIHHL9L,ML|$1LM~-MDA4GDL$T$AAAALE G |$=DM0MVML9AAD @sI0HH9I0v`@=tZHD MSIHI9v=L9s87A<3dtHA1IuDT$A=t"T$=tI;/[1]A\A]A^A_f[]A\A]A^A_ËfG ȉGȉGff.HHHGȉGG ȉG HGHPHʉPPʉPH9u@f.AUATIUSHHL%,A<$uRH1@ tA<$uHuH[]A\A]@DCH= L1NDF 1HHH=R AWAVAUATMUSDHA"Ho HDIHcHfV(AHH1HHP`HIHHHAGCAG fC sL,A:r{H[]A\A]A^A_@V(AH{fDV(A H[fDV(ApH;fDV(AHfDH=a L1MH[]A\A]A^A_fH,8(H=Q L1f.C{ f{ IWIUIWAMIUIWIUIW&IUIW.IU IW6IU(IW>IU0IWFIU8IWNIU@IWVIUHIW^IUPIWfIUXIWnIU`AUAGvAMffAEhfAUEEA}AEEM AufAEAA}A}AfA:EEEM AuA}A}&fAEA}&D9f=J_{1fA} A:H= LfDC LT$HKH= LPDK 1DCR{XZLT$u=D[ESA:>H= 1L(A:H= 1LLT$H= PV1LAYAZLT$A:AUAMH=  VAE&LPEM$1EEAU_AXLT$D9r fA:xH= 1LObAUJfv%A:DH=  1L.f1f9A:H= LAUA9։fJAWAVAUATUSH(HHD$t L:IMu)H ,1ۀ8H([]A\A]A^A_fDR tIIHH=e E1HL1蹸uHT$Ht$Ht=H,8tH= 1H=y 1nDHa,WI~AF D$H|$\|$HD$ht AU,|<$999;,$vAf|$HrHH9I)AF 9,$ID$hAU(HI9HHIF1HP`HuH= |$xID$ @(H|$)H=!,AF D$HD$fH= 1}H,8|$L蜧yDH=,tH=[L#H=,AF H ,o"t$H= 19H|$] EH?,8tH=1H,82H=+1|Ht$H=K1dH,H=vL>H=r1+H,8H=1 H=q1$Hq,8H=1AWAVAUATUSHHtRHGhHHtFH5,>uRHHxPwmE1AL|DHĈ[]A\A]A^A_H=1ZH=12HChHHxP}D1ɺHHkhP`HIHII$ILLHII$H)H)΁IHAAWfff=+HfAfAWVf=XHfH,AGAGAG AG AG$AG$AG(AG(AG,AG,)AG(APH,A8mH=1ZfDHQ,A8>H=S1+H!,8 H=I1E1Ay@H=Q1E1Ai@H=a1ALfVH,H=M1H,IGpMMM`HHD$aLYLQLIIHHD$5H&,8tOHt$H=V hH=Y LYH=V LJH=S L;Ht$H=N *H$H$L b ALHAH$HT$vL  ALHbAkHC Hx *HHD$H|$=u~H:,AA;G,s?AG(IH9w.$ƉD$P$fD$>H9S AHC @(t*H|$HHt$H=1A2H|$H=AH=] 1Hp,8ttA7H=1HR,8AwH=+ 1H0,8txAw H= 1H,8[Aw$H=  1oH,89Aw(H= 1MH΁,8Aw,H= 1+AG(:|$>$HI ;$so$AG(99D$hH<,8ALT$hDEH,8)H=W 1pD$hH,8tH=1GHȀ,tH=B1A%{Ht$H=1 H,AA;G, H=1H],8qH=H¾1LH=1H,*|$>l$HD$hD$LDt$lL|$ H\$(fft$Tft$VHt$XH$Ht$H$Ht$`H1HHHʼnH,xHD$ ;r-IH\$(>H=1H\,HD$ E1H$UEt 9u]A)HAuL|$ H\$(H=W1XH~,8H=i1:H~,H=D1H5~,EH~,A8t$>H=1OL|$ H\$( H=1DH;~,nH=D1H~,QH=w1~H},i.HD$ B ;p,r7H},L|$ H\$(8H=1+H},HD$ p(ulL|$ H\$(EL|$ H\$(CH=_1DH^},H=1$D$P$fD$>HD$($H@hHLI@PH9H9w5H)LH9HG1HAP`HtHHL;$9t?H|,L|$ H\$(8zH=1H|,I$H$H$AD$$AD$ f$=HN|,8$$$f9D$TfL$V)fHD$XDE,ATDD,fA AYA9PD$>E1DxHD$HD$HHD$@KAfD;$4AAAATA9fA9zAAA ADȃɍ CA9 HcMTH {,A*f8feCHHH;D$H|$LH$ff$ffH5z,> H=1D\$0 D\$0H=!AD1D\$8LT$0D\$8LT$0J$9l$H{AT$Pt$LNF99$wL|$ H\$(L|$ $AG(H9YL$Ll$H+H\$`D\$0HH=RHH$D\$0H\$@D\$0HH=(HH$(D\$0H\$(HL$HT$@Ht$ H D\$0/C2 fH9y,8D$hHy,EL|$ H\$(A8H=UA1bL|$ H\$(EHx,A8H=A1$zH\$(HL$HT$`Ht$ HSD\$0DC2 Hlx,8D$hHH5H=4$PD$1D$$$Y^Hx,L|$ AH\$(8H=1WL|$ H\$(D$hAHw,8H=nD1rL|$ H\$(D$hAHw,8MH=D17H]w,L|$ AH\$(8H=1H*w,Dt$lL|$ H\$(8H=1|Hv,Dt$lL|$ H\$(8H=1JH=1L|$ H\$(}Hv,L|$ AH\$(8cH=q1PL|$ H\$(E1H=1D\$0!H=j1D\$0L|$ H\$(1HsL|$ H\$(]H=D1(Hu,8u L|D$hf.HGPH9tOHtJH9rMUSH)IHHH9LHF1HHW`Ht*HHHH[]D1DøAWAVAUATUSHH@HGhHt$HT$4Ht$8HHG Hx uuHD$|$4FHlHt$8H=1 |$4H|$8H|$8Hĸ@[]A\A]A^A_@H= A1DDt$$Ht$8H=1DHD$pD9q;tHcT$$H=%1t@|$4H贒|$4AHE @(IH|$87H|$8f3 ;H$L$ H5pD$HHDŽ$HD$HD$@HD$@Ll$XHDŽ$AHHDŽ$D$` HD$D$$9Hl$(fLl$XD$` T$HufL{PLt$IcL9Lt$@I)1ILHS`HH\LLMDD|$HAH|$ +T$`AZD$$Ht$(H=V3E11D<IcI|$4DLA9D|$$ HS`HHƹH|$ A HO@Hl$(1H|$/Hq,;uHD$p9t$$HcT$$H=q1DH|$8DfDAHl$(A{@H=1|$4yH|$H|$85fH|$8f|$$txH5bH1$H=1b|$4 H|$8H|$85=Ht$8H=1 H|$H5H1@@f.AWAVAUATIUSHHAHGhHT$4Ht$8H(HG Hx uo|$4A$FLtlHt$8H=1|$40H|$8H|$8\HA[]A\A]A^A_DH=IA17DfHUPHv/Lj1IwjLHU`HtH|$0LHH=1|$4H|$8V>H|$8f RHU`HtHEPHPHΉL$0H9 H=1HEPH H Lh1IL HU`HH$LHHHL$H|$@1At$L$!McHH|$HHD$HL$L$HDŽ$ I H$ڼHD$IH\$ Ld$(!DL$HDŽ$ |H$ulH\$H$LePM9GM)1ILLHU`HHoLHMIcH$IH|$k +$ALLcLd$Ht$ H=<.E11L3|$4DLA9Ld$fH|$8~ @Hl,:H=1HGHEPfD LHU`HyHƹH|$ HH|$H\$ Ld$(LH-ml,}AD$H9D$HtHT$H= 19|$4H|$4AaHC @(uH|$8H|$8D#fH=a1r|$4H|$8H|$8E HU`HH$HA H|$H@H|$ALd$(H\$ 9AH|$H5H1DH=y1H|$|$4GH|$8 H|$8sH=21cH=1R|$4H|$8H|$8r%Ht$8H=G1H|$VxH5 H10L|$Ht$8H=u1LAD$L9H}HT$H=D1AWAVAUATIUSHXHj,HGh;L0XInPH1Hvk1LAV`HtyHHD$HHl$HH=/HH=7HHL/1HLAV`HHt H|$HH;1HX[]A\A]A^A_t$KH=1;t$LH={1Hl$HuH=|HtH=b1IfHLrfDH=11WH=1DH==H!ZI~P+1ɺLAV`HAĈD$G;D$A|$ZD$MnPDxDDI H$L MIfE1I9HAL1LAU`HtQEH|$GDt1҉уD 9D rI9t+HADd$GMuPADAL $$I9wH=21N fH=11H=1H=HyoH=1[\MD)A)D$(DD$AE!9D$D+D$(MVPDDL9HD$%Dd$EME1I9HAL1LAV`HEH|$GDt1҉уD9DrI9HAD|$Gv0MfPADAL |$I9wH=1qDd$ED)A)D$,DD$AE!9D$DD+D$,M^PDDI9HD$6D|$0Dd$ EME1L9HAL1LAV`HEH|$GDt1҉уD9DrL9HADT$GvM~PADAL T$I9wDd$ D|$0ED))‰D$0D!9T$LL$0)L$ƋT$M^PI9Ht$ LDd$4Dd$D|$8DT$H|$|$H D$0D$XLd$`Ht$pH|$ HH9D$1$6HH,8H=^1/D$ aH$HD$(5Ht$(H=2D\$LEtDT$0Ed|$HDL$XE/DD$LE|$L I INlj|$LH$H=M$pHHIH$>H=2$qHHH$H$HB!BHH%H H$HHHH)HHHHHH)H9Hb|$T$HD$$H$H$Hcl$\Ll$hHBF-HD$0H$p~H$%H|$0V$V $ }HsF-H)HH$H$Hf.H9H F-Ht,2H=E-HE-HHF-D5F-D E-T$@E΅D5E-5E-DE-E1ۋ=E-E-E1E1DL@DE1A1LLcAH)IDHIAHHHHHHcI98utAAHcIfDAE'Et= E-EtD E-EtD5E-HD-DHD-@McM9H|$0~HD-HH)HDŽ$D$T`11fvHD,8 H|$0D$ oH+$D$H$DŽ$ }EH9D-H$uHcD$`H9D$87$$XHt$(H=M Dt$LE> |$L  D$0D$PHC,8-H=1WD$ f.DŽ$D$0KHt$(H=NDl$|E l$Ld\$Ht=HF  tI $p9$ D$|D$0D$HD$0D$XHt$(H=}$ D\$XEDT$LE I $pfff=KfH*$tfffɉH*$xȉH*苄$|^ȉH*$ȉH*؋$ȉH*Ћ$^H*ȋ$fD(f(ȉf^H*^^^^^ffA. =fD.v fEfD.f f.\ AXD]<fA.C ff. f. f. f. XfA. ff. f. f. f. XfA.w ff.5 f.+ f.! f. XfA. DŽ$D$0TMDt$LH$>H@,8H=1D$ DHQ@,8yH= 1貪fDH)D$8A}HD$ H\$8$H@PH}LNIcDt$`HH9H9 H)H9HGHD$ 1HHP`H H|$HHA9H\$H|$DD$HQH$HD$D$$H$p~H$HpDŽ$ }H>-H$HDŽ$@HDŽ$HHDŽ$PѤgL$@>->->-}>-HcD$\b>-HD$hN>-H3>-L%=-L%>-L%=-L%=-L%>-L%=-L%=-HHHH=-$,HL>,8H=\1譨D$ H!>,8Xt$HH=1~D$ H=,8(H=1RD$ DH=,8H=1D$ JH=,8H=E1D$ DHt$(H=@H|$(H5ެ$ |$L |$X IJ $p DŽ$D$0u1$HD$hH5<-L <Z<-L<-AH+<-1HHHHcD$\HHHHH <-w IcL1H|$ht1LH)HDHHHtHFAHAH몹1ҸH;L$h}KHc1ɺ1Ҹ1ɺʹ1Ҹ1ɺH1vH;,8H=a1 D$ <DHy;,8H=1ڥD$  HN;,8H=f1该D$ H|$(H5ID$0D$LH:,8H",H=%H41:D$ lH:,8H=1D$ AH:,8fH=I*^ФD$ HD:,8{H=Z1襤D$ H:,8K$H=1nD$ H9,8H=1H]8,8t$@H=Y1躢D$ H.8,8eH=1菢D$ H8,8:H=1dD$ H7,8H=Q19D$ kH7,8H=1D$ @H7,8Ht$(H=1ޡD$ HR7,8H=1賡D$ H'7,8^H=1舡D$ H6,83H=1]D$ H=1BH6,8H=1D$ QH6,D$ ;9H=1$Hf6,8H=B1ǠD$ H|$(H5<٥IH6,8OH=1yD$ H5,8$H=E1ND$ H5,8H=1#D$ UH|$(H55I tHt5,8H=1՟D$ 54-D4-4-H=1袟D$ H5,8MH5NH=1pD$ H4,8H=1ED$ wH4,8H=1D$ LH4,8H=~1D$ !Hc4,8H=1ĞD$ H84,8oH=1虞D$ H 4,8DH=11nD$ 2H3,8H= 1;D$ mH3,8H=l1D$ BH3,8H=$1D$ HY3,8H=1躝D$ H.3,8eH=>1菝D$ H3,8:H=1dD$ H|$(H5vuU$n|$X8|$L$HI9Lt$8DŽ$D$0H|$(H5 D$$|$X|$L\H|$H$rq3Hc$P)ŃHcpWp-DŽ$D$0SH1,8fH=%I*YD$ 0Hr1,8H=1ӛD$ HG1,8~H=1訛D$ H1,8SH=q1}D$ H0,8tH=1SD$ H0,8tH=_1,H0,8tH=1H0,8tH=D1Hs0,8tH=1ؚHW0,8sH=1踚`H40,8PH=1蕚=H|$(H5诟tdH|$(H5蚟$z|$LDI $x<DŽ$D$0:H|$H$nuY$=|KPHcpHp]AHA/,8tH=1覙D$ H/,;QH="1xD$ H.,8tH=p1QH.,8tH=$12H.,8H=1D$ DH.,8H=[1D$ H[.,8H=C1輘D$ H|$(H5GΝu-$|$LuxDŽ$D$0H|$(H5'茝L$|$LI $x<wnDŽ$D$00H-,8H=1D$ !Hc-,8H=1ėD$ H8-,;oH=1薗D$ H -,8AH=Y1kD$ H,,8H=1@D$ rH,,8H=1D$ GH|$(H5'uR|$HED$x$|$X|$L\$HHHc HH|$(H5$$p_|$L)IFH\$HIHL9]8THI$p9$q9$rT9L$st>9|:DŽ$D$0Iur$pt;9|7$quH+,8FH=1pD$ H*,8H=\1ED$ wH*,8H={1D$ LH*,8H=1D$ !Hc*,8H=1ĔD$ H8*,8oH=1虔D$ H *,8DH==1nD$ H),8H=1CD$ uH),8H=1D$ JH),8H=41D$ Iu$pt~9|z$qtC9|?$rt9H'),8^H=o1舓D$ H(,83H=1]D$ H(,8H=12D$ dI$pt9?H(,8H=@1D$ L9HhI9@HL9sa;t1HH((,8_H=1艒D$ H',84H=1^D$ uӀ$q-<-H$HH)HǃdH)HHdDŽ$D$0 Hk',8H=;1̑D$ H@',8wH=1衑D$ H',8LH=%1vD$ H&,8!H=1KD$ }H&,8H=1 D$ RH&,8H=1D$ 'H|$(H5|$LH|$H$eufHc$BHp)Љ@@4xDpuruNH%,8tH=m1FD$ xH%,8tH=1H%,8tH= 1H%,8tH=1Hf%,8tH=1ˏH|$(H5u^$$b|$X,|$LI$pwvDŽ$D$0yH|$(H5uG$|$LI$pwnDŽ$D$0Hy$,8H=q1ڎD$  HN$,8H=ܾ1诎D$ H#$,8ZH=c1脎D$ H#,8/H=¾1YD$ H#,8H=z1.D$ `H#,8H=1D$ 5H\$(H5fHtH5XHuuH|$H$$buHzl$Hp,H",8tH=1cD$ H|$(H5нu$QID$p$r$sD$tD$u$vfAfAED_A p~9AA;<H'",DŽ$D$08H| ,IcDHWH=2S1bAXAY|H!,8H=:1;Hc$1)HT$9t @t_H=GH<7tH~!,8H=f1ߋwH[!,8H=ɼ1輋D$ H0!,8AAHD$ @2 E1D$<fHQ,81Hx[]A\A]A^A_A}H=1DL$节DL$r{!cHD$ @2 E1D$<,HD$BD Ht$ H=E11LDL$E:A}DL$H=31DL$DL$DH= 1DL$ՁDL$DKKH=*SCH5EAHDHH=3QRPL$H1HT$0老H ED$HD$Ht$@PHD$ H@hHHH0HH)H+p@DL$HPxDL$fDH=1^DH,8AED$,D${HD$HT$HHt$PHH@ Hx 1AA}_EHL$1ҸDQDIHqA1҉HLH@hLI@PH)IDL$(HL9Ll$XLl$H\$\$(@l$(D1҉DLADEI 1HAP`E9eHAFmHtc|$d69}A)NEU1ҸE]IuAA1LىIEH@hLI@PH)IHI9fl$(H\$Ll$XA}dA|$dDL$0tHD$DL$HH@ @(t$H|$hDL$QDL$DH)ƋHH|$hsDL$ DEH=1 EH,8Hx[]A\A]A^A_Ã|$<AEHx[]A\A]A^A_D$<OH=DD1DL$~DL$l$(H\$HD$|$dH02AHt$hH=1H\$l$(ԆAHt$hH=8~H=1%~+H=q1~f.Hw1@AWAVAUAT USHHHXHGhHHP`HItYHH,qHt7L)‰D$H9r#A$L$t!t1HX[]A\A]A^A_DHD$AH)Ht$DAA Ht$D$HUh1ALHLAP`HIt}D8AtsHxH5X莃uZAuA~X%uA~Y/uAuAvAFZLJH=CH1z;IL纀H=EH1y;I>H纀H=H1y;BA:HA/A.A-H=PA9PA8PA7PA6PA5PA4PA3PA2PE11E0)yHP;AKHA@A?A>H=PAJPAIPAHPAGPAFPAEPADPACPEB1EAxHP;A\HAQAPAOH=aPA[PAZPAYPAXPAWPAVPAUPATPES1ERwHP;AmHAbAaA`H=PAlPAkPAjPAiPAhPAgPAfPAePEd1EcawHP;AH=1>w;tsAH=1$w;AH=1w;AH=1v;kAH=1v;KAqH=1v0D$%D$A1HH=u1E1@1DADAAAHHDHuƇƇUStMjA؉L\AHALAL AAA0FL9uˍ\+[]AWAVIAUATUSD.FNHII1FL1HH1HDVIFVvIHI1HI1I1LWEYAA AQ AI IHI1HI1I1L_AY AA AQAIHHH1HH1H1ˁH_AAHHAAHH1AQH1AQHH1HG AAAIHHAAHHH1AQH1H1ȁHG(:AAHHAAHH1AQH1AQHH1HG0EAAAIHI1AAI1AAHI11LG8[]A\A]A^A_@H-ѾL L @H H_L/LWL_HHUI4HHAH1HHMAL1MAL1L1HH1HO L1HHO(L1HG0H1L9HG8r[ ]A\A]A^A_fH- LPL V.@H3W H0HW H1HW(HG(L/HMLWL_H_HI4HHAсH1HHIсH1M4AL1L1H1HO0L1HO8L1HHO@H1L9HWHc[ ]A\A]A^A_L%9LL HH@HLHD%H1HH3GHHTHLH1H1HG H3GHG(H3GI1HG0LG8LG8L/I$LWL_H_AIH-I LHA4LHIH1%H1LMuT$ u1@E1E1LHL{D$ tH+8^H=1ZAKDAWAVIAUATIUSDHHL5+$LL$A>)1ɺLAU`HH$L$A0HLHLt'A>HH[]A\A]A^A_fD$L A LL$HEHHD$uH$AHLLyz$tsA>oH=0@TA>QH=W@6DH=1?(H=1Ht$?Ht$$H$A0HLL$$tA>H=%?$Ht$L ALL$lH$A1HLLGHHt$HULL#$tA>H=>H$A0HLLHUHutyL A L H$H$HUALHHD$yz$t*A>pH=V1>UL A 녋$HL$A0H$L$H$HHD$8$tA>H==H$HL$AH$LLHH$$H$$H$HHD$07H$0H$PL$$L$H$H$4HL$xH$HD$XH$THD$$H$Ht~H|$0DŽ$ZD$(H$HLLw$$<1A>H=1VH={1;H$HLLy $H$A0HLL$$pA>uH=;6;ZL$L$$L$H$MLA>t$H=1LT$:LT$H$H$D$(Ll$p\$xLHD$XH$L$HD$hH$HD$H$pHD$ HLIHH$? HtpPt-A>D$(tH3HH=0HHD1*:H!HHL!LL'p H|$0H`H\$Ll$p\$xL$H$tA>tH=19H|$0>H$`H+D$@L$HT$H$XALLHD$po$H$IwL AHL$H$H$ $`A>H\$H=n8$HuL ALL$-H$A0HLL$HL$A0HT$8H$L$stH$$H$LHHD$HEHL$HT$8AH$ LH$$H$LHHD$X@$A>H=7HT$H$ALL$H$HL;f$H$HDL@HT$H$IwLHHT$H$A0LL H$HT$A0H$LLHD$`$D$h$L$H0HLL扄$H$H$ xH8HLL [H$H9$A>H\$;H=16(HuLLLH$AHLLHHD$ H$H+L$ HL$`$HL$D$$H$HHL$PH$H$ H$HL$hHD$0H$HD$@$bHL$HT$8A0H$ L:pHL$0HT$PAH$LH$ uIU0H$ME`HuAUL)H)I+E@1ɺ LHAHH$H5z HHL$pC;QHL$pH5^ H";A HL$0HT$PA1H$LDL$pODL$p$,D$DEwHD$0HpTL A HT$@LMu'L$$nA>tH=i13DŽ$$t"A>H\$H=21k3HT$H$A0LLhV$H$HKL3$H$HLr L$HT$H$A0LLH$It$L LH$$$H$HHD$ BHT$ H$ALL|j$tCA>H\$VH=,/2EE1A>vH= 2eIU0H$ME`HuAUL)H)I+E@1ɺLHAHeH$>A>H\$H=$11L A HL$hHT$@AH$L$u]IU0H$ME`HuAUL)H)I+E@1ɺLHAHH$H$pL$1A>IH=\106|$t8A>H=10A>H=0HuL LL>H$AHLLz{$A>jH=p+0OHt$XHXE1YHt$hHYH|$1H|$ H$H|$`EHD9HD$BT-IH5;JHH=~1/+E1ED9HD$ BT- H5{JH=1-A>H=1r-H$AHLLqr$A>dH=%-IA>IH=' -.A>YH=,1,FA>H\$H=0k,A>H\$rH=K,a$HT$ AH$LL$:($E=A>H\$ 4H=1+HD$ AML)H)A>H=+$H$A0HLL$$A>H=1M+qLl$`ID)9]H5y9A$:EL1II)IM0H$ME`HuAML)H)I+E@1LHAH H$HXwQHT$ H$ALL$A>H\$H=X*n$HuL :A LL$EH$A1HLL !$A>H=)H$PLE1HD$HH$HD$PH$HD$@HD$HAUH5(IJ< 1(HD$PAUH5J< 1(HD$@AU;H5J< 1I'I(uH=1.)Ht$PH=1)Ht$@H=1)Ht$XH=1(DHH5L H8H0LH=RHDLLDȃHARVHt$XLD1(H=]1(Ht$0H=(1s(Ht$pH=(1`(Ht$ H='1M(A[A\$H$A0HLL$:;$$HuL ALL$UH$A0HLLH]HL$H$A0LHHL$H$LH$HL$H$ AHL]^HL$X$LH$:$tA>0H=&H$A0HLLHL$H$HUAL$A>H=1p&$9D<IM0ME`H$HuAML)H)I+E@1LHAH$H$HLH$H$DŽ$H\$(H$H$HL$HH$H$HD$P$THT$H$LLp$$9z@p<$uH$H$IWA0LL$H$p1H$$HL$HH$A0H$LwH$H$AHT$PH$LH$<HL$ HT$PLH$V$$<$$t0IU0H$xME`HuAUL)H)I+E@1ɺLHAHH$xH= H*$H$PwUIE0ME`HlHH)HI+E@1LHAHt9}u$MB9u MA>tH=1T#DŽ$$}DŽ$DŽ$bA>H\$$4H=1" A>HD$(HD$tH=1"DŽ$THD$(HD$A>WH=1"A$u_HL$ HT$PLH$Q Eu !$:AMHL)H)A>H=1"H=JH(%H=DH(HD$ H$A0LLHPY$u-DŽ$A>5H=1{!"HL$HH$IT$ALv$uYIU0H$ME`HuAUL)H)I+E@1ɺLHAHH$8$A>H=@ zHD$ H$A0LLHP$A>H\$(tH=1} DŽ$DŽ$T$ToH$H)Ht!A>tH=10 H2H|$0HHu͋T$hHt$`HKHL T$hHt$`HLOHD$xHT$XLLHp$;$A>H\$H=Y1H$I\$H$$ HL$HH$AHL\ $uIU0H$ME`HuAUL)H)I+E@1ɺLHAH H$H=%H% DŽ$RH\$(WA>H\$H=IM0ME`H$HuAML)H)I+E@1LHAH$A>gH=1&JA>H\$(H={1H\$(xHT$XH$`ALL$$=A>H\$H=1A>H\$H=~yH\$(H$H5^$ HL$PT$ LHt$TD$ $< H$AHLLHHHD$H$H)كHL$0$|$ D$@$H$H$ D$xH$HD$hH$HD$`H$H$HD$HX$HL$HT$8A0H$ LUHL$hH$AHL/e$ uIU0H$ME`HuAUL)H)I+E@1ɺ LHAHH$H5 He"H5 HI",H5Hߺ ("D$@ٸH$ D$@HD$HL$hA1LLPLL$7m$L$$$rHt$`L A LL7DŽ$H$H5zF!@HL$PT$ LHt$D$ 0A>|H==a|$@tVA>ZH=p1=$A>ZH=1$t9H$A0HLLHL$H$HUAL$ A>H=lH$Ht$`LLDŽ$IA>H=!zLL$PDD$xHt$`LL}A>DŽ$>H=!1IU0H$ME`HuAUL)H)I+E@1ɺ LHAHH$H5 H5t`H5 HtHA>H=1Ae$A>H=1#$H$AHLL$v6A>H=A>H=$tnA>H=1zHt$HUE1E1LHv$hH=)MIE0T$0ME`H^H\$H)HI+E@1LHAHb|$ H=%HHH5He$HD$0Ht$HߍPHL$Ht$H/IM0$H$ME`HuAML)H)I+E@1LHAHtljt$LDL$0D$H$HT$hHt$XXHZYtA>tH=1 D$(-H=A>H=0H=ҷHHHD$AML)H)A>H=$1$A>zH=)1ZgDŽ$2IM0ME`H$HuAML)H)I+E@1LHAH$H$H ;$4tNA>H\$H=1H=Hb2DŽ$"$te$t:H|$0Hw,A>H\$hH=vAWT$pHt$@H0L t1T$pHt$@H0LvvA>H=-1HD$HUE1E1LHp9$A>H=1!H\$pH$H90 H;8pA> H=U1FAWAVHF0AUATHUSE1H1IH(Hl$PPLd$TLmATWPM_AXtAH(D[]A\A]A^A_Ht$`A0HLLuHUHuL A Lut$Tt%H+8tH=1sxfDHt$`AHLLoQHt$`AHLLN0LU LLLHt$`A0HLL AD$THt$XD$LHt$`H$H$D|$,Ld$0Hl$8HD$H$IHD$H$HD$L|$8HT$0A0LLlHl$pMgHt$XALHL`BH$A1HLL<L$T]D$tHL$Ht$xHUA0LH$HT$AH$LLHD$x$ uIF0H$MF`HH)I+v@1ɺ LAHH$H5n  $HL$HT$A0H$L$IHT$H$A0LLL$HT$H$ALL$ -IV0H$MF`HdH)I+F@1ɺ LHAHL$H5h LH5W L\D$(HT$H$A0LL$Ld$IuLLLZH$ALLLx$$MIV0H$MF`HQH)I+F@1ɺLHAHH+8tOH$E1HD$ IH$H5LIB81Ir IuHM+8H{xH{xL$(E1H$pH=51L)AF|$LHt$`D$(]H̢+8EH=1- 2HpHHCxHHhAL)AVL)AV|$(HaHM Ht$ H=CHE1 H,+8H=1 H +8H=1j oH+8_H=61G LHá+8+8H=~1 H+8H=31| H+8qH=1Y ^D|$,Zf.AWAVAUATUSHHH~G0uxH+MAIHH81L|$LLHAH0LDSLAHH\$ SLL$bLAGEZYt HH[]A\A]A^A_f.Ld$ Ht$A0HHLuM|$Ml$L A HLLuHt$0A0LHH7oD$tUH+8WH=1 DLp+H=H1 LLLHXMALLHH+8H=1L SH5HH\$RHD$u H+8H[H5IHu(HY+8tH=`1H1+8tHH=dAejejmAejmlle1lH hH=1RRf.HHAWAVMAUATIUSIHIH(H[0HCL9uH{LuMMHC Ht{ML;uMtnIOHhE1IHHM9tOHEH9AuHϺHLD$LL$HL$6HL$LL$LD$tM9Jf.H+H}HHu+HH}HLO uH(H[]A\A]A^A_fH(1[]A\A]A^A_1ff.USHHHHt-H8HtfHEH<HHuHHE HtH8tHxH} HH[]{HtsHtnATLf8USHLSu}H}Ht@H_0WHHuH}HEEHt HELu []A\fDH=RH‰[]A\1RfHH=ސf.HHH@$AVAUATUHSHH`HL-+A}{Lu8LOAtHQH=HD1 H}0HtHHtHH`[]A\A]A^DHEHHH$HEHD$HEHEHD$HEEHD$HE HD$ HE(HD$(HE0HD$0HE8HD$8HE@HD$@HEHHD$HHEPHD$PHEXHD$X;LI0H|$Ht@H_0oHHuMt1DL$$H=H HH5M LH<$HtH}tpA}H=q1H= 1rDHHH=H‰1 +H$~Df.HAWAVLq8AUATIUSHLHIHA AtDHHkH{E1LLHHt:HP(HtHH0HJ0HP0HtHH(HJ(H;CuHP0HSLuH[]A\A]A^A_fH=H‰H1[]A\A]A^A_ DHH=f.HtpAWAVIAUATLa8USILHIH5 uOH{E1LLLHtPtuPL uIH[]A\A]A^A_fH=H‰H1[]A\A]A^A_8 HH=HC0HLLLHHt nD_fDHt G1f.AVAUATUS1HLo8HL uxLc`MtPf.I,$H8Ht/H}HtuAfIIVHH|HuLMd$0MuLr uIMI1DHI L9tKI>HuII_LH;HHHLH[]A\A]A^A_ÐHsHL`HIUHHHHBHBHBIMHQHIUtHIHZh@HL[]A\A]A^A_þ HItUIE1, ^1I}Lt!f.H}HH I9]wL1 11f.AVAUATUSHH5%I$HHVH=,lHII<$Il$t@HLH H}uLHIwI<$Il$ HtfH H}HuHl$LAHًH! t€DHAHDȉHH)HwLH!t -HAUH< H5̢1IL9uHH[]A\A]A^1I<$Il$ HtH H}HuLH1L1fDUSHH2HHt H+{+8uHH[]@HHH<H=HHD1bAVAUATIUSHfHusH{HHtcH5Ht HtSH5Htt HtkH5HTtHhu1[]A\A]A^LHU[H,z+8tH=1E1DHHHH H5:Ht HtSH5[HtHH5HxtHsfDH5HIH5HH7HIt HE1Ht HWy+HMHBy+LEuQH5mHHHH5hHatH5ZHNHx+HHHx+8H=1vfDH5ޡHE1^(H5͡LGAH5x+8$H=E1HgHxHI HHLIHEI$HEI,$H58H5Hw+HH5L}6H5 LE1cA*HYw+8HH=15DH1w+8u[]A\A]A^H=1@AWAVAUATUSHHHHD$8Hv+L$ HT$H8%11 pHITHLd$8wtcDH5HYtLmH5AH5tLILLHHv+8tH=H1wzD$$Ll$(lHu+8L1LHH[]A\A]A^A_LLGLALDHLd$8MtHD$Hx`CD$$Ll$(HHD$fMEID$HD$8I$IHD$IH@IIEDB uLH$TAH$HIDHDJ u HH@IADJ tI9rAtH$Hc HI1L,A_H$,@tNހZIc LA_H9HD$LELP.~*AFM\LH0DrtA2IHL9uHD$T$ LH@HH$L]HD$H $1LHx`CtJH=s+?Hs+I<$LLd$8KHDJ AEA4'fD$$fHs+H|$LLHAs+8lH=1YH $H=D1RHr+Ll$(L8LH $LH $HGHr+Ll$(8LLHH=1H=H1dHpIVHIF`tH|$Ld$8HHht$$Hf HH=wHHE1v H=1c9H=1L<$LH $Hq+ATAUSH8HCHtHPXC(uD[]A\H{H5HŋC(" Z@2 ujuE lH1HC) QHH1D[]A\H1HC(f.HŦ1HC(f.H1HC(XHL1HC(/H1H_C(Hy1H?C(Hѥ1HC(H1HC(H^1HC(eHџ1HC(=H1HC(H̤1HC(H1H_C(W(H=1df.AWAVIAUATAUSAH(Hn+;nM EHl$@1 H$DHHL|$@Dl$H>H$1DsHHD$Pu;HpPHt$`A9AIH5HD$XH1H|$`D$tfT$pHD$P11HP`Hf ;HL$hH([]A\A]A^A_;tH=1 ; tH=1fDH=ƣ1DHL$h~{IH5|HD$XIH5HD$X;&H=3VD`AD$vU;H=1+fDH=1:H=.H;HD$`HHHD$P1ɺHP`Ht_;Dh1D$tHD$xfD$pIEH;D$`vHL$hH30H=1[H L$hHD$P1ɺLHP`H;0t$lDpFAXDt$ T$lIDH;D$`dHD$P1LHP`HIXHE@HD$Dd$8L|$0HD$(HE0HD$H$ HD$ L$9L$  HD$T$lHH9&;HD$EtEd A|$HHD$xD$tu_AHJcHH=ޜ1;%H=D1H= 18AH+JcHH=ל1DADt$ v L$hD$ ;t$ H=ٜD1zxL$h H=DD1RL$hHEHD$xHt$(H|$@tL$h T$lDHHH9HwAL$fA| t";tH=1L$hRALAD$fvdft*fHffHHH9,ITHt$xH|$XHD$f#fHt$xH|$XHHH9ATHt$xH|$X?LLHI L|$ HL$xH1LH|$XLi*HHH9K|$tADHt$xH|$X fff HHH9ATHt$xH|$X:HHH9fI,DHt$xH|$XH*ZHHH9|$tADtfD$pHt$xH|$XSf|$pu;tH=1L$h@6HHH99EtAC&9$Av);tH=D1ML$hAA~HI DLHLHt$H}(E1LL^HIHt$xH|$XLLALD_fHHH9`A~Df.FH,HfH*Ht$xH|$XLLrHItILt$ HL$xH1L:H|$XL8/o;H=1t$ t$ mHfHH H*XI\jHH,H1HVHD$xhH<HD$xWH!HD$xFHHD$x5HHD$x$H~JHD$xHDHD$xHHD$xHHD$xHqHD$xHXHD$xHCHD$xHBHD$xHHD$xHHD$xzft.ft(;tHT$xH=1L$hHHH9ATHt$xH|$XHHH9ATHt$xH|$Xpfioff@gHHH9AT$ADATH H 1HHoIHHH H;WH=1DHXAHD$x^HcHD$xM;tH=C1lL$hH|$x&HiHD$xHkHD$xH:HD$xHHD$xHHD$xHHD$xH˙HD$xHiGHD$xHBHD$xH@HD$xwH[kHD$xfHkHD$xUH0kHD$xDH2kHD$x3H&AHD$x";H=D1=HAHD$xHAHD$xHaGHD$xH=GHD$xHEHD$xH!HD$xH@HD$xHD$tHD$xvDd$8L|$0AuIH5טH163HHD$x,HHD$xHmHD$x H?HD$xHt$xH|$XZHHH9ATAҁv';tH=1L$hA;D$lszT$<_HID|$Ht$H}(LLL谧HIFHt$xH|$XLLA.L&DABD8CD>HI~HIJL8KL>LH)H)DHHiLFHF1Hv1HHGHw)‰fAWAVAUATUSH8H^,L-^,IUHH|$011E1D$IH|$L|$$HHD$(HD$-DHtH^+8KIUH׉n:HT$I}LH@T$$tHHT$T$A9DLHD$(I}sI,$LI ID$HT$ID$?D$$D$ID$jHct$H\$H A DNHH~SL MSH H5SS1APHcSj DPHbSj Pj1VHŘH0L H H5 S1PHj ADPHj Pj1 LL$pH0Mulf.fMH*xyfI*^HH5Jj R1j sAjH DH 褾LKH0MHSHyHHfHH MH*XyLLfHH H*XoEH-QDHH=QH1H=1,H8[]A\A]A^A_f.HH[,H85H[,HÐf.1yfAWAVAUATUSHHDy(AAL!HP1IIHt$IHHu5#K`A9LIPHHEu΋C`Mt0AT$(уuH+[+:C`AL$(H{ AHt$1LtH=ND$1cT$K`H[]A\A]A^A_HZ+8/Hs8H=1 A9LH1[]A\A]A^A_DH{ E1`@H=1H[]A\A]A^A_@Hs8H=]1C`fDE1[AWAVAUATUSH(HHkHP]HTHtHA`Ht @(<ILIIHIGVA$LHI|A$LtzH|$1H|$8fDQHtptkuvQLQPIGA9$Lv7II$PH Q`yIGA9$Lw1H([]A\A]A^A_ÐIGL4LL$A$HH1LN0-7uMMAt;t$IW)Ɖ4SfHFHH([1]A\A]A^A_AIGfH=ɔ:H=3D$1II?T$ H=Ŕ1nI]f.Ht%SHH?7H{H'HC[@Ht/DGHAt At!At+At51DD1@GLGP1+wL2GP1AWAV1AUATUSHhELDŽ$HDŽ$EMPMH$tH$L[`Mt AC(^H$H|$H$1HL$ H|$H\$pH$HH\$xH$LL$@LD$(HT$8LH\$`H$t$LD$PE1D$H\$hfDl$HD{`E#H$tH$H<sL#H=NLnEDc@AH$H$H$HHR$$E0$!D$0!L$L9<DT$4D$EAAT)lj9DBDHk D$KDET$4u$t$9.HT,stH8K6CH|$  żHHSHL$ H@HHHP$$HxHED$|$KE9H|$HXAHS,spH8;1$LL$DHt$DD$0DH7 AHS,spH8b2L%S+A<$$LD$DHt$DHAA<$$$H=W1|ADH|$Hh[]A\A]A^A_Ey$uEuHL$(D$D$9LHD$(HPDD$D$E1ɋKSHt$@H|$(A[PH$!HsH$~H|$8t HSH|$8HH$A2 D$PD$0DŽ$1D$0DH!R+8BH3H=1D{`(fDHQ+8Hs8H==1Nf$NfDA6Dl$LA)sH|$8HCHT$8HL踸HT$@KI4LD$`E1LHRHHL$h"E$H|$vD$Pf.HL$pHT$xHߋt$L:$-H=A4?A<$|$H=1`HtkUSHHHH6HtHhHHsHtHh߼HCH{hHt HChHH{ []f@f.AWAVAUATUSH(HtHHtHItMMu%H=F1GH([]A\A]A^A_:t9u&H=g1H([]A\A]A^A_@MHIMt A8LDH=HtRH蚶HtE111AHuH|$`HL$`q9ADHhxHHhHHD$]LT$HH=&I}T$hHhLLT$@*LT$HIBIH|$`HL$`H HHBHD$`ABABHD$`@ABLLT$ڴLT$HH=#IB8IJHMJ\MBX1LLT$,LT$ABHt7XM_Mb Hl$Lt$1HLLT$LT$2HD$greH=1LT$LT$HLLT$HhL}H=購LT$HLLT$HhL诹CH=&1w+H=61]AJ`HHD$AJ`AJ`H=1L!HL+8H=p1tD$hLHhHPLT$UIHΦHH=܎LT$LHP1DLNH=A1LL|LT$HLlLT$HhLxAB}H=e16\L-YK,I}dL%?K,A<$}M8H1LHIz8HHHHH)HHLT$[LT$HIBhMB8HHLH1~LT$A4$AI}IRhFArpA$%LT$uzA4$IRhAI}LT$FArtA$%LT$:ArtH=1LT$ABtH=]1LT$LT$ArpH=|1͹LT$ABpL=LT${#HIELT${H=‹}LT$ATU1SLHt7DHPH߃L$L=HhLN9LwHPHh3HǃPǃL[]A\fH9I+H:I+H H+HHH+HH OI+HH-I+H1HtHuHH LYt;A<7IcLfO@HHHHHu1Of.Of.Of.OO f.Of.ҸufDH=9H1軷HÐAUATUSHHHHHEIHLl$sHL$E1LƴHH1LH}HHCHu HHHCL`HSHHHHCHh(1H[]A\A]fDLl$HL$E1LAHH{HT$t$H=H[]A\A]H=Y1袶H[]A\A]fHj(H1[]A\A]@ HHCH=}P=fDUSLHHO I h,AQEAȉHHwH??ZY|6~C CCCH[]DCCH[]Ðt~)tluGH= 1豵fu#H F+8tH=X1qH=y1hgDHE+8RH=ى1*?DAWAVAUATUSHxHE+H|$8Ht$(T$8JI@ Ld$PHD$A HD$AHHD$ HD$Ht$\;\$D$0DHD$Ht$Hc,)D$4Hl$(A E1f.BL=LHkL)L1LII8D9HD+89HD$HD$H;D$ MHD$8HL$@HpH8肯L$@HoD+w8H\$8HL$H HsH;KHsH;HL$D5T$@HD$HD$HD$HD$Ht$fD$ HHc \)ˁ;D$0HD$(H$`A E1A L,fDCL=LHjL)L1HIID9HlC+8HcD$DD$HD$D$;D$@>H?C+jHx[]A\A]A^A_f.D$0@fDD$4fDH=1ҵ*D$0L bdHLEHD$t$ H=UIHHD$DP10HB+8 L dH$`뵋t$4H HcHDȋt$0H=L1转H9B+8H c͍AHB+ 8H=1sfD8H=81QHA+H=14HA+8xH=h1eH=1(H=h1LD$L$HhA+L$LD$8H=1HAA+L$LD$8HD$8H=Hp1莫LD$L$8H=Ȇ1iH@+f.GHGHG HHLJH)81Hf.@f.SHH?HtH?+HH{Ht θHCH{Ht 踸HC[fDAWAVIAUATAUSH(HHt$mLg(HGL-II)Mc1DL9 HD$ML4(UI_I_A7IcDLfDPЀ ƒ߃AA;;Lt IVA;HL9AuHHILrZI9QA7uH=1LL$袮A?LL$tL1E1Dl$Ld$ HT$(HT$DHT$HT$@H$HT$HHT$HT$HuUHxPI9WPvJHt$(LfD$>ffTHfxHcHLd$ 1I$5HD$H1HD$H1{HD$H1kHD$H@1^HD$HDcD$@DL $LD$DLHA|$@Dt1HD$HDcD$@DL $LD$DLHAa|$@DtHD$HDcD$@DL $LD$DLHA<|$@DtnHD$H\1}HD$HmHD$HHt$LHPHT$H'L$DHT$H\HH9I9GPDcHD$HD$@DL $LD$DLHDjl|$@DtA1HD$HHt$LHPHT$HHPX<L$DHD$HHPTkHT$HHHH9I9GPDcHD$HE1D$DD$@DA9}UL $LD$DLHA|$@DtADl$H=n1DL $LD$DLHDjd|$@DtDl$H=n1D襅RHD$H`1HD$HT1HD$H*1HD$H1{HD$H 1nHD$H1aHD$HHt$LHP L$DHT$HAHH9}I9GPvHD$H1HD$H1 Dl$ff.AWAVAUATAUSHHHD$<@H/HHl$H8HBhH$L C3Ht$HIT$PAH9sH)1HuFLAT$`HtD$PH<$ tH$HPX H[]A\A]A^A_DLAT$`HtD0C3fDt$PuvCHT$HHHH9IT$PH9zAHD$HHJH)1HILAT$`HHHH|$:Lu6D1LuxfDHD$HExZHT$PDxyH$1D1HIH$H=dl1H=k1HH5PcyIGDHLAT$`H]D(C3fDl$:AiHT$HHHH9}I9D$Pw[H=4l1Dr)H=k1DODH=Qk12 Lt$HHD$HHD$DH=1_1T$ jT$ `DDSH|$H5uRdGH=^1o DATUSHH`L%+A<$H۸HT$01E11A HHHChH=H 0RHHD$8_HHtqH*HIAHHHD$HD$HD$HD$ H$"HhkHsH`[]A\DA<$u9HH5QfH`[]A\DH=gQ1ziDH=^1biUSHPHewH H@H@f8@HfHHCH1 fHCHHѾHHHCHftHCHT HCHT HHuHCHHC HCH HS8HHHC@1HS0H]0H[]H]HE HovH]HE DHAWAVAUATUSHXLw0MHGHHD$HHGD$8GInHEDO(I^MnAĉD$,IFM^8MHD$ IF0HHD$IF@HD$HH9II~ HD$,D$(t$(Dd$81H|$IEgEO(L$8T$,I|$(AH|$ fEI^MnM^8I~H|$I~0H|$I~@A+OA+WAO AW u @HX[]A\A]A^A_fIF(DHH)H9yHI~ fHHH9u|$,Ht$Ht$HHHf.p HH9@1HuDd$81D$(@I~HHH9D$Lߋt$8H)HDEDL$<AL|$HDD$0L|$ DD$(D$@AADL$(LL$HHjDfH IEL9} EDBHHjDfH IEHL)D)IHD!ffIvHHHfL$0L$<ff9MHD9}IA)LH H HHuDHEL|$ DD$(E1LL$L|$HEDL$<1x@|$(tAL;\$v:II D|$0EAA HHL$DL9HI9}Ht$I3N AK vL9fAssH AK IL9\$sC|$@tEHHMAT$H IEH~AHfHD$@IHH1LпAHD$A fILODAIILHHHHL$+ILODAIILHHINHHL$ffA AHMVHDHID@HL$t$,H|$)Ήt$(HH)Hx HH9@9HuIF DGED$8fDL|$ DD$(HLL$L|$HEDL$<1WHL HD$D$8OEBHHH IEHILhILffHHJDFH IEH~DHL|$ DD$(ALL$L|$HEDL$<1H*L|$ DD$(LL$L|$H8DL$/uD@HH9wHIu@HxH\_HtIT$HBID$HX[]A\fD[]A\@HHtIT$HP8IT$HB0A$$ID$[]A\ATUISHH>uHsHNHNI $HSHj[]A\f.AUATIUSIHHHL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$H$HLLHD$HD$ D$D$ 0HD$+uHuHT$LDH}L1IH[]A\A]@HHT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$H$HT$HD$HD$ D$D$ 0HD$HÐATUISHHHHWHBHrH)H9r;HHzHHBH|$HLaHt8HD$HE1H[]A\@HT$HuH|$1ff.ATUISHHHQLHH[]A\HPEDHHGHVHP0HFHWHP8HFHGHb1Hf.~GHcЃH01f~HH0f1f.AVAUIATUHSD(E~bAFHLǰ HL9t'H3HXuAE[]A\A]A^fA~[AE]A\A]A^HRHt Ic(HIͨ1A(문륋(~0SH(HHǨ2aHc(HDŽè[@(~HHǨ1f.S(Hw1OHKHc HHHcHJH1FH[HHcHIH1FHHcHIH1eFHHcHIH1EFHcHJH1,Ff.HcHJH1 FbHcHvJH1EBHcHIH1E"HcHHIH1EHHcHHH1EHHcHtHH1eEHHcHHH1EEHHcH?IH1%E{HHcHGIH1E[HHcHGH1D;HHcHGH1DHHcHIH1DHcHaHH1DHHcH?H1eDHcHGH1LDHFH;GPsH1ɺW`HtHHںںHںںHFH;GPsH1ɺW`HtHHںںHںںHFH;GPsH1ɺW`HtH@HںںHںںHFH;GPs&H1ɺW`HtHHf.HںںHںںfHFH;GPs&H1ɺW`HtHHf.HںںHںںfHFH;GPsH1ɺW`HtHcHHںںHںںAWAVAAUATUSHHoLD$(L*H|$ Ht$H$A"H$L5SHL$E1D$<1IںںH|$0uEIcLuH=G1DL$LD$MDL$LD$T$<1H[]A\A]A^A_CDL$HHcӁ?LD$HT$D$@HT$LD$DL$H \$@HDŽE~AA HA(SDL$HLD$Hc‰T$HCHc=?H/ VMHT$LD$HDL$HCDL$HLD$Hc=?HHT$H$Hx(HT$LD$DL$HH/CDL$HLD$Hc=?HHT$H$Hx(cHT$LD$DL$HHCDL$HLD$Hc=?HHT$,H$Hx(HT$LD$DL$HHCDL$HLD$Hc=?HHT$H$Hx(HT$LD$DL$HH'CDL$HLD$Hc=?HHT$|H$Hx(+HT$LD$DL$HHCDL$HLD$Hc=?HHT$$H$Hx(HT$LD$DL$HHw?H<$HcÃHWHIf?H<$HcÃHHf.C@HHCHHnH9}+H@CHc=?HCL9tHmHDCHMHcL9\=? H}DHEH?HDPHcӃHL@HEHHcHHTP(HEHHcHHTPHEHHDPf.HEHHDPDHHcHL9HHD$ H|$D$<HW8fDHEH?H|$@0HcӃHO8HIfHcHL9 H|$ H|$HW(H411Ґ@(<HcHL9uۍsHcHL9 ?LHcH9@HKHcHL9 H|$ Ht$?Hv0H4H  HcHHc(HtH ;F ?HˋDHD[IcHCHcD$L9Ht{L9tvCHLHD$ HD$H@0HHtPIcR(LTMtBAZt:ABH9~(H9|,CIR MT I9tH9` H9 |$?HDŽDUDD[HcHL9trIcHHD$ 0HD$H@0HHtNHcw(HDHt@pLPt5xH9 |'H I|0H9 HH9|H9u??HDŽDCHc=?H HD$ HcI(0HD$H@(H<HXCHc=?HHD$ HcI(0HD$H@HHKHcHL9h 0@K@ H@ H( ?EH@H$Hu1DL$LD$HHx HLD$DL$ ?HcӃH]DHuHH~0HD$0HDHHcHHHI9u)D[DL$LLD$@H4$H|$0McD\$HJLT$HHL$Q0D\$HA?RHL$LT$LD$@DL$LHA(JfHEH? fC=?HHcHHL95L9,H|@C=?HHcHHL9L9H<@SHcʁ?HZHL9HHEH@C=?.HcHcHHL9DL9;HHHmDC=?HcȃHHcHL9L9HH\DC=?HHcHHL9L9H'C=?NHHcHHL9L9H)C=?HHcHHL9QL9HHSHcHL91?1Ҁ9HSHcHCHcHL9.L9%=?DL$HLD$T$MdFDSHcHCHcHL9L9=?DL$HLD$T$ FfSHcˁ?HcHHL9AL9D!E1H9AL!H @SHcˁ?HcHHdL9AL9D!E1H9AL!H@SHcˁ?HcHH L9AL9D!E1H9AL!H\@SHcˁ?HcHHL9AL9D!E1H9AL!H@SHcˁ?HcHH\L9AL9D!E1H9AL!H@SHcˁ?HcHHL9AL9D!E1H9AL!HT@SHcHL91?1HHC=?HHcHHL9L9H1SHcHcHHL9L9&?H H@SHcHcHHL9lL9c?H!H4H ;H5c7H=7e4DHںںI1DL$LD$JHt$(HBEDL$fA*f.E1LD$=?6HںںH?H@ H|?i?HںںHDHںںHںں]fDHH9fD?L?gHDŽ7H=51LD$L$'uH{H9t(H >tH[HuH1[]A\A]fDHCH[]A\A]ÐAWAVIAUATIUS IHAHFHt}LH7HHHtuH7HHCLL{45L1HA5HD1E1AuIDHPHSHXHD[]A\A]A^A_fLHCL{4L10fDH;EHEfD w(H5HcHH>E@f.>"tHtvSH,H)[H1Q't~0,tЀ\u6y\HQuHHtH"u HtÐHf.H3AWAVHcAUATIUH*SHHXH,H|$Ht$1H:HD$I$HH=AHl$ D$PA9DAEHE)AAJEŸJDOE9L=M8HDC4HAGD9u4At.H=:*IcƍiH41Ht Hr/HcAE9u-H'4HcHHX[]A\A]A^A_@HFC 1Ll$IrHT$L;*wfHD$1H(HHE<%CuNLeHt$ K$LLHD$8>L;|$ItLHD$ @LL$ K$H\Ol)HDH9jLL$ IAH- =McBLEA|$pT$4wH24HcJ9H;BwHcD$A=4D$(|$(ua|$Ht$HDLD$( AD$LD$(u7fDI9t{H2LHIB<LFtEAtAAwHk3McfBH$H;|$0t>H( []A\A]A^A_H0HcD@HL$@ )AlL$8HcMtwpH.JcHMuL,-HAE<^<=<uH5]>Lo'HD$@MuD$8HL$@HHH)Hy0I)LMmLrH 9 JH4BvGH8D4BH$fHcH;:DH;<\H5Y1Hcf; VuH4D4PfH;D D$(;Ht$PH|$XDHLD$8DL$(DL$(LD$8H<6Ht$H|$D$(LD$8#D$(LD$83Hi8BAD9L$wfD1D$.H3D4HDED$(D$ID$(H$IEH$Ht$H|$LD$("LD$({M1HT$Ht$H|$HLD$@L$8*LD$@D$L$8aE1MuI};HD$HMuEuIuH|$gBI}v;qAfA[M]M ]MKEuBA}GLt$H5AI*AFHt$H|$1!D$8HHH)LI)FtEOAE<<uHD$H5?CH)HD$@H|$1H[!IUEE1ɾH|$II}Il:McLAE<<uHD$H5?H()AE<<kHD$H5?H(IAE<2<4HD$H5v@H(AuH|$IMIU ?DI}I9I}9MrIuH|$GHL$AI}`9HL$y>AHI}?9HD$D@EH|$11Ҿb?HL$AAIUH|$1ɾ>HL$AtAE<<HD$H5C@H'H|$1Ҿ-<>HL$AAjAE<<HD$H5=HB'IUIMH|$BI}I"8I}8MH|$IMIUAuBI}IIAE<0<&HD$H5>H&H|$HL$AHD$1Ҿ. H|$&=HL$AWIuH|$!EHL$AI}E7HL$q# AE<p<fHD$H5`>H%DAE<</HD$H5=H% AE<v<HD$H5:H%IuHt >HD$HvHP%HD$@%I}C6HD$@3Hl$1HںںH;H55H<HD$ H|$1Hںں;AE<[< HD$H5g=H$AE<6<HD$H5X=H_$AWHD$E1HǀH?AE<<|HD$H5=H$ZAE<<EHD$H5=H##AE< <HD$H5=H#AE< <HD$H5=H`#IuH|$DI}D$hH4D$hIMIUMMMEAuH|$?I}ЉD$h4D$hHD$MupAE< <'HD$H5!<H"IUE11ɾIUALt$HD$`1ɺ0IHHH@H@H@H@ H@(DŽ$AFIEHL$HHMuIEIUE1H|$HHoBAE< </HD$H5;H! 11H|$8HL$AAA} HD$H58LL]!HD$@A}AHH|$1ɺ0HL$AI}*HD$P A1ɺ7)HD$hIAE<<<uH|$hH5)H|$hfDH=I|Aq1A} AE<~AE<qH|$1ҾA.'H|$1Hںں.HD$ MHt$H|$H(|$fDM1H$H;|$0tLD$8DL$((LD$8DL$(H$LD$8DL$("HH$DL$(LD$8tH|$1ҾA_,f.AE<iH|$1ҾA/,f.H|$1ҾA ,_AE<H|$1ҾA+9AE<NH|$1ҾA+f.HL$H|$+HcHX1+,AE<H|$1ҾAe+H5'LHD$@'|H|$1Ҿ%+HL$AIUHR LrIuAE<H|$1ҾA*0IuH|$!}3HL$A<YH|$hH5[b>H|$hH5&#H|$hH5FHD$Iu1H8 HIHD$HT$`IuHHL$AH$H|$1ɾ*HL$A@HD$DXEH|$1Hںں)HL$Au@ H5EL6 <H51aL 1Ҿ4$1Ҿ3AE<H|$1ҾA')zfDQEY,H|$1ɾ&UHc5)H|$U1ɾ&Hc)HL$`H|$Hcվ()Ht$H$HcHHփHXHǂxHD$@ 1Ҿ/$1Ҿ0AE<1Ҿ5GHL$`H|$Hcվ(Q(zAE<oH|$1ҾA'>fDAE<<<}<mHD$H5w&HKHD$H5&H(H|$1ҾAj'AE<AH|$1ҾAD'AE<bH|$1ҾA'jfAE<H|$1ҾA&Bf.H 9H5 H=  HD$A@H% HD$A@fHD$1Ҿ6@Lt$IUL(AFu%I}H|$1Hcо&HL$AIELp(ff.H~Ðf.H~Ðf.G|ff.~|ff.HHKf.HSH1HHHxHHǀHH)1HHH@(H@H@ H@@@H@L@T@XH@`H@H@1[D[fD [fDATUHSHHHHH濘HHHxHHǀHH)1HHH3/HH@(H@H@ H@@@H@L@T@XH@`H@H@HĠ1[]A\f. HĠ[]A\@ HĠ[]A\@f.f.Ht[USHHF(Ht HVHH;8t/G HHuHHH[]HDH@f.HG(Ht{SHWHHHH =I$I$1 cHI$H5HH I$H I$H*H=I$H^HEI$H8I$I$)HI$HH$ cI$I$HI$HHtl$ .I$I$HI$H8t9 I$I$HI$ H:H4$HL1I$HHt$I$HH= Ht$>u [fI$HHHHHVI$f>u#".!$I$HT$H5Hx1 I$HH HHJHD$PI$fI$HHt$I$HH= Ht$>uOfDI$HHHHHVI$f>uI$HH1 HHJHI$I$HHHHI$RI$fI$HH HHJH/I$faI$f{ HI$AD$LH H@I$Pi s7xs-I$H{HcI$HVI$HH4$HLH4$HL1I$HHt$I$HH= Ht$>u JI$HHHHHVI$f>uI$P^H4$HHL@1fI$3HcHH \S@I$HxHHc!I$H(I$E1HHI$fDAD$LVI$E1HHI$fDAD$L'H4$HLk1"MLd$A@0A$Ic@hM`pADEZIct$8IL$I$4H|$HI+$D$,AD$0IT$ID$(HHDA8Eu6QAT$4IT$HHIT$ID$(H@8IT$ID$(H Ict$4LAID$@I0H9I|0I$H9H8y4H)RHMIc@4LLD$HAI@@^LD$HADEIM`@H|$@fD320/.,z-pf\RH>4AD$L LHHD$SHtHH|$LdID$(HtIT$H<1MAL$0Md$@&%$ #ukaW)M*C49(/'%I$HHI$1fAD$LD$ ~"1 A H9D$ IT$ID$(H Ѓy8D$ AIT$@MIeAD$AD$LLD$8Hc9HID$LD$8tGLcd$0IHJ I@(IP@L$ȋD$ AD$vI|$AL$ H)HT$0uID$H5 LLD$8ID$LD$8KH5LhPIAD$@LMċQ$= OljD$0HcT$ E1H<D HL$@HT$HI|$It$(AH4HvHD9D$0~TI|$DD$8HT$HHL$@hDD$8uI|$DD$0DD$0tH5S LDD$0DD$0ED$4DIL$ID$(HȉPAD$4AAT$41Ʌu+D$ IT$ID$(H@8AT$4I|$It$(D$ H4LA;AAD$4HHHRID$(IT$HIcD$4HRDIT$ID$(HHHrI$MuRHH4$H L4I$H5HHI$H  HcD$,LLd$HIt$@LD$IM`@H|$A $XIyL$@LLL$8HcD$0DLL$8L$@IAIT$ID$(HHxu%H5S LL$8IT$ID$(L$8HЋT$0PIt$IT$(D$ AD$4H4I|$LAT$4O H4$H@LI$H5MHHHT$HHHT$I$H|$H H1HT$H4$LH4$HLkLD$PPH4$HLI*H5 LHT$0LD$ ID$(IL$I$HT$0LD$ H ID$@HcD$,LLd$I$ID$@HcLD$ATuM`@ftA@hM`p sHcAHT$1ɾ$LCuH@H0HHL$H觫Cu HD$Ht$ǃP1ɉP$Hǃ 趎Hl$H腉HE(HH NH1{C2HD$HH HT$HHD$H aH=@f.AUATIUSHAHA}$Ht^LH3HIt31H¾HAtAeA1HAMCH[]A\A]f.A}uHcxf1ɾ)H1AHAtHHHu&DHƉPH0.HtPtt@@H[]A\A]ÐAVAUEATUASIHHH(HT$HI1AfCuHD$HLHP7Cu`HHD$tFHHPHCuw@IuHh[]A\A]f.Hl$LHH$TtS$PHLl$tSHLLH$P҉u݃Hh1[]A\A]DŽ$T뚋fAWAVAUATAUSH>>-HHD$ H{H1HHǃ@HH)HHD}EtoL-ha+IcH$A#HIDw9AWAVIAUATIUSHx@u"0FHx[]A\A]A^A_H\$ LHH$dt{$`L-]+HcLt$HD$M1Ht$HLHINIUHD$AD$$`uɉLA$1PA-DŽ$dImM1fB>wHA~@AWAVIAUATIUSHx@u/0FHx[]A\A]A^A_fDf.Ld$ LLH$d$`AAAHcLLt$L-\+IDHD$ @H;\$t5LHLLHIUHD$D)C$`uL1*fA-DŽ$dAIUL1f.H1ɍPHHf.@@tYH~eHu`Hw1HHNHuC9uHcH ωuH5fHHHtf.1@tPHcHHt fHufDSHc@D@H‰@HLXJI~GDJ11IIfDH H?IIL IHHȃI9uHc@HHHA9~-AA)JTf.HH@H9u@D҉Dt6BHcH<t)f.PHcH<u#Ѕudž@1D[f@D[fAVAUATUHSHP~1IHHHAIHt HLI9t8IH{LHHI@H@HH)HH)ƉHA?A?tpHc@IcADA@II)IHHT~GHHH)1HvfDH:DHIIDHL HBHL!H9u؋@t7HcH<tD$PHcH<Ѕuǃ@1H퉃Dt6H$H}LHHEI$@H@H)H)HHHP[]A\A]A^@H9t6HHHH@H@HBHH)HH)ցHHHtH}HEHDž@1HH)HHHP[]A\A]A^@@DDH"A?HD@AAA@D@9#f.)HcH HcЃ9H ~xHcЃHuEt5A@HcH<t4PHcH<uЅuLJ@1DÉ@DDÁLJ@AVqIAH9t5HLHH@HzHH@HH)H)HHA@A9D1@A?9}f.Hcȃ9Hu@HcHD)HH!<…t.HcH<t0fFHcH<uƅuǂ@1DÉ@DDHzHHǂ@1HH)HсHHfD@9AHA)ARLDIDHcHHHPL9uD9~DfHcЃ9HuIcD@H<Ht2PHcH<uЅuLJ@DÉ@DDHWHHHLJ@1HH)HׁHHD@EuDAWAVIAUATUSHHHL$XHT$@Ht$HH|$Px?Ht$PH|$p1L$` H|$hH@LQ $HH$$H|$HH$HH|$(HH$ Ht$HDŽ$ HH|$0HHt$HHDŽ$T D9DD$d]D$`Ѓ?)Ѓ?$ $P L|$0D`ELED$A)DIc,$Hl$(DHLHHDpLHuH|$0D,$lD;d$$ DD$$)\$$Hc\$HcHL$H\$#fD\$ \$ l$$9\$$S$9Lc,$HD$L JL9J$L1LD$8D$ HHVLcd$$LD$8HhJDp$DxMcpJH$HcD$ HH$Ht$LJDŽ$H$ZHD$JlpL T$H]1LJ\pH~ HD$H LHLH$` L$h DŽ$贘<$:HDŽ$81>t HD$PDH|$@$ $t6HcH|pt&PHcH|pЅuDŽ$HT$@HD$pHHt$hHzHH@H@HH)H)HH\$dDH|$XH|$(t$`1HHD$H$ @9}HcЃ9HDŽut<HcHtAHcHuDŽ$ 1Ht$X$ H$H~HHHT$(HH)H@H@HH)΁HH1H[]A\A]A^A_H|$(?)‰ӉT$`HH|$0Hf.H|$0LH谖t$$LH|$(LH$ $ f.Lcd$$$1JDpD$ L9HLt3Mt.HIHIH@H)H)΁HI@HH|$@HD$@HxHHHǀ@1HH)HHHt$0LHt$$LHH|$(LHJlp$ $ )$HDH;HxD@EhAWIAVH~AUATUSIHxHHL$H$H|$ 1H|$HADD$`ADD$D$$dDE1LHcHM,Iw1M9r1LLLQHII)ŃHL uHD$HtL(H<$HcT$H| Ht1fDPHcH| 1ЅuDŽ$`D$D$H$$dHD$ HHHHHt$H@H@H)H)ށHH1DHtHH9HHHH@H@HBHH)H)ׁHHHlj1H1f@YHЉHI9uH|$t I#?HD$H8H$H[H1L 1Hx[]A\A]A^A_D1É$`E1yfATUIS1H1IH`H\$HHHLu'A$D9$Tt(HLH߉D$ D$ H`[]A\fDHH}HHUH$PH@H)H)HHމHH`[]A\f.DH1fDHHLJ@HHH1HH)HHx%=HH@HH<@AWAVAAUATIUSHHHHt$HL$(1~ $AAH$1HHD$Ht$8L t4HĘ[]A\A]A^A_f=A~E1=AA렐H\$@1LHHHHLHD$JHHLHHD$EoLHLHLLDHcD$HiHHl$L9tH$HHE1Et.f.HHAAHT$8LHE9u܋D$DT$ 9~mHHL$t$ HiHLHHVAD+t$LLiHIf.HHLHHT$8HL.L9HuHD$1ɽE1D$E1틀@D$ u't$ HcƃH|$@L,ljD$ LMH? u HADD) T$E9ǹuE1DHHAHT$8LHiE9uHct$HHHiHHt$HT$8LH8E1D$+1!fHHDD$$耖HT$8LHDD$$uLt$1IHEHT$8HLHL$(HD$@HH@HyHH@HH)HH)Hމ1HfDHLHHT$8LHJDD$ A9uHHDD$ 評HT$8LHd$DD$ D$D$ t@HHHHH@D4AUATHUSIHHHXDtHX[]A\A]@HƹHHHHH謎uǃDLHHH=L9tǃDf.fSHT+1H:AHHAHh"H H߾[XHZ[@HLJ@HHH1HH)HH1HH2@@ATUHSHI@Ѓ?)EA$@~^HtfHHLHtHLH@u[]A\f.H1!f.DAWAVAUATUSHxD@Ht$ADT@IօD$Ll$0H 1fHITHH9uD$C 9HcЃ9HD0uEDLLl$(H|$ AAIDAIЃD$HHH\$fLHL|$H}E1DILM_HLHLVHHHHLM_HLHLVHHHFHLM_HLHLVHHHFHLM_ HLHLV HHHFHLM_(HLHLV(HHHF HLM_0HLHLV0HHHF(HLM_8HLHLV8HHHF0HLHLHHHHF8HI@H@I9E9~eEILD$DIALMGHLHHHIHHLVE9HLD$tHHHHHVHuHI9ALl$(IcH|$ IL1DHHHA9}EɺAIHcƒHD9T$~+L$)HTf.HH@H9uAA@t1H<t{AAHcH<u^AEuLJ@1Hl$DHH(tHHH%Hx[]A\A]A^A_E11LD$D@DIcEHIL11Ll$0f.@HtSHDHѿIIIHHI)HIHI)HIHI)IHH)H1Hf.@@@DAG9ADMA~XA~:9O~A~2~A~/~A  g+K'Zf.AWAVAUATAUSHHIH@@=DNH9H9HzH1HHǂ@IHH)HEHE}111D|$I@@D@9O)LcA)N LcD9NTD@DALЅBIH1M\IIIAIbIHHM9uMHL9xE@D3DADHcT$I<Ht)DPHcI<ЅuAdž@1M9ADt6II|$LHI$I@I$@I)A$HL)HH[]A\A]A^A_IH1MHL9:Lt$1ELHE@D3DEADNAED$ A@0f.fD@D@HD@@~eH1E1fDL HHAO L HBLH?D9@HD@t!AtH@D@D@IcE9H}AE)JTHH@H9uDDfAVSHH9t8HHHHH@HzHH@HH)H)HH?DA?A)u@D[u@A@E)~׍KH1LTIDH8DHIIDLHHpI9HuHtCAۉ@HcH4IcH<Ht7@HHcH<u ȅuǂ@1DH[A^É@DDH[A^ÉHHT$HT$f.AWAVHAUATAUSHHHHHD$HL$LH\$HHD$8HHHI̹HLD$L|$8Ll$@L\$HLT$Lt$HHLIHHHHHMH\$LLIHHHLIHHHH}LLIHHHLIHHHHIHHHHuLLHd$PHHHLIHHHHIHHHLIHHHHMLLHd$XHHHLHd$PHHHHIHHHLIHHHHD$IHHHH} LLHd$`HHHLHd$XHHHHHd$PHHHLIHHHHD$IHHHHD$IHHHHu(LLHd$hHHHLHd$`HHHHHd$XHHHLHd$PHHHHD$IHHHHD$IHHHHD$IHHHHM0HLLHd$pHHHLHd$hHHHHHd$`HHHLHd$XHHHHD$Hd$PHHHHD$IHHHHD$IHHHHD$IHHHHM8HLLHd$xHHHLHd$pHHHHHd$hHHHLHd$`HHHHD$Hd$XHHHHD$Hd$PHHHHD$IHHHHD$IHHHHD$IHHHHM@HLLH$HHHLHd$xHHHHHd$pHHHLHd$hHHHHD$Hd$`HHHHD$Hd$XHHHHD$Hd$PHHHHD$IHHHHD$IHHHHD$IHHHHMHHLLH$HHHLH$HHHHHd$xHHHLHd$pHHHHD$Hd$hHHHHD$Hd$`HHHHD$Hd$XHHHHD$Hd$PHHHHD$IHHHHD$IHHHHD$IHHHHMPHLLH$HHHLH$HHHHH$HHHLHd$xHHHHD$Hd$pHHHHD$Hd$hHHHHD$Hd$`HHHHD$Hd$XHHHHD$Hd$PHHHHD$IHHHHD$IHHHHD$IHHHHMXHLLH$HHHLH$HHHHH$HHHLH$HHHHD$Hd$xHHHHD$Hd$pHHHHD$Hd$hHHHHD$Hd$`HHHHD$Hd$XHHHHD$Hd$PHHHHD$IHHHHD$IHHHHD$IHHHHM`HLLH$HHHLH$HHHHH$HHHLH$HHHHD$H$HHHHD$Hd$xHHHHD$Hd$pHHHHD$Hd$hHHHHD$Hd$`HHHHD$Hd$XHHHHD$Hd$PHHHHD$IHHHHD$IHHHH$IHHHHMhHLLH$HHHLH$HHHHH$HHHLH$HHHHD$H$HHHHD$H$HHHHD$Hd$xHHHHD$Hd$pHHHHD$Hd$hHHHHD$Hd$`HHHHD$Hd$XHHHHD$Hd$PHHHHD$IHHHH$IHHHHD$IHHHHMpHLLH$HHHLH$HHHHH$HHHLH$HHHHD$H$HHHHD$H$HHHHD$H$HHHHD$Hd$xHHHHD$Hd$pHHHHD$Hd$hHHHHD$Hd$`HHHHD$Hd$XHHHHD$Hd$PHHHH$IHHHHD$IHHHHD$IHHHHMxHLLH$HHHLH$HHHHH$HHHLH$HHHHD$H$HHHHD$H$HHHHD$H$HHHHD$H$HHHHD$Hd$xHHHHD$Hd$pHHHHD$Hd$hHHHHD$Hd$`HHHHD$Hd$XHHHH$Hd$PHHHHD$IHHHHD$IHHHHD$IHHHHHLLH$HHHLH$HHHHH$HHHLH$HHHHD$H$HHHHD$H$HHHHD$H$HHHHD$H$HHHHD$H$HHHHD$Hd$xHHHHD$Hd$pHHHHD$Hd$hHHHHD$Hd$`HHHH$Hd$XHHHHD$Hd$PHHHHD$IHHHHD$IHHHHD$ IHHHHLLH$HHHLH$HHHHH$HHHLH$HHHHD$H$HHHHD$H$HHHHD$H$HHHHD$H$HHHHD$H$HHHHD$H$HHHHD$Hd$xHHHHD$Hd$pHHHHD$Hd$hHHHH$Hd$`HHHHD$Hd$XHHHHD$Hd$PHHHHD$IHHHHD$ IHHHL$HD$(IHHHHLLIHHHLH$HHHHH$HHHLH$HHHHD$H$HHHHD$H$HHHHD$H$HHHHD$H$HHHHD$H$HHHHD$H$HHHHD$H$HHHHD$Hd$xHHHHD$Hd$pHHHH$Hd$hHHHHD$Hd$`HHHHD$Hd$XHHHHD$Hd$PHHHHD$ IHHHLD$0HD$(IHHHLIHHHHLLIHHHHH$HHHLH$HHHHD$H$HHHHD$H$HHHHD$H$HHHHD$H$HHHHD$H$HHHHD$H$HHHHD$H$HHHHD$H$HHHHD$Hd$xHHHH$Hd$pHHHHD$Hd$hHHHHD$Hd$`HHHHD$Hd$XHHHHD$ Hd$PHHHHD$(IHHHLIHHHHLHIHHHLH$HHHHD$H$HHHHD$H$HHHHD$H$HHHHD$H$HHHHD$H$HHHHD$H$HHHHD$H$HHHHD$H$HHHHD$H$HHHH$Hd$xHHHHD$Hd$pHHHHD$Hd$hHHHHD$Hd$`HHHHD$ Hd$XHHHHD$(Hd$PHHHLIHHHHLLIHHHHD$H$HHHHD$H$HHHHD$H$HHHHD$H$HHHHD$H$HHHHD$H$HHHHD$H$HHHHD$H$HHHHD$H$HHHH$H$HHHHD$Hd$xHHHHD$Hd$pHHHHD$Hd$hHHHHD$ Hd$`HHHHD$(Hd$XHHHLHd$PHHHHLHD$IHHHHD$H$HHHHD$H$HHHHD$H$HHHHD$H$HHHHD$H$HHHHD$H$HHHHD$H$HHHHD$H$HHHH$H$HHHHD$H$HHHHD$Hd$xHHHHD$Hd$pHHHHD$ Hd$hHHHHD$(Hd$`HHHLHd$XHHHHLHD$IHHHHD$H$HHHHD$H$HHHHD$H$HHHHD$H$HHHHD$H$HHHHD$H$HHHHD$H$HHHH$H$HHHHD$H$HHHHD$H$HHHHD$Hd$xHHHHD$ Hd$pHHHHD$(Hd$hHHHLHd$`HHHHLHD$IHHHHD$H$HHHHD$H$HHHHD$H$HHHHD$H$HHHHD$H$HHHHD$H$HHHH$H$HHHHD$H$HHHHD$H$HHHHD$H$HHHHD$ Hd$xHHHHD$(Hd$pHHHLHd$hHHHHLHD$IHHHHD$H$HHHHD$H$HHHHD$H$HHHHD$H$HHHHD$H$HHHH$H$HHHHD$H$HHHHD$H$HHHHD$H$HHHHD$ H$HHHHD$(Hd$xHHHLHd$pHHHHLHD$IHHHHD$H$HHHHD$H$HHHHD$H$HHHHD$H$HHHH$H$HHHHD$H$HHHHD$H$HHHHD$H$HHHHD$ H$HHHHD$(H$HHHLHd$xHHHHHLHD$IHHHHD$H$HHHHD$H$HHHHD$H$HHHH$H$HHHHD$H$HHHHD$H$HHHHD$H$HHHHD$ H$HHHHD$(H$HHHLH$HHHHHLHD$IHHHHD$H$HHHHD$H$HHHH$H$HHHHD$H$HHHHD$H$HHHHD$H$HHHHD$ H$HHHHD$(H$HHHLH$HHHHHLHD$IHHHHD$H$HHHH$H$HHHHD$H$HHHHD$H$HHHHD$H$HHHHD$ H$HHHHD$(H$HHHLH$HHHHLHD$IHHHH$H$HHHHD$H$HHHHD$H$HHHHD$H$HHHHD$ H$HHHHD$(H$HHHLH$HHHHLH$IHHHHD$H$HHHHD$H$HHHHD$H$HHHHD$ H$HHHHD$(H$HHHLH$HHHHLHD$IHHHHD$H$HHHHD$H$HHHHD$ H$HHHHD$(H$HHHLH$HHHHLHD$IHHHHD$H$HHHHD$ H$HHHHD$(H$HHHLH$HHHHLHD$IHHHHD$ H$HHHHD$(H$HHHLH$HHHHLHD$ IHHHHD$(H$HHHLH$HHHH LHD$(IHHHLH$HHHH(HLIHHIH0H8HD$Dž@(DHD$3DHDu7Dž@'H(HȺ&HHHu@u1DH[]A\A]A^A_f.fAWAVHAUATIUSHIH HD$HL$HLL$HHD$XHHLH˹HIILd$XLT$`Ll$Hl$LL$HILIHHILI LD$hHLIHHHHIHHHLIHHII{H|$HIHHILIHHIIsHt$pLHHIIHIHIILIHIIHIHIIIKHLHd$xIIHHHIIHLIIIHHIIIHHD$IIIHMs ILH$IHIHHd$xIHILHIHIHIIHIHD$IIHIHD$IIHIM{(ILH$HIIHH$HIILHd$xHIIHHHIIHD$IHIIHD$IHIIHD$IHIIIK0LILH$HIIHH$HIILH$HIIHHd$xHIIHD$HHIIHD$IHIIHD$IHIIHD$IHIIIK8LILH$HIIHH$HIILH$HIIHH$HIIHD$Hd$xHIIHD$HHIIHD$IHIIHD$IHIIHD$IHIIIK@LILH$HIIHH$HIILH$HIIHH$HIIHD$H$HIIHD$Hd$xHIIHD$HHIIHD$IHIIHD$IHIIHD$IHIIIKHLILH$HIIHH$HIILH$HIIHH$HIIHD$H$HIIHD$H$HIIHD$Hd$xHIIHD$HHIIHD$IHIIHD$IHIIHD$IHIIIKPLILH$HIIHH$HIILH$HIIHH$HIIHD$H$HIIHD$H$HIIHD$H$HIIHD$Hd$xHIIHD$HHIIHD$IHIIHD$IHIIHD$IHIIIKXLILH$HIIHH$HIILH$HIIHH$HIIHD$H$HIIHD$H$HIIHD$H$HIIHD$H$HIIHD$Hd$xHIIHD$HHIIHD$IHIIHD$IHIIHD$IHIIIK`LILH$HIIHH$HIILH$HIIHH$HIIHD$H$HIIHD$H$HIIHD$H$HIIHD$H$HIIHD$H$HIIHD$Hd$xHIIHD$HHIIHD$IHIIHD$IHIIH$IHIIIKhLILH$HIIHH$HIILH$HIIHH$HIIHD$H$HIIHD$H$HIIHD$H$HIIHD$H$HIIHD$H$HIIHD$H$HIIHD$Hd$xHIIHD$HHIIHD$IHIIH$IHIIHD$IHIIIKpLILH$HIIHH$HIILH$HIIHH$HIIHD$H$HIIHD$H$HIIHD$H$HIIHD$H$HIIHD$H$HIIHD$H$HIIHD$H$HIIHD$Hd$xHIIHD$HHIIH$IHIIHD$IHIIHD$IHIIIKxLILH$HIIHH$HIILH$HIIHH$HIIHD$H$HIIHD$H$HIIHD$H$HIIHD$H$HIIHD$H$HIIHD$H$HIIHD$H$HIIHD$H$HIIHD$Hd$xHIIH$HHIIHD$IHIIHD$IHIIHD$IHIIILILH$HIIHH$HIILH$HIIHH$HIIHD$H$HIIHD$H$HIIHD$H$HIIHD$H$HIIHD$H$HIIHD$H$HIIHD$H$HIIHD$H$HIIHD$H$HIIH$Hd$xHIIHD$HHIIHD$IHIIHD$IHIIHD$ IHIIILILH$HIIHH$HIILH$HIIHH$HIIHD$H$HIIHD$H$HIIHD$H$HIIHD$H$HIIHD$H$HIIHD$H$HIIHD$H$HIIHD$H$HIIHD$H$HIIH$H$HIIHD$Hd$xHIIHD$HHIIHD$IHIIHD$ IHIIHD$(IHIIILILH$HIIHH$HIILH$HIIHH$HIIHD$H$HIIHD$H$HIIHD$H$HIIHD$H$HIIHD$H$HIIHD$H$HIIHD$H$HIIHD$H$HIIHD$H$HIIH$H$HIIHD$H$HIIHD$Hd$xHIIHD$HHIIHD$ IHIIHD$(IHIIHD$0IHIIILILH$HIIHH$HIILH$HIIHH$HIIHD$H$HIIHD$H$HIIHD$H$HIIHD$H$HIIHD$H$HIIHD$H$HIIHD$H$HIIHD$H$HIIHD$H$HIIH$H$HIIHD$H$HIIHD$H$HIIHD$Hd$xHIIHD$ HHIIHD$(IHIIHD$0IHIIHD$8IHIIILILH$HIIHH$HIILH$HIIHH$HIIHD$H$HIIHD$H$HIIHD$H$HIIHD$H$HIIHD$H$HIIHD$H$HIIHD$H$HIIHD$H$HIIHD$H$HIIH$H$HIIHD$H$HIIHD$H$HIIHD$H$HIIHD$ Hd$xHIIHD$(HHIIHD$0IHIIHD$8IHIIHD$@IHIIIHLH$IIHHH$IIHLH$IIHHH$IIHHD$H$IIHHD$H$IIHHD$H$IIHHD$H$IIHHD$H$IIHHD$H$IIHHD$H$IIHHD$H$IIHHD$H$IIHH$H$IIHHD$H$IIHHD$H$IIHHD$H$IIHHD$ H$IIHHD$(Hd$xIIHHD$0HIIHHD$8IIIHHD$@IIIHHD$HIIIHMIHLH$IIHHH$IIHLH$IIHHH$IIHHD$H$IIHHD$H$IIHHD$H$IIHHD$H$IIHHD$H$IIHHD$H$IIHHD$H$IIHHD$H$IIHHD$H$IIHH$H$IIHHD$H$IIHHD$H$IIHHD$H$IIHHD$ H$IIHHD$(H$IIHLl$PHD$0Hd$xIIHHD$8HIIHHD$@IIIHHD$HIIIHLIIIHIMHH$IHILH$IHIHH$IHIHD$H$IHIHD$H$IHIHD$H$IHIHD$H$IHIHD$H$IHIHD$H$IHIHD$H$IHIHD$H$IHIHD$H$IHIH$H$IHIHD$H$IHIHD$H$IHIHD$H$IHIHD$ H$IHIHD$(H$IHIHD$0H$IHIHD$8Hd$xIHIHD$@HIHIHD$HIIHILIIHIIMLH$HIIHH$HIIHD$H$HIIHD$H$HIIHD$H$HIIHD$H$HIIHD$H$HIIHD$H$HIIHD$H$HIIHD$H$HIIHD$H$HIIH$H$HIIHD$H$HIIHD$H$HIIHD$H$HIIHD$ H$HIIHD$(H$HIIHD$0H$HIIHD$8H$HIIHD$@Hd$xHIIHD$HHHIILIHIIIHHH$IIHHD$H$IIHHD$H$IIHHD$H$IIHHD$H$IIHHD$H$IIHHD$H$IIHHD$H$IIHHD$H$IIHHD$H$IIHH$H$IIHHD$H$IIHHD$H$IIHHD$H$IIHHD$ H$IIHHD$(H$IIHHD$0H$IIHHD$8H$IIHHD$@H$IIHHD$HHd$xIIHLHIIHHMHD$H$IHHHD$H$IHHHD$H$IHHHD$H$IHHHD$H$IHHHD$H$IHHHD$H$IHHHD$H$IHHHD$H$IHHH$H$IHHHD$H$IHHHD$H$IHHHD$H$IHHHD$ H$IHHHD$(H$IHHHD$0H$IHHHD$8H$IHHHD$@H$IHHHD$HH$IHHLHd$xIHHHMHHD$H$HHHHD$H$HHHHD$H$HHHHD$H$HHHHD$H$HHHHD$H$HHHHD$H$HHHHD$H$HHHH$H$HHHHD$H$HHHHD$H$HHHHD$H$HHHHD$ H$HHHHD$(H$HHHHD$0H$HHHHD$8H$HHHHD$@H$HHHHD$HH$HHHLH$HHHIHHHD$H$HHHHD$H$HHHHD$H$HHHHD$H$HHHHD$H$HHHHD$H$HHHHD$H$HHHH$H$HHHHD$H$HHHHD$H$HHHHD$H$HHHHD$ H$HHHHD$(H$HHHHD$0H$HHHHD$8H$HHHHD$@H$HHHHD$HH$HHHLH$HHHIHHHD$H$HHHHD$H$HHHHD$H$HHHHD$H$HHHHD$H$HHHHD$H$HHHH$H$HHHHD$H$HHHHD$H$HHHHD$H$HHHHD$ H$HHHHD$(H$HHHHD$0H$HHHHD$8H$HHHHD$@H$HHHHD$HH$HHHLH$HHHIHHHD$H$HHHHD$H$HHHHD$H$HHHHD$H$HHHHD$H$HHHH$H$HHHHD$H$HHHHD$H$HHHHD$H$HHHHD$ H$HHHHD$(H$HHHHD$0H$HHHHD$8H$HHHHD$@H$HHHHD$HH$HHHLH$HHHIHHHD$H$HHHHD$H$HHHHD$H$HHHHD$H$HHHH$H$HHHHD$H$HHHHD$H$HHHHD$H$HHHHD$ H$HHHHD$(H$HHHHD$0H$HHHHD$8H$HHHHD$@H$HHHHD$HH$HHHLH$HHHIHHHD$H$HHHHD$H$HHHHD$H$HHHH$H$HHHHD$H$HHHHD$H$HHHHD$H$HHHHD$ H$HHHHD$(H$HHHHD$0H$HHHHD$8H$HHHHD$@H$HHHHD$HH$HHHLH$HHHIHHHD$H$HHHHD$H$HHHH$H$HHHHD$H$HHHHD$H$HHHHD$H$HHHHD$ H$HHHHD$(H$HHHHD$0H$HHHHD$8H$HHHHD$@H$HHHHD$HH$HHHLH$HHHIHHHD$H$HHHH$H$HHHHD$H$HHHHD$H$HHHHD$H$HHHHD$ H$HHHHD$(H$HHHHD$0H$HHHHD$8H$HHHHD$@H$HHHHD$HH$HHHLH$HHHIHHH$H$HHHHD$H$HHHHD$H$HHHHD$H$HHHHD$ H$HHHHD$(H$HHHHD$0H$HHHHD$8H$HHHHD$@H$HHHHD$HH$HHHLH$HHHI HHHD$H$HHHHD$H$HHHHD$H$HHHHD$ H$HHHHD$(H$HHHHD$0H$HHHHD$8H$HHHHD$@H$HHHHD$HH$HHHLH$HHHI(HHHD$H$HHHHD$H$HHHHD$ H$HHHHD$(H$HHHHD$0H$HHHHD$8H$HHHHD$@H$HHHHD$HH$HHHLH$HHHI0HHHD$H$HHHHD$ H$HHHHD$(H$HHHHD$0H$HHHHD$8H$HHHHD$@H$HHHHD$HH$HHHLH$HHHI8HHHD$ H$HHHHD$(H$HHHHD$0H$HHHHD$8H$HHHHD$@H$HHHHD$HH$HHHLH$HHHI@HHHD$(H$HHHHD$0H$HHHHD$8H$HHHHD$@H$HHHHD$HH$HHHLH$HHHIHHHD$0H$HHHHD$8H$HHHHD$@H$HHHHD$HH$HHHLH$HHHIPHHD$8H$HHHHD$@H$HHHHD$HH$HHHLH$HHHIXHHD$@H$HHHHD$HH$HHHLH$HHHI`HHHD$HH$HHHLH$HHHIhHAǃ@0LH$HHHHD$IpIxDHD$3DHADu @HHHu@u1D@9@M@AWHAVHAUATUSIIH`HcH1HHII&HHHǁ@H1HyADA3DHDuHPǁ@1DH`[]A\A]A^A_DIGIWI_Iw MW(M_0MG8MO@IoHMgXHD$HT$IG`IWhH\$Ht$I_pIwxMoPH?L$L\$LD$LL$Hl$ Ld$0HD$8HT$@H\$HHt$PLl$(I6MnMF8MN@IFHIVhMV(LD$MFPLL$MNXM^0HD$LD$MFpIF`LL$MNxHT$LD$E1MfHD$InI^ LT$ML\$LL$MMHHIIILMHIIIIHD$HIIILQMHIIIIHD$IIIIHD$HIIILIMHHIIIHD$IIIIHD$IIIIHD$HIIILYMHHIIIHD$HIIIHD$IIIIHD$IIIIHD$HIIILQ MMHHd$IIIHD$HIIIHD$HIIIHD$IIIIHD$IIIIH$HIIILQ(MMHHd$IIIHD$Hd$IIIHD$HIIIHD$HIIIHD$IIIIH$IIIIHD$HIIILY0MMHHd$IIIHD$Hd$IIIHD$Hd$IIIHD$HIIIHD$HIIIH$IIIIHD$IIIIHD$HIIILQ8MMHHd$IIIHD$Hd$IIIHD$Hd$IIIHD$Hd$IIIHD$HIIIH$HIIIHD$IIIIHD$IIIIHD$HIIILY@MMHHd$IIIHD$Hd$IIIHD$Hd$IIIHD$Hd$IIIHD$Hd$IIIH$HIIIHD$HIIIHD$IIIIHD$IIIIHD$ HIIILQHMMHHd$IIIHD$Hd$IIIHD$Hd$IIIHD$Hd$IIIHD$Hd$IIIH$Hd$IIIHD$HIIIHD$HIIIHD$IIIIHD$ IIIIHD$(HIIILYPMMHHd$IIIHD$Hd$IIIHD$Hd$IIIHD$Hd$IIIHD$Hd$IIIH$Hd$IIIHD$Hd$IIIHD$HIIIHD$HIIIHD$ IIIIHD$(IIIIHD$0HIIILQXMMHHd$IIIHD$Hd$IIIHD$Hd$IIIHD$Hd$IIIHD$Hd$IIIH$Hd$IIIHD$Hd$IIIHD$Hd$IIIHD$HIIIHD$ HIIIHD$(IIIIHD$0IIIIHD$8HIIILY`MMHHd$IIIHD$Hd$IIIHD$Hd$IIIHD$Hd$IIIHD$Hd$IIIH$Hd$IIIHD$Hd$IIIHD$Hd$IIIHD$Hd$IIIHD$ HIIIHD$(HIIIHD$0IIIIHD$8IIIIHD$@HIIILQhMMHHd$IIIHD$Hd$IIIHD$Hd$IIIHD$Hd$IIIHD$Hd$IIIH$Hd$IIIHD$Hd$IIIHD$Hd$IIIHD$Hd$IIIHD$ Hd$IIIHD$(HIIIHD$0HIIIHD$8IIIIHD$@IIIIHD$HHIIILYpMMHHd$IIIH|$HHd$IIIHD$Hd$IIIHD$Hd$IIIHD$Hd$IIIH$Hd$IIIHD$Hd$IIIHD$Hd$IIIHD$Hd$IIIHD$ Hd$IIIHD$(Hd$IIIHD$0HIIIHD$8HIIIHD$@IIIIHD$HIIIIHD$PHIIILLQxLT$HHd$IIHLLHd$IIHHD$Hd$IIHHD$Hd$IIHH$Hd$IIHHD$Hd$IIHHD$Hd$IIHHD$Hd$IIHHD$ Hd$IIHHD$(Hd$IIHHD$0Hd$IIHHD$8HIIHHD$@HIIHHD$HIIIHHD$PIIIHLLHd$IHHL,$L\$LT$LHd$IHHLHd$IHHLHd$IHHHD$Hd$IHHHD$Hd$IHHHD$Hd$IHHHD$ Hd$IHHHD$(Hd$IHHHD$0Hd$IHHHD$8Hd$IHHHD$@HIHHHD$HHIHHHD$PIIHHLd$LMLHd$HHILT$LHd$HHILHd$HHILHd$HHILHd$HHIHD$Hd$HHIHD$ Hd$HHIHD$(Hd$HHIHD$0Hd$HHIHD$8Hd$HHIHD$@Hd$HHIHD$HHHHIHD$PHHHIHLLHd$HIHHl$ L\$LHd$HIHLHd$HIHLHd$HIHLHd$HIHHHd$HIHHD$(Hd$HIHHD$0Hd$HIHHD$8Hd$HIHHD$@Hd$HIHHD$HHd$HIHHD$PHHIHHLLHd$IHHLHd$IHHLHd$IHHLHd$IHHLl$0H\$(HHd$IHHHHd$IHHLHd$IHHHD$8Hd$IHHHD$@Hd$IHHHD$HHd$IHHHD$PHd$IHHLMLHd$HHILT$8LHd$HHILHd$HHIHHd$HHIHHd$HHILHd$HHILHd$HHIHD$@Hd$HHIHD$HHd$HHIHD$PHd$HHIHLLHd$HIHLHd$HIHHHd$HIHHHd$HIHLHd$HIHLHd$HIHLd$@LHd$HIHHD$HHd$HIHHD$PHd$HIHHLLHd$IHHHHd$IHHHHd$IHHLHd$IHHLHd$IHHLHd$IHHL\$HLHd$IHHHD$PHd$IHHLMHHd$HHIHHd$HHILHd$HHILHd$HHILHd$HHILHd$HHIHl$PHHd$HHIHLHHd$HIHLHd$HIHLHd$HIHLHd$HIHLHd$HIHHHd$HIHHLLHd$IHHLHd$IHHLHd$IHHLl$H\$LIIHHǁ@ HHd$IHHLMLHd$HHILT$LIHHILHHHIHIHHILl$HLLIHIHLIHIHHHHIHHLMLIHHIHIHHIHLHIHHIHHEDE3DHDDuEǁ@HHHHHu@ufDE1DDQHHWE1LMIHT$`HD$XHVHLǁ@HHD$hHT$pLHHIHLT$pH9LLIIHHL\$`LHIHHLIHHILAHqHyADA3DHDHǁ@}Hyǁ@hH9ǁ@HOE1H.LFH?I_ML^MWLMǁ@HHIHIL)MHIHIIHHHIIHqLHIIIHLHIHIHILLHIHHLLaHIHHHHLIHHHHyHLIHHIHq Hy(EDE3DHDDǁ@HyHHHH@uDH^HHLGLoLgH\$1HD$HT$HL^LVLD$HIHIǁ@HHIHILLHLL$Hl$ILIHHILHHHIHyHLIHIHLL$LIHIHLHHIHHqHHD$IIHHLIIHHLIIHHHD$HIHHHl$LAILIHHIILILIHIHHIHIHHy LLIHHIHIHHIHy(LHIHHHHq0Hy8EDE3DHDDǁ@Hy(H DHHH@uDHHWH_Hw Lg1M.HT$HD$IM^MVHMN H\$Ht$I^HHIHIHHH9Hl$1HHIHHLIIHHLAE1HIHHIHl$LHHHIHIHHIHq1HD$IHIHLIHIHHHHIHHl$HIHIHHy1HD$IIHHLIIHHHD$IIHHHHIHHHl$HIIHHLA Ll$E1ǁ@ LIHHILd$LIHHILIHHIHHHHIHq(1LIHIHLIHIHHIHIHHy0LE1LIHHIHIHHIHy8LE1HIHHIHq@HyHEDE3DHDD6ǁ@ Hy8H HHH @uDHwHHWH_MW(H Ht$1HD$HT$M.IInM^IMN(H\$H|$I^HLT$MV HIHIILH1Ld$1HD$HHIHLIHIHHy1HD$HIHHLHIHHLd$LIIHHLAE1HD$IHHIHD$HHHILHHHILd$LIHHIHq1HD$IHIHHD$IHIHHD$HHIHLHHIHLd$LIHIHHy 1HD$IIHHHD$IIHHHD$IIHHHD$HIHHLHIHHLd$LIIHHLA(E1HD$IHHILl$ǁ@ LIHHIHD$IHHIHD$HHHILHHHIHl$Hq01LIHIHLl$HIHIHLIHIHLHHIHHy81HIIHHHHLIIHHHLIIHHLA@E1LIHHILIHHIHyHLE1LIHHIHqPHyXEDE3DHDDǁ@ HyHH HHHk@uUDHwHHWH_MNH MW(MG0Mf0Ht$1HT$HD$M.InM^ H\$H|$I^HLT$LD$IMV(Ld$ILL$HIHIILH1Ld$1HD$HIHHLIIHHLAE1HD$IHHILHHHILd$LIHHIHyI1LHD$HIHHMLL$HD$Hd$IHHLHIHHLd$LIIHHLAE1LIHHIHD$HHHIHD$Hd$HHILHHHILd$LIHHIHq 1LIHIHHD$IHIHHD$HHIHHD$Hd$HIHLL$LHHIHLd$LIHIHHy(1HD$IIHHHD$IIHHHD$IIHHHD$HIHHHD$Hd$IHHLHIHHLd$LIIHHLl$LA0E1HD$IHHILIHHIHD$IHHIǁ@HD$HHHIHD$Hd$HHILHHHIHl$Hq81LIHIHLl$HIHIHLIHIHHD$HHIHLHd$HIHHy@1HIIHHHl$LIIHHHIIHHLHIHHLAHE1LIHHIHLE1HIHHHLIHHHHYPHIHHILIHHIHyXLE1LIHHIHq`HyhEDE3DHDDǁ@ HyXH f.HHH@uDHWHGHLWMG(H M_0MO8Hn LnLfH|$LD$I~0MF8L\$LL$LLNHv(Hl$1HT$HD$H|$HHt$LD$HILl$HIHIHH1HHIIHHLIIHHLAIHIHHILIHHIIHD$IHIIHyLHHIIHHLHd$IHHHD$IIHHHD$IIHHHD$Ld$ILiILl$HHHHIILLHd$HHIILLHd$HIHHD$IHIHILHD$IIHHHT$LA IIHIHHIMLHd$HHILHd$HHILl$HD$Hd$HHIHD$IHHIHD$IHHIHq(HHIHIHLHd$HIHLHd$HIHHD$Hd$HIHHD$Hd$HIHLd$HD$IHIHHD$IHIHHy0HHIIHHH\$LIIHHHHd$IHHHD$Hd$IHHHD$Hd$IHHHD$Hd$IHHHD$IIHHHD$IIHHL\$LA8ILIHHILT$HIHHILHd$HHILHd$HHIHD$Hd$HHIHD$Hd$HHIHD$IHHIHq@HHIHIHLIHIHLHd$HIHLL$H\$HHd$HIHLHd$HIHHD$Hd$HIHHyHHLIIHHLT$LIIHHHHd$IHHLHd$IHHLHd$IHHLAPILIHHIL\$HIHHILIHHILHd$HHIHqXHHIHIHLIHIHLIHIHHy`Lǁ@ILIHHILIHHIHyhLLIHHHHqpHyxEDE3DHDDǁ@HyhH @HHH@uuDMG(Mo@HWM_0Io8HGLD$MF0Ll$Mn@L'H_LNLVH HT$L\$IV(L^Hl$LD$H.MF8Hv Ll$E1HT$HD$H|$LHt$LD$LMLHHIHH1LLIIHHHHIHHLALT$MLIHHIHIHHIILL$HD$HHIIHyLLLD$LIIHHHHd$IHHLIIHHHD$HIHHHD$LQMILIHHIHHd$HHILHd$HHIILLL$HD$IIHHILHD$HIIHHT$LQ ILIIHHHHd$IHHLHd$IHHLT$HD$Hd$IHHHD$IIHHHD$HIHHLA(MLIHHIHHd$HHILHd$HHIHD$Hd$HHIHD$Hd$HHIHD$IHHIHD$HHHIHq0Ht$HLHD$LHd$HIHHIHIHLHd$HIHHD$Hd$HIHHD$Hd$HIHHD$Hd$HIHLL$HD$IHIHHD$HHIHHy8LLIIHHLd$HHd$IHHLIIHHHD$Hd$IHHHD$Hd$IHHHD$Hd$IHHHD$Hd$IHHHD$IIHHHD$HIHHHl$LA@MHIHHIH\$LHd$HHIHIHHIHHd$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIHD$IHHIL\$HqHLLIHIHLd$HHd$HIHHIHIHLHd$HIHLHd$HIHHD$Hd$HIHHD$Hd$HIHHyPLHIIHHH\$HHd$IHHLIIHHLHd$IHHHHd$IHHHD$Hd$IHHLAXMHIHHIHl$LHd$HHILIHHIHHd$HHIHHd$HHIHq`Lǁ@LIHIHLHd$HIHHIHIHHHd$HIHHyhLLIIHHLd$IHHIIIHLHIIHHLApMHIHHIHIHHIHyxLHIHHIHHEDE3DHDD-ǁ@HyxH fHHH@uDHLWHGHWIo8H Iw@M_(MO0MoHHD$HT$IF IV(H|$Hl$I~0In8Ht$Iv@HT$HD$MfL\$LL$MMNLl$H|$MnHl$Ht$1MFHHLd$Ll$HL$IHIHIHH1HHIIHHLIIHHLAIHIHHILIHHIIHD$IHIIHyLHHIIHHLd$ILHd$IHHLIIHHHD$IIHHHD$LiIHIHHIMLHd$HHILHd$HHIHD$IHHIIHLHD$IIHHLa HT$IIHHHHIILLHd$HHIILLHd$HIHHD$Hd$HIHHD$IHIHILIHD$IIHHHD$La(IHHHHIILLHd$HHIILLHd$HIHHD$Hd$HIHHD$Hd$HIHHD$IHIHILHD$IIHHHT$LA0IIHIHHIMLHd$HHILHd$HHIHD$Hd$HHIHD$Hd$HHILl$HD$Hd$HHIHD$IHHIHD$IHHIHq8HHIHIHLHd$HIHLHd$HIHHD$Hd$HIHHD$Hd$HIHL$$HD$Hd$HIHHD$Hd$HIHHD$IHIHHD$IHIHHy@HHIIHHH\$LIIHHHHd$IHHHD$Hd$IHHHD$Hd$IHHHD$Hd$IHHHD$Hd$IHHHD$Hd$IHHHD$IIHHHD$IIHHLAHILIHHILT$HIHHILHd$HHIL\$LHd$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIHD$IHHILL$HqPHHIHIHH\$LIHIHLHd$HIHHHd$HIHLHd$HIHHD$Hd$HIHHD$Hd$HIHHD$Hd$HIHHyXHLIIHHLIIHHHHd$IHHLT$LHd$IHHLHd$IHHHD$Hd$IHHHD$Hd$IHHLA`ILIHHIL\$HIHHILHd$HHILHd$HHILHd$HHIHD$Hd$HHIHqhHHIHIHH\$LIHIHLHd$HIHLHd$HIHHHd$HIHHypHLIIHHLIIHHLHd$IHHHHd$IHHLAxILIHHIILILIIHHHHd$IHHLIHHILHIHHIHLHIHHHHHǁ@EDE3DHDDǁ@HH HHH@uDHGHWH_ M_0IwHLLGMO8H(Mo@HD$HT$IGPIV H\$L\$I^(Ht$M^8Iv0H$HT$MfH|$LL$I~MLl$H\$MnHt$L\$M^@I^PInHLl$Ld$H\$1L\$Hl$HHILIHHIH1HLHHIHLIHIHHiHLIIHHLHIHHIHD$IIIHLYHILIIHILd$HLHd$IHILHIHIHD$IIHIHT$LiILIHIHMLHd$HIHLHd$HIHHD$HHIHILIHD$IIHIHD$La LIILIHHIILHd$HIILMLHd$HHIHD$Hd$HHIHD$HHHIIHHHD$IIHIHT$La(MILIHIHMLHd$HIHMILHd$HIIHD$Hd$HIILl$HD$Hd$HIIHD$HHIIHLHD$IHHIHi0MHLIHIHMLHd$HIHMIHD$Hd$HIIHD$Hd$HIIHD$Hd$HIIHD$Hd$HIIHD$HHIIHLHD$IHHIHT$Hi8HIHT$LIHIHLIHIHHD$Hd$HIHHD$Hd$HIHHD$Hd$HIHHD$Hd$HIHHD$Hd$HIHHD$HHIHILIHD$IIHHHD$La@HD$ILIHHILHd$HHIHD$IHHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHILd$HD$HHHIHD$IHHIHqHHLIHIHLT$LHd$HIHLHd$HIHHD$IHIHHD$Hd$HIHHD$Hd$HIHHD$Hd$HIHHD$Hd$HIHHD$Hd$HIHHD$HHIHH$IHIHIHiPHl$LIIHILHd$IHIHHd$IHILD$LIIHIHD$Hd$IHIHD$Hd$IHIHD$Hd$IHIHD$Hd$IHIHD$Hd$IHIH$HIHIHLYXL\$LIHIHHHd$HIHLHd$HIHLIHIHHD$Hd$HIHHD$Hd$HIHHD$Hd$HIHHD$Hd$HIHH$Hd$HIHHq`HMHIIHHHl$LHd$IHHILHd$IHHHIIHHHD$Hd$IHHHD$Hd$IHHHD$Hd$IHHH$Hd$IHHLIHHILIhMLL$LHd$HHIIHHd$HHIHl$LIHHIHHd$HHIHD$Hd$HHIH$Hd$HHIHypHLIHIHLT$LHd$HIHLHd$HIHHIHIHLHd$HIHH$Hd$HIHHqxHLIIHHL$LHd$IHHHHd$IHHLIIHHLHd$IHHLILIHHIHHd$HHILHd$HHIǁ@LIHHIHHHIHIHHl$IHLHIIHLHd$IIHLLILIHHILHHHIHLLIHHHHHEDE3DHDDǁ@HH fDHHH@uDHGHWHw Lo@L'H_L_(LO0Ho8MF0HD$HT$HGHHWPHt$Ll$HwXMn(I~ H$HD$MVL\$LL$M^MNHl$H|$I.Ll$LD$Ht$Iv8MnHI~@MFXLT$LL$Ll$MnPHt$H|$LD$ Ll$E1LMLLHHIHH1LLIIHHHHIHHLAMLIHHILT$HIHHILHHHIHyLLIHIHHHd$HIHLIHIHIHLHD$HIIHHD$LIILIIHHMHHd$IHHLHd$IHHHD$IIHHHD$HIHHHT$LI IMHLHHIILHHd$HHIILLHd$HIHHD$Hd$HIHHD$IHIHILMHD$HIHHHD$LI(IHLHHIILHHd$HHIILLHd$HIHHD$Hd$HIHHD$Hd$HIHHD$IHIHILHD$HIHHHT$LA0MILIHHIHHd$HHILHd$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIHD$IHHIIHLHD$HIHIHD$LI8ILIHIHMHHd$HIHLHd$HIHHD$Hd$HIHHD$Hd$HIHLT$HD$Hd$HIHHD$Hd$HIHHD$IHIHHD$HHIHHq@LMLIHHIHHd$HHILHd$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIHD$IHHIHD$HHHIHqHHt$HLHD$LHd$HIHHIHIHLHd$HIHHD$Hd$HIHHD$Hd$HIHHD$Hd$HIHHD$Hd$HIHLL$ HD$Hd$HIHHD$Hd$HIHHD$IHIHH$HHIHHyPLLIIHHLd$HHd$IHHLIIHHHD$Hd$IHHHD$Hd$IHHHD$Hd$IHHHD$Hd$IHHHD$Hd$IHHHD$Hd$IHHHD$Hd$IHHH$IIHHHD$HIHHHl$LAXMHIHHIH\$LHd$HHIHIHHIHHd$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIH$Hd$HHIHD$IHHIHq`LLIHIHHHd$HIHLd$L\$HIHIHLHd$HIHLHd$HIHHD$Hd$HIHHD$Hd$HIHHD$Hd$HIHH$Hd$HIHHD$Hd$HIHHyhLHIIHHH\$HHd$IHHLIIHHLHd$IHHHHd$IHHHD$Hd$IHHHD$Hd$IHHH$Hd$IHHHD$Hd$IHHLApMHIHHIHl$LHd$HHILIHHIHHd$HHIHHd$HHIHD$Hd$HHIH$Hd$HHIHD$Hd$HHIHqxLLIHIHL\$LHd$HIHHIHIHHHd$HIHLHd$HIHH$Hd$HIHHD$Hd$HIHHLLIIHHHHd$IHHL$$HIIHHLHd$IHHLHd$IHHHD$Hd$IHHLMHIHHIH\$HHd$HHILIHHILHd$HHIHHd$HHIHLHIHIHLHd$HIHLIHIHHHd$HIHHl$HLǁ@LIIHHIHLHIIHLHIIHHLMLIHHIHHHHIHLHIHHIHHEDE3DHDDǁ@HH fDHHH@uDLHwHGHWH_ MW0H(M_8MoHHD$ HT$IGPIWXH|$LT$I`MV L\$MO@M^(HT$HD$MfInH\$L,$H|$MnI>LT$L\$LL$MN0MV8M^@I^PLd$Hl$LT$MVXLL$L\$MNHM^`LT$(E1H\$LLL$L\$0MMLHHIIHLLIIIHHHIIHLYMLIIHILd$ HIIHILHIHILIMLHHIIHHd$HIILIHIIHD$HHIIHD$HYLHLHIIHLIHHd$HIILHd$HIIHD$IHIIHD$HHIIHT$Hi LLILIIHHIHHd$IIHLILHd$IHIHD$Hd$IHIHD$IIHILILHD$HHIIHD$Hi(LILIIHHIHHd$IIHLILHd$IHIHD$Hd$IHIHD$Hd$IHIHD$IIHILIHD$HHIIHT$HY0LLILIIHHIHHd$IIHLILHd$IHIHD$Hd$IHIHD$Hd$IHIHD$Hd$IHIHD$IIHILIHD$HHIIHD$HY8LLILIIHHIHHd$IIHLILHd$IHIHD$Hd$IHIHD$Hd$IHIHD$Hd$IHIHD$Hd$IHIHD$IIHILIHD$HHIIHT$HY@LLILIIHHIHHd$IIHLILHd$IHIHD$Hd$IHIHD$Hd$IHIHD$Hd$IHIHD$Hd$IHIHD$Hd$IHIHD$IIHILIH$HHIIHD$HYHLHLHIIHLHHd$IIHLHd$IIHHD$Hd$IIHHD$Hd$IIHHD$Hd$IIHLd$(HD$Hd$IIHHD$Hd$IIHHD$Hd$IIHH$IIIHHD$HIIHLIPMLIIHIHHd$IHIHHd$IHIHD$Hd$IHIHD$Hd$IHIHD$Hd$IHIHD$Hd$IHIHD$Hd$IHIHD$Hd$IHIHl$0H$Hd$IHIHD$IIHIHD$HIHILYXMLHHIILD$ HIHIILHd$HIIHD$Hd$HIIHD$Hd$HIIHD$Hd$HIIHD$Hd$HIIHD$Hd$HIIHD$Hd$HIIH$Hd$HIIHD$Hd$HIIHD$IHIIHD$HHIILHY`H\$HHIIHLIIIHHHd$IIHHD$Hd$IIHHD$Hd$IIHHD$Hd$IIHHD$Hd$IIHHD$Hd$IIHH$Hd$IIHHD$Hd$IIHHD$Hd$IIHHD$IIIHLl$LIhLLL$LHIHHMHIIHHLHd$IHHLHd$IHHHD$Hd$IHHHD$Hd$IHHHD$Hd$IHHH$Hd$IHHHD$Hd$IHHHD$Hd$IHHHD$Hd$IHHHHHHILYpLMLIHHILL$LHd$HHILHd$HHILl$LHd$HHIHD$Hd$HHIH$Hd$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIHyxLHHHIHH\$LIHIHLHd$HIHLHd$HIHHHd$HIHH$Hd$HIHHD$Hd$HIHHD$Hd$HIHHD$Hd$HIHHLLHIHHL$LIIHHLHd$IHHHHd$IHHLHd$IHHHD$Hd$IHHHD$Hd$IHHHD$Hd$IHHLMLHHHILL$LIHHIHHd$HHILHd$HHILHd$HHIHD$Hd$HHIHD$Hd$HHIHLLHHIHHIHIHLHd$HIHLHd$HIHLl$LHd$HIHHD$Hd$HIHHLHHIHHH\$LIIHHLHd$IHHLHd$IHHHHd$IHHLMLHHHIL\$LIHHILIHHIHHd$HHIHLLHHIHIHLIIIHHIIIHLLMLHHHIHIHHIHLHHHHIHHǁ@EDE3DHDD۲ǁ@HH DHHH@u镲DIGIWIw I_MW(MO8Io@MoHMgPHD$HT$IGXIW`Ht$MG0IwhHD$ H?HT$(H\$LT$I^ L $Hl$Ll$InMnLd$Ht$0MfI6LD$MF(MN0MV8M^PLD$MF@LL$MNHLT$MVXLD$MF`LL$MNhL\$LT$LD$E1LL$8MMMHHIIILMHIIIIHD$HIIILQMHIIIIHD$IIIIHD$HIIILIMHHIIIHD$IIIIH\$HD$IIIIHD$HIIILYMHHIIILMHD$HHIIHD$IHIIHD$IHIIHD$HHIIHD$HY MLIHIIIHMHD$Hd$IIHMIHD$HIIIHD$IIIIHD$IIIILMMHD$HHIIHT$HY(LIHIIHIIHD$Hd$IIILMHD$Hd$IHIHD$HIHIHD$IIHIHD$IIHIMIHD$HIIIHD$LY0LMIHIIHIIHD$Hd$IIILMHD$Hd$IHIHD$Hd$IHIHD$HIHIHD$IIHIHD$IIHIMIH$HIIIHT$LY8LMIHIIHIIHD$Hd$IIILMHD$Hd$IHIHD$Hd$IHIHD$Hd$IHIHD$HIHIHD$IIHIH$IIHIMIHD$HIIIHD$LY@LMIHIIHIIHD$Hd$IIILMHD$Hd$IHIHD$Hd$IHIHD$Hd$IHIHD$Hd$IHIHD$HIHIH$IIHIHD$IIHIMIHD$HIIIHT$LYHLMIHIIHIIHD$Hd$IIILMHD$Hd$IHIHD$Hd$IHIHD$Hd$IHIHD$Hd$IHIHD$Hd$IHIH$HIHIHD$IIHIHD$IIHIMIHD$HIIIHD$LYPMHHHIIIHD$Hd$IIIHD$Hd$IIIHD$Hd$IIIHD$Hd$IIIHD$Hd$IIIHD$Hd$IIIH$Hd$IIIHD$HIIIHD$IIIIHD$IIIILMMHD$ HHIIHYXHT$HHHIIIHD$Hd$IIIHD$Hd$IIIHD$Hd$IIIHD$Hd$IIIHD$Hd$IIIHD$Hd$IIIH\$8H$Hd$IIIHD$Hd$IIIHD$HIIIHD$IIIIHD$ IIIIHD$(HIIILI`MHHIIIH|$HHd$IIIHD$Hd$IIIHD$Hd$IIIHD$Hd$IIIHD$Hd$IIIHD$Hd$IIIH$Hd$IIIHD$Hd$IIIHD$Hd$IIIHD$HIIIHD$ IIIIHD$(IIIIHD$0HIIILLYhL\$HHIIHLLHd$IIHHD$Hd$IIHHD$Hd$IIHHD$Hd$IIHHD$Hd$IIHH$Hd$IIHHD$Hd$IIHHD$Hd$IIHHD$Hd$IIHHD$ HIIHHD$(IIIHHD$0IIIHLHIHHLQpLT$LHd$IHHLl$L\$LHd$IHHLHd$IHHHD$Hd$IHHH$Hd$IHHHD$Hd$IHHHD$Hd$IHHHD$Hd$IHHHD$ Hd$IHHHD$(HIHHHD$0IIHHL$$LIxMLHHHILT$LHd$HHILHd$HHILHd$HHILHd$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIHD$ Hd$HHIHD$(Hd$HHIHD$0HHHIHl$HLLHHIHL\$LHd$HIHLHd$HIHLHd$HIHLHd$HIHHHd$HIHHD$Hd$HIHHD$ Hd$HIHHD$(Hd$HIHHD$0Hd$HIHHLLHIHHLl$LHd$IHHLHd$IHHLHd$IHHHHd$IHHLHd$IHHHD$ Hd$IHHHD$(Hd$IHHHD$0Hd$IHHLMLHHHILT$ LHd$HHILHd$HHIHHd$HHILHd$HHILHd$HHIHD$(Hd$HHIHD$0Hd$HHIHLLHHIHLd$(LHd$HIHHHd$HIHLHd$HIHLHd$HIHLHd$HIHHD$0Hd$HIHHLLHIHHL\$0HHd$IHHLHd$IHHLHd$IHHLHd$IHHLHd$IHHLMHHHHIHl$LHd$HHILHd$HHILHHHILHd$HHIǁ@HLLHHIHLl$LHd$HIHLIHIHLHHIHHl$HLLHIHHIHLHIIHLLIIHHLMLHHHILHHHIHLLHHHIHHEDE3DHDDzǁ@HH @HHHK@u5DIGIWIw MG0I_MW(MO8MoHMgPHD$HT$IGXIW`Ht$L$IwhMGpIo@HT$0H?HD$(H\$LT$LL$Ll$Ld$ MnMfHt$8LD$@I6Hl$InMN(MV0MF8M^HI^ LL$MN@LT$MVPLD$MFXLL$L\$MN`M^hLT$MVpLD$E1LL$L\$HMLT$PMMHHIIILMHIIIIHD$HIIILQMHIIIIHD$IIIIHD$HIIIH\$LIMHHIIIHD$IIIIHD$IIIIHD$HIIILYMHHIIILMHD$HHIIHD$IHIIHD$IHIIHD$HHIIHD$HY MLIHIIIHMHD$Hd$IIHMIHD$HIIIHD$IIIIHD$IIIILMMHD$HHIIHT$HY(LIHIIHIIHD$Hd$IIILMHD$Hd$IHIHD$HIHIHD$IIHIHD$IIHIMIH$HIIIHD$LY0LMIHIIHIIHD$Hd$IIILMHD$Hd$IHIHD$Hd$IHIHD$HIHIHD$IIHIH$IIHIMIHD$HIIIHT$LY8LMIHIIHIIHD$Hd$IIILMHD$Hd$IHIHD$Hd$IHIHD$Hd$IHIHD$HIHIH$IIHIHD$IIHIMIHD$HIIIHD$LY@LMIHIIHIIHD$Hd$IIILMHD$Hd$IHIHD$Hd$IHIHD$Hd$IHIHD$Hd$IHIH$HIHIHD$IIHIHD$IIHIMIHD$HIIIHT$LYHLMIHIIHIIHD$Hd$IIILMHD$Hd$IHIHD$Hd$IHIHD$Hd$IHIHD$Hd$IHIH$Hd$IHIHD$HIHIHD$IIHIHD$IIHIMIHD$ HIIIHD$LYPLMIHIIHIIHD$Hd$IIILMHD$Hd$IHIHD$Hd$IHIHD$Hd$IHIHD$Hd$IHIH$Hd$IHIHD$Hd$IHIHD$HIHIHD$IIHIHD$ IIHIMIHD$(HIIIHT$LYXMHHT$HHIIIHD$Hd$IIIHD$Hd$IIIHD$Hd$IIIHD$Hd$IIIHD$Hd$IIIH$Hd$IIIHD$Hd$IIIHD$Hd$IIIHD$HIIIHD$ IIIIHD$(IIIILMMHD$0HHIIHD$HHY`HD$HHHIIIHD$Hd$IIIHD$Hd$IIIHD$Hd$IIIHD$Hd$IIIHD$Hd$IIIH$Hd$IIIHD$Hd$IIIHD$Hd$IIIHD$Hd$IIIHD$ HIIIHD$(IIIIH\$PHD$0IIIIHD$8HIIILIhMHHIIIH|$HHd$IIIHD$Hd$IIIHD$Hd$IIIHD$Hd$IIIHD$Hd$IIIH$Hd$IIIHD$Hd$IIIHD$Hd$IIIHD$Hd$IIIHD$ Hd$IIIHD$(HIIIHD$0IIIIHD$8IIIIHD$@HIIILLYpL\$HHIIHLLHd$IIHHD$Hd$IIHHD$Hd$IIHHD$Hd$IIHH$Hd$IIHHD$Hd$IIHHD$Hd$IIHHD$Hd$IIHHD$ Hd$IIHHD$(Hd$IIHHD$0HIIHHD$8IIIHHD$@IIIHLl$LQxLHIHHLT$L\$LHd$IHHLHd$IHHLHd$IHHH$Hd$IHHHD$Hd$IHHHD$Hd$IHHHD$Hd$IHHHD$ Hd$IHHHD$(Hd$IHHHD$0Hd$IHHHD$8HIHHHD$@IIHHLd$LMLHHHIL$LHd$HHILHd$HHILHd$HHILHd$HHIHD$Hd$HHIHD$Hd$HHIHD$ Hd$HHIHD$(Hd$HHIHD$0Hd$HHIHD$8Hd$HHIHD$@HHHIHl$HLLHHIHL\$LHd$HIHLHd$HIHLHd$HIHLHd$HIHHHd$HIHHD$ Hd$HIHHD$(Hd$HIHHD$0Hd$HIHHD$8Hd$HIHHD$@Hd$HIHHLLHIHHLHd$IHHLHd$IHHLHd$IHHHHd$IHHLl$ LHd$IHHHD$(Hd$IHHHD$0Hd$IHHHD$8Hd$IHHHD$@Hd$IHHLMLHHHILHd$HHILT$(LHd$HHIHHd$HHILHd$HHILHd$HHIHD$0Hd$HHIHD$8Hd$HHIHD$@Hd$HHIHLLHHIHLd$0LHd$HIHHHd$HIHLHd$HIHLHd$HIHLHd$HIHHD$8Hd$HIHHD$@Hd$HIHHLLHIHHHHd$IHHL\$8LHd$IHHLHd$IHHLHd$IHHLHd$IHHHD$@Hd$IHHLMHHHHILHd$HHILHd$HHILHd$HHILHd$HHIHl$@ǁ@HHd$HHIHLLHHIHLl$LHd$HIHLIHIHLHd$HIHHHd$HIHHLLHIHHLHd$IHHLIIHHHHd$IHHLMLHHHILd$ILMLIIHHHIIHHLHHHILHIHHIHLHHHHIHHEDE3DHDDǁ@HH HHH{@ueǁ@wfDATLc@IUS@D@DDD@E1E1E1E1@AHH$LLIHH1I@IAS9=LL AL$ASA@O 9~Hcƒ9Iut0AHcI<t#PHcI<uЅuAǀ@1[AD]A\[ADA@]A\DD1f.ATUISI1HHPHHHLDwLHHkHP[]A\f.AWAVIAUATUSH"HT$@H|$x HL$H$`1L$LLL$pH$HHHH$ LHHHt$HDŽ$dLLHHƹHHHq$xT$puJLLO[$P~$tLLLOLL![$yfDD$Ex$HLjN1LHLcOLHLUO$NHyND$ $"HD$Du HLHL$"tHT$H$`HH@HzHH@HH)H)HHމHDDtD$ D$ Hĸ"[]A\A]A^A_fHHY$"~$`tHLHRNHHYfHLH2NHLH$NH|$0L$L$pH$L$H|$(HT$(LHH$HHL$ HHLHH$ HH $HH$`HLHHHLHHHH|$hD$ $pH|$ LHx"D$0uD$Ex$~Ht$(LHH<$Ht$ HLnHm$ xx$unLL3X$ $pHt$ LLfJHt$(HHLLLWHHW$ yDD$`Ex$ H4$L)KWH4$LL!LLLLLHHHL$ H<$(KD$ t;LLLI1LKtfLLLKLL'KuHL$ILHHyI@HH@H)H)΍HHH<$HV$P~I$t?Ht$ LLHHt$(HHKLLtVHHiV@$"~$`tH<$LHJLLLJHHHJD$E$D@~*~~(~+ ~鱈+3X1f.AWAVIAUATE1USMLLLHPH/LoHHHHIH$H\$MH_MHHHIHHIHHL$LL\$HIIHHIHHHHIHHHGLD$E1IHIHHIHHIHIHHIHHIHG MHt$ 1IHIHIIHIIHIHIIHIILHHIIHG(HL$(1IHIHHM1HIHHIHD$IHHIHW0LL\$MHIMHIMHT$HD$0HHd$HHM1HIHHIMHD$IHHIMIIMIIMLHIIIHG8Ll$8HD$IHIHHM1HHd$HHIHD$Hd$HHILIHHIHW@LMHIMHIMHD$@IHT$HIHHM1MMHHd$HHIHD$Hd$HHILHd$HHIIIMIIMLHIIIHGHLl$HHD$IHIHHM1MHHd$HHIL\$Ll$HD$Hd$HHILHd$HHILIHHIHWPLMHIMHIMHD$PHT$HHd$HHM1HHd$HHIHD$Hd$HHILHd$HHILHd$HHIMMIIMIIMLHIIIHGXL\$Ll$XHD$IHIHHM1Ll$HHd$HHIHD$Hd$HHILHd$HHILHd$HHIHD$IHHIHW`LMHIMHIMHD$`HT$HHd$HHM1HHd$HHIHD$Hd$HHILHd$HHILHd$HHIMMHD$Hd$HHIIIMIIMLHIIIHGhLl$hHD$IHIHHM1HHd$HHIHD$Hd$HHILHd$HHIL\$Ll$LHd$HHIHD$Hd$HHIHD$IHHIHWpLMHIMHIMHD$pHT$HHd$HHM1HHd$HHIHD$Hd$HHILHd$HHILHd$HHIMMHD$Hd$HHIHD$Hd$HHIIIMIIMLHIIIHGxLl$xHD$IHIHHM1MHHd$HHIHD$Hd$HHILHd$HHIL\$HD$Hd$HHIHD$Hd$HHIHD$Hd$HHILIHHIHLMHIMHIMH$IHT$HIHHM1MHHd$HHIHD$Hd$HHILHd$HHIMHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIIIMIIMLHIIIL$LHIHHM1HHd$HHIHD$Hd$HHILl$LHd$HHIMHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHILHd$HHIIIMIIML$LHIHHM1HIHHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIHHD$Hd$HHILHd$HHILMIHMIHMIHHHHM1HD$HIIIHIHHIL$LLt$HD$IHHILHd$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHILHILHILH$HHHHM1HD$IHHIL\$LLIHHILHd$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIIHLIHLHD$HIHHL$MHD$HHHM1LIHHILIHHIMHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIHHMHHMLHHHM1MH$LLIHHILl$LIHHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIHILHILHD$HHIHLHHHM1MH$LLIHHILl$LIHHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIIHLIHLLHHHM1ML$MLIHHILl$LIHHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIHHMHHMLHHHM1MLIHHILl$HD$HHHILIHHIH$LHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIHILHILLHHHM1MH$LLIHHILl$LIHHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIIHLIHLHD$HIHHLHHHM1L$MMLIHHILl$LIHHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIHHMHHMLHHHM1MH$LLIHHILl$LIHHIHD$Hd$HHIHD$Hd$HHIHILHILLHHHM1MLIHHILl$HD$HHIHLIHHIH$LHD$Hd$HHIHD$Hd$HHIIHLIHLLHHHM1ML$MLIHHILl$LIHHIHD$Hd$HHIHHMHHMLHHHM1MLIHHILl$HD$HHHILIHHIH$LHD$Hd$HHIHILHILLHHHM1H$MLLIHHILl$ALJ@(LIHHIIHLIHLLHHHM1HD$HIHHLt$L$LIHHILIHHILALJDHHLHHLLHMLHHHHHHHLIHHHHHHLHHHHLHHHIHHILIHHIHHIH$ LMLHHHIHHILHHHIH$(HLMH$H$LHHHIHHIH$0HHt$HHHIIIH$8LM8H$HL$@IH)H)΁@HI8u8I0ALJ@'&H:uA@HuHP[]A\A]A^A_DAWAVAUATE1USMLLMHH/L_HHHHILWHt$LH\$ H\$8MH_HHHIHHIHHL$@LLT$HIIHHIHHHHIHHHIHHIHHIHIHHIHHIHG LD$HE1Ht$P1IHIHIIHIIHIHIIHIILHHIIHG(HL$X1IHIHHM1HIHHILIHHILMLl$HIMHIMHD$`HG0IHIHHM1HIHHIMLIHHIIIMIIMHD$HIIIHW8Lt$hHT$IHIHHM1Lt$HIHHILIHHIHD$IHHILMLT$HIMHIMHD$pHG@HD$HHd$HHM1HHd$HHILIHHIMHD$IHHIMMIIMIIMLHIIIHWHLt$xHT$IHIHHM1HHd$HHILHd$HHIHD$Hd$HHILIHHILMHIMHIMH$HGPHD$IHIHHM1MMHHd$HHILHd$HHIHD$Hd$HHILHd$HHIIIMIIMLHIIIHWXL$HT$IHIHHM1MHHd$HHILHd$HHIHD$Hd$HHILHd$HHILT$LIHHILMHIMHIMH$HG`HD$HHd$HHM1HHd$HHILHd$HHIHD$Hd$HHILHd$HHILHd$HHIMMIIMIIMLHIIIHWhL$HT$IHIHHM1HHd$HHILHd$HHILt$LT$HD$Hd$HHILHd$HHILHd$HHIHD$IHHILMHIMHIMH$HGpHD$HHd$HHM1HHd$HHILHd$HHIHD$Hd$HHILHd$HHILHd$HHIMMHD$Hd$HHIIIMIIMLHIIIHWxL$HT$IHIHHM1HHd$HHILHd$HHIHD$Hd$HHILT$Lt$LHd$HHILHd$HHIHD$Hd$HHIHD$IHHILMHIMHIMH$HHD$HHd$HHM1HHd$HHILHd$HHIHD$Hd$HHILHd$HHILHd$HHIMMHD$Hd$HHIHD$Hd$HHIIIMIIMLHIIIHL$HT$IHIHHM1MHHd$HHILHd$HHIHD$Hd$HHILT$LHd$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHILIHHILMHIMHIMH$HIHD$HIHHM1MHHd$HHILHd$HHIHD$Hd$HHILHd$HHIMHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIIIMIIMLHIIIHL$H$IHIHHM1MHHd$HHILHd$HHIHD$Hd$HHILHd$HHIHD$Hd$HHIHD$Hd$HHILT$Lt$HD$Hd$HHIHD$Hd$HHILIHHIMIIMIIML$LHIHHM1HH$$HHILHd$HHIHD$Hd$HHILHd$HHIMHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIIIMIIMLHIIIL$LHIHHM1HIHHIL|$LH$$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIL|$HD$Hd$HHIHD$IHHILHd$HHILLLIHLIHLHD$0HT$(L$MHIHHM1HHd$HHILIHHIHD$H$$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIHLIHHIHT$(HD$0HHMHHMIIHHHHM1HD$HIIIHIHHIL$LLHd$HHIHD$IHHIHD$H$$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHILT$HD$Hd$HHIHD$Hd$HHIHD$Hd$HHIHD$IHHILHILHILH$HHHHM1LLIHHIHD$Hd$HHIHD$IHHIHD$H$$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIL|$HD$Hd$HHIHD$IHHIIHLIHLLHIHHL$Ll$LHHHM1MHD$IHHILHd$HHIHD$IHHIHD$H$$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHILIHHIHHMHHMH$LMHD$HHHM1LIHHILl$LHd$HHIHD$IHHIHD$H$$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIHIMHIMHHHHM1LLIHHILl$LHHIILHd$HHIH$LHD$IHHIHD$H$$HHIHD$Hd$HHIHD$Hd$HHIL|$HD$Hd$HHIHD$Hd$HHIHIHHILIILIILHHHHM1LL$MLIHHILl$LHd$HHIHD$IHHIHD$H$$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIIHMIHMHHHHM1LLIHHILl$LHIHILHd$HHIL$MHD$IHHIL|$HD$H$$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHILIHHIMHIMHIMHHHHM1LH$ LLIHHILl$LHd$HHIHD$IHHIHD$H$$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIIILIILHHHHM1LLIHHILl$LHIIHLHd$HHIL$(MHD$IHHIL|$HD$H$$HHIHD$Hd$HHIHD$Hd$HHILIHHIMIHMIHMHHHHM1LL$0MLIHHILl$LHd$HHIHD$IHHIHD$H$$HHIHD$Hd$HHIHD$Hd$HHIHIMHIMHHHHM1LLIHHILl$LHHIILHd$HHIH$8LHD$IHHIHD$H$$HHIHD$Hd$HHIL|$HIHHILIILIILHHHHM1LL$@MLIHHILl$LHd$HHIHD$IHHIHD$H$$HHIHD$Hd$HHIIHMIHMLHIHIHHHHM1LL$HMLIHHILl$LHd$HHIHD$IHHIHD$H$$HHIL|$LIHHIMHIMHIMHHHHM1LH$PLLIHHILl$LHd$HHIHD$IHHIHD$H$$HHIIILIILHHHHM1LHIIHLL$XMLIHHILl$L<$LHd$HHIHD$IHHILIHHIMIHMIHMHHHHM1LL$`MLIHHILl$LHd$HHIHD$IHHIHIMHIMHHHHM1LHHIILH$hLLIHHILl$LHd$HHILIHHIIILIILHHHHM1L$pLMLIHHIML|$LIHHIIHMIHMHHHHM1LHIHILIHHILIHHILL$xHILHILLHMLHIHHIHHLIIHHIHHLHIHHLHHHIHHILIHHIHHIH$LMLHHHIHHILHHHIH$HLMH$H\$ LHHHIHHIH$HHt$8HHHIIHD$H$L$L$HxHLxǀ@0ǀDHHH)H)΁HHxu8HL$.Hpǁ@/DH:u@HuH[]A\A]A^A_fDAWAVAUATE1USMLLMH H/L_LWHt$0LHHHHIH\$8H\$XMH_H|$HHHIHHIHHL$`LHIIHHIHHHHIHHHIHHIHHIHIHHIHHIHG LD$hE1Ht$p1IHIHIIHIIHIHIIHIILHHIIHG(HL$x1HIHIHHM1HIHHILIHHILMHIMHIMH$HD$H@0HD$IHIHHM1MHHHHILIHHIIIMIIMLHIIIHD$L$HP8HT$IHIHHM1HHd$HHILHHHILIHHILMHIMHIMH$HD$H@@HD$IHIHHM1MMHHd$HHILHd$HHILHHHIIIMIIMLHIIIHD$L$HPHIHT$HIHHM1HHd$HHILHd$HHILHd$HHILHHHILMHIMHIMH$HD$H@PIHD$HIHHM1MMHHd$HHILHd$HHILHd$HHILHd$HHIIIMIIMHHIIIHD$L$HPXIHT$HIHHM1HHd$HHILHd$HHILHd$HHILHd$HHIHHd$HHILMHIMHIMH$HD$H@`IHD$HIHHM1MMHHd$HHILHd$HHILHd$HHILHd$HHIHHd$HHIIIMIIMHD$HIIIHD$L$HPhIHT$HIHHM1HHd$HHILHd$HHILHd$HHILHd$HHIHHd$HHIHD$Hd$HHILMHIMHIMH$HD$H@pIHD$HIHHM1MMHHd$HHILHd$HHILHd$HHILHd$HHIHHd$HHIHD$Hd$HHIIIMIIMHD$HIIIHD$L$HPxIHT$HIHHM1HHd$HHILHd$HHILHd$HHILHd$HHIHHd$HHIHD$Hd$HHIHD$Hd$HHILMHIMHIMH$HD$HIHD$HIHHM1MMHHd$HHILHd$HHILHd$HHILHd$HHIHHd$HHIHD$Hd$HHIHD$Hd$HHIIIMIIMHD$HIIIHD$L$HIHT$HIHHM1HHd$HHILHd$HHILHd$HHILHd$HHIHHd$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHILMHIMHIMH$HD$HIHD$HIHHM1MMHHd$HHILHd$HHILHd$HHILHd$HHIHHd$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIIIMIIMHD$HIIIHD$L$HIHT$HIHHM1HHd$HHILHd$HHILHd$HHILHd$HHIHHd$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHILMHIMHIMH$HD$HIHD$HIHHM1MMHHd$HHILHd$HHILHd$HHILHd$HHIHHd$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIIIMIIMHD$HIIIHD$L$HIH$HIHHM1HHd$HHILHd$HHILHd$HHILHd$HHIHHd$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHILMHIMHIMH$HD$HIHD$HIHHM1MMHH$$HHIH|$ LHd$HHILHd$HHILHd$HHIHHd$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIH|$HD$Hd$HHIHHd$HHIIIMIIMHD$HIIIHD$L$HIHT$HIHHM1HHd$HHILH$$HHILHd$HHILHd$HHIHD$ Hd$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIHHd$HHIHD$Hd$HHILMMHIMHIMH$HD$Lt$(LHIHHM1HHd$HHILHd$HHILH$$HHILHd$HHIMHD$ Hd$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIHHd$HHIHHD$Hd$HHIIIMIIMLHD$HIIHHL$@L$HHD$LHIHHM1HIHHILHd$HHILHd$HHIHD$(H$$HHIHD$ Hd$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIH|$HD$Hd$HHIHD$Hd$HHIHHd$HHIHD$Hd$HHIHT$@LIHLIHLHT$@L$ HD$HHD$LHIHHM1HIHHILIHHILHd$HHIHD$(Hd$HHIHD$ H$$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIHHd$HHIHMHD$Hd$HHIMHT$@HD$HMH|$@LD$HHHMHHMIHHD$HIHIHL$PL$(HD$HL$@LD$HHHHHHM1LHIHHILIHHILIHHIHD$(Hd$HHIHD$ Hd$HHIHD$H$$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIHD$PHILHILH$0HHHHM1LLIHHILIHHIHD$(IHHIHD$ Hd$HHIHD$Hd$HHIHD$H$$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIIHLIHLHD$HIHHL$8Ll$(LHHHM1MLIHHILIHHIHD$ IHHIHD$Hd$HHIHD$Hd$HHIHD$H$$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIHHMHHMLHHHM1H$@LMLIHHILl$ LIHHIHD$IHHIHD$Hd$HHIHD$Hd$HHIHD$H$$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIHIMHIMHHHHM1LLIHHILl$HD$HHIILIHHIH$HLHD$IHHIHD$Hd$HHIHD$Hd$HHIHD$H$$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIIILIILHHHHM1LL$PMLIHHILl$LIHHIHD$IHHIHD$Hd$HHIHD$Hd$HHIHD$H$$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIIHMIHMHD$HIHIHHHHM1LL$XMLIHHILl$LIHHIHD$IHHIHD$Hd$HHIHD$Hd$HHIHD$H$$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIHIMHIMHHHHM1LH$`LLIHHILl$LIHHIHD$IHHIHD$Hd$HHIHD$Hd$HHIHD$H$$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIIILIILHHHHM1LLIHHILl$HD$HIIHLIHHIL$hMHD$IHHIHD$Hd$HHIHD$Hd$HHIHD$H$$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIIHMIHMHHHHM1LL$pMLIHHILl$LIHHIHD$IHHIHD$Hd$HHIHD$Hd$HHIHD$H$$HHIHD$Hd$HHIHD$Hd$HHIHIMHIMHD$HHIIHHHHM1LH$xLLIHHILl$LIHHIHD$IHHIHD$Hd$HHIHD$Hd$HHIHD$H$$HHIHD$Hd$HHIHD$Hd$HHIIILIILHHHHM1LL$MLIHHILl$LIHHIHD$IHHIHD$Hd$HHIHD$Hd$HHIHD$H$$HHIHD$Hd$HHIIHMIHMHHHHM1LLIHHILl$HD$HIHILIHHIL$MHD$IHHIHD$Hd$HHIHD$Hd$HHIHD$H$$HHIHD$Hd$HHIHIMHIMHHHHM1LH$LLIHHILl$LIHHIHD$IHHIHD$Hd$HHIHD$Hd$HHIHD$H$$HHIIILIILHHHHM1LLIHHILl$HD$HIIHLIHHIL$MHD$IHHIHD$Hd$HHIHD$Hd$HHIHD$H$$HHIIHMIHMHHHHM1LL$MLIHHILl$LIHHIHD$IHHIHD$Hd$HHIHD$Hd$HHIHIMHIMHHHHM1LLIHHILl$H$HHIILIHHIH$LHD$IHHIHD$Hd$HHIH$Hd$HHIIILIILHHHHM1LL$MLIHHILl$LIHHIHD$IHHIH$Hd$HHIIHMIHMHD$HIHIHHHHM1LL$MLIHHILl$LIHHIH$IHHIHD$Hd$HHIHIMHIMHHHHM1LH$LLIHHIL,$LIHHIHD$IHHIIILIILHHHHM1HD$HIIHLL$MLIHHILl$LIHHIHD$IHHIIHMIHMHHHHM1L$LMLIHHILl$LIHHIHIMHIMHHHHM1LHHIILIHHIH$H\$8LIHHILIILIILLHMLHIHHIHHLIIHHIHHLHIHHLHHHIHHILIHHIHHIH$LMLHHHIHHILHHHIH$HLML$L$LHHHIHHIH$HHt$XHHHIIHD$0H$L$HxHLǀ@8ǀDHHH)H)΁HHu3HL$06Hǁ@7H:u@HuH []A\A]A^A_fDAWAVAUATE1USMLLMHH/LWL_Ht$XLHHHHIH\$`H\$xMH_MHHHIHHIHH$LHIIHHIHHHHIHHHIHHIHHIHIHHIHHIHG L$E1H$1HD$HHd$HIIHIIHIHIIHIILHHIIHG(H$1IHIHHM1HHd$HHILIHHIHW0IIMIIML$HT$IHIHHM1MHIHHILHd$HHIIIMIIMLHIIIHG8L$HD$@IHIHHM1HHd$HHILIHHILHd$HHIHW@LMHIMHIMH$IHT$HIHHM1MMHHd$@HHILHd$HHILIHHIIIMIIMHD$HIIIHGHL$HD$IHIHHM1HHd$HHILHd$@HHILHd$HHIHD$IHHIHWPLMHIMHIMH$IHT$HIHHM1MMHHd$HHILHd$HHILHd$@HHIHD$Hd$HHIIIMIIMLHIIIHGXL$HD$IHIHHM1HHd$HHILHd$HHILHd$HHIHD$Hd$@HHILHd$HHIHW`LMHIMHIMH$IHT$HIHHM1MMHHd$HHILHd$HHILHd$HHIHD$Hd$HHILHd$@HHIIIMIIMHD$HIIIHGhL$HD$8IHIHHM1HHd$HHILHd$HHILHd$HHIHD$Hd$HHILHd$HHIHD$Hd$@HHILMHIMHIMH$HWpIHT$HIHHM1MMHHd$8HHILHd$HHILHd$HHIHD$Hd$HHILHd$HHIHD$Hd$HHIIIMIIMHD$@HIIIHGxL$HD$IHIHHM1HHd$HHILHd$8HHILHd$HHIHD$Hd$HHILHd$HHIHD$Hd$HHIHD$@Hd$HHIHLMHIMHIMH$IHT$HIHHM1MMHHd$HHILHd$HHILHd$8HHIHD$Hd$HHILHd$HHIHD$Hd$HHIHD$@Hd$HHIIIMIIMHD$HIIIHL$HD$IHIHHM1HHd$HHILHd$HHILHd$HHIHD$Hd$8HHILHd$HHIHD$Hd$HHIHD$@Hd$HHIHD$Hd$HHIHLMHIMHIMH$IHT$HIHHM1MMHHd$HHILHd$HHILHd$HHIHD$Hd$HHILHd$8HHIHD$Hd$HHIHD$@Hd$HHIHD$Hd$HHIIIMIIMHD$HIIIHL$HD$IHIHHM1HHd$HHILHd$HHILHd$HHIHD$Hd$HHILHd$HHIHD$Hd$8HHIHD$@Hd$HHIHD$Hd$HHIHD$Hd$HHILMHIMHIMH$HIHT$HIHHM1MMHHd$HHILHd$HHILHd$HHIHD$Hd$HHILHd$HHIHD$Hd$HHIHD$@Hd$8HHIHD$Hd$HHIHD$Hd$HHIIIMIIMHD$HIIIHL$HD$IHIHHM1HHd$HHILHd$HHILHd$HHIHD$Hd$HHILHd$HHIHD$Hd$HHIHD$@Hd$HHIHD$Hd$8HHIHD$Hd$HHIHD$Hd$HHIHLMHIMHIMH$ IH$HIHHM1MMHHd$HHILHd$HHILHd$HHIHD$Hd$HHILHd$HHIHD$Hd$HHIHD$@Hd$HHIHD$Hd$HHIHD$Hd$8HHIHD$Hd$HHIIIMIIMHD$HIIIHL$(HD$IHIHHM1HH$$HHILHd$HHILHd$HHIHD$Hd$HHILHd$HHIHD$Hd$HHIHD$@Hd$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$8HHIHD$Hd$HHIHLMHIMHIMH$0IHT$HIHHM1MMHHd$HHILH$$HHILHd$HHIHD$Hd$HHILHd$HHIHD$Hd$HHIHD$@Hd$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$8HHIIIMIIMHD$HIIIHL$8HD$IHIHHM1HHd$HHILHd$HHILH$$HHIHD$Hd$HHILHd$HHIHD$Hd$HHIHD$@Hd$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$8HHIHLMHIMHIMH$@IHT$ HIHHM1MMHHd$HHILHd$HHILHd$HHIHD$H$$HHILHd$HHIHD$Hd$HHIHD$@Hd$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIIIMIIMHD$8HIIIHL$HHD$(IHIHHM1HHd$ HHILHd$HHILHd$HHIHD$Hd$HHILH$$HHIHD$Hd$HHIHD$@Hd$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIHD$8Hd$HHIHLMHIMHIMH$PIHT$0HIHHM1MMHHd$(HHILHd$ HHILHd$HHIHD$Hd$HHILL$HLHd$HHIHD$H$$HHIHD$@Hd$HHIHD$Hd$HHIHD$Hd$HHILL$8HD$Hd$HHIHD$Hd$HHIHD$Hd$HHILHd$HHIIIMIIMHD$HIIIL$XLHIHHM1HHd$0HHILHd$(HHILHd$ HHIHD$Hd$HHIHD$HHd$HHIHD$Hd$HHIHD$@H$$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHILHd$HHIHD$Hd$HHILLMHHMHHMHT$PH$`Lt$hLHIHHM1HIHHILHd$0HHILHd$(HHIHD$Hd$ HHIHD$HHd$HHIHD$Hd$HHIHD$@Hd$HHIHD$H$$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHILHd$HHIIMHD$Hd$IHILHT$hLl$PLHL$PIHLIHLHIHD$HIHILD$pHL$hML$hHL$PLLHIHHM1HIHHILIHHILHd$0HHIHD$Hd$(HHILL$@HD$HHd$ HHIHD$Hd$HHILHd$HHIHD$Hd$HHIHD$H$$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIHD$8Hd$HHIHD$Hd$HHIHD$Hd$HHIHD$hHl$pHHLHHLH$pHIHHM1LLIHHILIHHIHD$Hd$0HHIHD$HHd$(HHIHD$Hd$ HHILHd$HHIHD$Hd$HHIHD$Hd$HHIHD$H$$HHIHD$Hd$HHIHD$Hd$HHIHD$8Hd$HHIHD$Hd$HHIHD$Hd$HHIHHHLHHLHHD$HHHHH$xHl$HLIHHM1MLIHHIHD$IHHIHHd$0HHIHD$Hd$(HHILHd$ HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIHD$H$$HHIHD$Hd$HHIHD$8Hd$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIHHMHHMLIHHM1IH$LHD$IHHIHIHHIHl$HHd$0HHILHd$(HHIHD$Hd$ HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIHD$H$$HHIHD$8Hd$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIHILHILHD$HHIHHD$IHHM1H$LLIHHIIHIHHILLHd$0HHIMHD$Hd$(HHIHD$Hd$ HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIHD$8H$$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIIHMIHMHIHHM1L$ILLIHHIHIHHIHl$MHHd$0HHIHD$Hd$(HHIHD$Hd$ HHIHD$Hd$HHIHD$Hd$HHIHD$8Hd$HHIHD$H$$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIHIMHIMHIHHM1HD$HHIIHH$LLIHHIHIHHIHl$HHd$0HHIHD$Hd$(HHIHD$Hd$ HHIHD$Hd$HHIHD$8Hd$HHIHD$Hd$HHIHD$H$$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIIILIILLIHHM1IL$MHIHHIHIHHIHl$HHd$0HHIHD$Hd$(HHIHD$Hd$ HHIHD$8Hd$HHIHD$Hd$HHIHD$Hd$HHIHD$H$$HHIHD$Hd$HHIHD$Hd$HHIIHMIHMHIHHM1HLIHHIHIHHIHl$HD$HIHIHHd$0HHIL$MHD$Hd$(HHIHD$8Hd$ HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIHD$H$$HHIHD$Hd$HHIHD$Hd$HHIHIMHIMLIHHM1H$ILHIHHIHIHHIHl$HHd$0HHIHD$8Hd$(HHIHD$Hd$ HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIHD$H$$HHIHD$Hd$HHIIILIILHIHHM1LLIHHIIHIHHIHl$8HD$HIIHHHd$0HHIL$MHD$Hd$(HHIHD$Hd$ HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIHD$H$$HHIHD$Hd$HHIIHMIHMHIHHM1L$HMLIHHIHIHHIHl$HHd$0HHIHD$Hd$(HHIHD$Hd$ HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIHD$H$$HHIHIMHIMLIHHM1IHIHHIHIHHIHl$HD$HHIIHHd$0HHIH$LHD$Hd$(HHIHD$Hd$ HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIHD$H$$HHIIILIILHIHHM1LL$MLIHHIIHIHHIHl$HHd$0HHIHD$Hd$(HHIHD$Hd$ HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIIHMIHMHIHHM1H$HIHILIHHIHL$MHIHHIHl$HHd$0HHIHD$Hd$(HHIHD$Hd$ HHIHD$Hd$HHIHD$Hd$HHIH$Hd$HHIHIMHIMLIHHM1IH$LHIHHIHIHHIHl$HHd$0HHIHD$Hd$(HHIHD$Hd$ HHIHD$Hd$HHIH$Hd$HHIIILIILHIHHM1LLIHHIIHIHHIHl$HD$HIIHL$MHHd$0HHIHD$Hd$(HHIHD$Hd$ HHIH$Hd$HHIHD$Hd$HHIIHMIHMHIHHM1HL$MLIHHIHIHHIHl$HHd$0HHIHD$Hd$(HHIH$Hd$ HHIHD$Hd$HHIHIMHIMLIHHM1IHIHHIHIHHIHl$HD$HHIIHHd$0HHIH$LH$Hd$(HHIHD$Hd$ HHIHD$Hd$HHIIILIILHIHHM1LL$MLIHHIIHIHHIH,$HHd$0HHIHD$Hd$(HHIHD$Hd$ HHIIHMIHMHIHHM1HD$HIHILIHHIHL$MHIHHIHl$HHd$0HHIHD$Hd$(HHIHD$Hd$ HHIHIMHIMLIHHM1IH$LHIHHIHIHHIHl$HHd$0HHIHD$Hd$(HHIIILIILHIHHM1LLIHHIIHIHHIHl$HD$ HIIHL$MHHd$0HHIHD$ Hd$(HHIIHMIHMHIHHM1HL$ MLIHHIHIHHIHl$ HHd$0HHIHIMHIMLIHHM1IHIHHIHIHHIHl$(HD$(HHIIHHd$0HHIH$(LIILIILHIHHM1L$0LMLIHHIIHIHHIHl$0IHMIHMHIHHM1HHIHILIHHIL$8HIHHILHILHILLHH$@LIIHHIHHLHIIHHIHHLHIHHHIHHHHHHL$HLIHHHHHHH$PHLLIHHHHHHLHHHHH$XHHLLIHHHHHHH$`HHt$xLHHHIH$hH$pHD$XH\$`HHxHǀ@@ǀDHHH)H)΁HHuHǁ@?fH:u@HuHĀ[]A\A]A^A_fDAWAVAUATIUSHH@=NH9T$H~H1HHdž@IHH)HH|$D$I111DxD|$I@9PBAA)LcD)McNT9NL7D)9O…*IHM\1IIIAIbIHHIHHM9uuHcHDHIHHMHII9FD$A@HcT$I<Ht7f.PHcI<ЅuAdž@AdžDM9t3II}LHIEI@I@I)AHL)HH[]A\A]A^A_fIME1PIH1 A@1|$Lt$LH?D$A@KD$f.@AWAVHAUATIUSH@HcHf1HHHHHHHHt$HT$HL$HD$ALJ@ALJDIWIIuI?ALJ@u ALJ@H[]A\A]A^A_Ð1HL_LWIHHIIHHHHIHt$Ht$HHIHIHHIHHL$HHIIHHIHHLHIHHHGLD$IHIHHIHHILIHHIHHIHG H4$1Lt$IHIHIIHIILIHIIHIILHHIIHG(Ll$HL$1H1HT$IHHd$HHM1LIHHIILIHHIIIMIIMLd$Lg0IHIIHM1LLd$ILHd$IHHLHd$IHHMIIMIIHD$HIIIHG8LL$MHD$ILt$HIIHH1LHd$IHHLHd$IHHLHd$IHHHW@IMIIMIILl$ HT$IHIIHH1MILHd$IHHLHd$IHHLHd$IHHMIIMIIHD$HIIIHGHLl$(HD$IHIIHH1LHd$IHHLHd$IHHLl$LHd$IHHLHd$IHHHWPLILIILIIHD$0HT$HHd$IHH1LHd$IHHLHd$IHHLHd$IHHLHd$IHHMIMIIMIIHD$HIIIHGXLl$8MIHD$HHHIHM1LLl$LHd$HHILHd$HHILHd$HHILHd$HHIHD$Hd$HHIHW`LIHIMHIMHD$@HT$HHd$HHM1LHd$HHILHd$HHILHd$HHILHd$HHIIHD$Hd$HHIIIMIIMHD$HIIIHGhLd$HHD$IHIHHM1MLHd$HHILHd$HHILHd$HHIIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIIIMIIMLL$PLOpHIHHM1LHd$HHILHd$HHILHd$HHIIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIIIMIIMHD$HIIILl$XLl$HxHHHHM1HLIHHILHd$HHILHd$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIIILIILLHHHM1Lt$`MILIHHILHd$HHILl$LHd$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIIHMIHMHD$HIHILHHHM1Ld$hMILIHHILHd$HHILl$LHd$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIHIMHIMLHHHM1MH\$pHLIHHIMLHd$HHILl$LHd$HHIHD$Hd$HHIHD$Hd$HHIIILIILLHHHM1MLIHHIMLHd$HHILl$HD$HIIHL\$xILHd$HHIHD$Hd$HHIHD$Hd$HHIIHMIHMLHHHM1ML$ILIHHIMLHd$HHILl$LHd$HHIHD$Hd$HHIHIMHIMHD$HHIILHHHM1H$MHLIHHIMLHd$HHILl$LHd$HHIHD$Hd$HHIIILIILLHHHM1ML$ILIHHIMLHd$HHILl$LHd$HHIIHMIHMLHHHM1MLIHHIMLHd$HHILl$HD$HIHILHd$HHIL$IHIMHIMLHHHM1H$MHLIHHIMALJ@ ALJDLHd$HHILl$IILIILLHHHM1LHIIHLIHHIL$L\$LIHHIHIHLIHLHHILHHHHHHHLIHHHHHHLHHHHLHHHIHHILIHHIHHIH$LILHHHIHHILHHHIH$HLIL$H$LHHHIHHIH$HHt$HHHIHHD$IH$L$MHILH)H)ƉHIIALJ@H:A@HufDE1HL_MMLLLALJ@HHIIHHIIHHIHHLHHHHHALJDMMWIOIw+IWALJ@H: A@HufDE1H/H_LWMMLLALJ@HHIIHHHIHHIHHHLALJDHIHHHHHHLMM_HHHHHHIHHHHHHHIIwLHHHIHIO I_(IW ALJ@fH:A@HufDE1L/LgLWHoMLMLLHIHILALJ@ALJDLIHIHHIHLIIHHIHHLHIHHHLMLHHHHHHHMI_MGLIHHHHHHLHHHIHHIMMILHHHILHHIIHIIMMIO HHIIIMIw(MW0Mg8IW0ALJ@@H:bA@HuJfDE1L7LoLgLWLH LMMLLLHHHILIHIIHIILIIIHIIHLHIIHLIIHHIHHLIIHHIHHLD$MALJ@ LHHHIHHIILALJDLIHIHHIHLHHIHMMILHIHIIHIMIoMOLIIHIIHIILIw LHIIHIIHMMMo(LHIIHLHIHIIHIMMg0Mw8HHHIIHD$MIO@MWHIGWIW@ALJ@ H:2A@HufDE1L'L_HoMLMLMLHIHIHLLHHIHHIHH\$H_LHIHHIHHMMHHIHHLIHHIHHILT$LW HHHHIHHILIHIIHIIHIHIIHIIHHHIIHG(Ht$1HL$1ALJ@ ALJDM7H1HT$HLHd$HHH1Ld$HIHHHHIHHHLIIHIIHLHLHIIHHIHHHIIHHIHHLHIHHHIHHHHHHHLMO(LIHHHHHHLIHHHHHHILMG0LHHIHLIIHHIHHLHHHIHD$LT$HIw8IO@M_HIPIGHD$MWIGHD$IG I_X`IWPALJ@ H:BA@Hu*fDE1L'L_HoMLLLMLHHHILHHIHHIHH\$HL$LH_LHIHHIHHMMHHIHHLIHHIHHILT$LW HHHHIHHILIHIIHIIHIHIIHIIIHt$1HHIIIHG(Lt$1H1HT$ILHd$HHM1HIHHIHIHHIHG0LMHIMHIMHT$ALJ@HD$HALJDLHHHM1Ld$LHIHHIHIHHIIILIILHHd$HHM1LHIIHHIHHILIHHILIHLIHLLt$HLHIHHHHHHLLIHHHHHHLHHHHLIHHHHHHMLIHHHHHHLIHHIHHIMLHHHIILLIIIHIIHLHIHIHD$HIHD$IGHD$IGHD$IGLt$HT$MG0MO8I@Mw IwHIW(IOPM_XMW`I_hIW`ALJ@ fDH:A@HujfDE1H/L_1E1LLHHHHIH\$H_HHHIHHIHHL$1HIIHHIHHME1HHIHHLT$LWHIHHIHHIHIHHIHHIHG Ht$1IHIHIIHIIHIHIIHIII1LHIIIHG(Ll$H1HT$IIHIHHM1MHIHHILd$E1LIHHIIIMIIMLL$LO0HIHHM1HHd$HHILIHHI1H8ALJ@IILIILMIALJDLHIIILd$Ld$HHHHM1HIHHILHd$HHILIHHI1IILIILHHHHM1LIHHILHd$HHI1IHLIHLLILHHHM1MLHHHILIHHILd$LIHHI1HILHIL1HE1LHIHHIHHMLIIHHIHHE1LHIHHLHHHIHHIE1LIHHIHHILHHIIHIIE1LHHIILHIIIIIIHHIIIHD$MIHD$LL$Ld$Mw8I_@IGHD$MO(Mg0IoHMGPIGHD$IwXIO`M_hMWpIGHD$MoxIG IWpALJ@fDH:A@HufDE1H/LWL_MLLLMHHHHIH\$H\$H_HHHIHHIHHL$LHIIHHIHHHHIHHHIHHIHHIHIHHIHHIHG LD$MH4$1IHIHIIHIIHIHIIHIILHHIIHG(Lt$HL$1H1HT$IHHd$HHM1HIHHIMLIHHIIIMIIMLL$LO0HIHHM1HHd$HHILL$MLHd$HHIIIMIIMLHIIILD$LG8HIHHM1HHd$HHILHd$HHIH@LHd$HHILIILIILHD$Lt$ HHHHM1LHIHHILHd$HHILHd$HHIHD$IHLIHLIHD$HIIHHHHHM1LL$(H\$MLIHHILHd$HHIHHd$HHILLt$HHMHHMHD$0LHHHM1MLIHHIHHd$HHIHIMHIMLHHHM1LHHIIHIHHIHl$8LT$LIHHILALJ@ALJDIILIILLHLL$@HHIHHIHHMH\$LIIHHIHHLHIHHLHHHIHHILIHHIHHIHt$PLMLHHHIHHILHHHIHL$XHLML\$HLHHHIHHIHL$`MHHHHIIILHL$hHt$LD$pMHIH)H)ƉHIIALJ@H:A@HujfD1HL_IHHHHHHIHt$Ht$HHIHIHHIHHGHL$HIIHIIHHIHHLHIHHHGMLD$IHIHHIHHILIHHIHHIHG ILd$H4$1IHIHIIHIILIHIIHIILHHIIHG(HL$1Ll$H1IHT$HHd$HHM1LIHHILIHHIIIIMIIMLL$LO0HIHHM1LHd$HHILL$MMLIHHIIIIMIIMHD$HIIILT$LW8HIHHM1LHd$HHILHd$HHILd$IHD$Hd$HHIIIMIIMLL$ LO@HIHHM1LIHHILHd$HHIIHHHD$Hd$HHIIIMIIMHD$HIIILl$(Ll$HHHHM1HLIHHILIHHIHD$Hd$HHIHD$Hd$HHIIILIILLHHHM1Lt$0MILIHHILl$LIHHIHD$Hd$HHIIHMIHMLHHHM1MLIHHILl$HD$HIHILIHHILd$8IHD$Hd$HHIHIMHIMLHHHM1H\$@MHLIHHILl$LIHHIIILIILLHHHM1HD$HIIHLIHHIL\$HLt$LIHHIHALJ@ALJDIHLIHLHHILHHHHHHHLIHHHHHHLHHHHLHHHIHHILIHHIHHIHt$`LILHHHIHHILHHHIHL$hHLILd$PH\$XLHHHIHHIHL$pHHt$HHHIHHD$IHL$xL$MHILH)H)ƉHI(IALJ@DH:A@HufD1HLWL_IHHIIHHHHIHt$Ht$HHIHIHHIHHL$HHIIHHIHHLHIHHHGLD$IHIHHIHHILIHHIHHIHG H4$1Lt$IHIHIIHIILIHIIHIILHHIIHG(Ll$HL$1H1HT$IHHd$HHM1LIHHIILIHHIIIMIIMLd$Lg0MHIHHM1ILHd$HHILd$MLl$LHd$HHIIIMIIMLHIIIHG8Lt$HD$IHIHHM1ILHd$HHILHd$HHILHd$HHIIIMIIMLd$ Lg@HIHHM1LHd$HHILHd$HHILHd$HHIIIIMIIMHD$HIIILL$(LOHHIHHM1LIHHILHd$HHIHD$Hd$HHIHPHD$Hd$HHILIHIMHIMHD$0HHHHM1HLIHHILIHHIHD$Hd$HHIHD$Hd$HHIIILIILLHHHM1HD$HIIHLIHHILl$8ILl$LIHHIHD$Hd$HHIHD$Hd$HHIIHMIHMLHHHM1Lt$@ILt$LIHHILIHHIHD$Hd$HHIHIMHIMLHHHM1Ll$HD$HHIILIHHIH\$HHLIHHIHD$Hd$HHIIILIILLHHHM1L\$PMILIHHILl$LIHHIIHMIHMHD$HIHILHHHM1LT$XLt$LIHHILIHHIHHILHILHH\$`HIALJ@ALJDLHIHHIHHLIIHHIHHLHIHHLHHHIHHILIHHIHHIHt$pLILHHHIHHILHHHIHL$xHLIL\$hLHHHIHHIH$HHt$HHHIHHD$IH$L$MHILH)H)ƉHIIALJ@H:A@HujfD1HL_IHHHHHHIHt$Ht$HHIHIHHIHHGHL$HIIHIIHHIHHLHIHHHGMLD$IHIHHIHHILIHHIHHIHG ILd$H4$1IHIHIIHIILIHIIHIILHHIIHG(HL$1Ll$H1HT$IHHd$HHM1LIHHILIHHIIIIMIIMLL$LO0HIHHM1LHd$HHILL$MLd$LIHHIMIIIMIIMLHIIIHG8Ll$HD$IHIHHM1LHd$HHILHd$HHILHd$HHIHW@LIHIMHIMHD$ IHT$HIHHM1LHd$HHILHd$HHILHd$HHIMIIIMIIMHD$HIIILT$(LWHHIHHM1LHd$HHILHd$HHIIHD$Hd$HHILd$HD$Hd$HHIIIMIIMLL$0LOPHIHHM1LIHHILHd$HHIIHXHD$Hd$HHIHD$Hd$HHIIIMIIMHD$HIIILl$8Ll$HHHHM1HLIHHILIHHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIIILIILLHHHM1Lt$@MILIHHILl$LIHHIHD$Hd$HHIHD$Hd$HHIIHMIHMLHHHM1HD$HIHILIHHIMLl$Ld$HLIHHIIHD$Hd$HHIHD$Hd$HHIHIMHIMLHHHM1MH\$PHLIHHILl$LIHHIHD$Hd$HHIIILIILLHHHM1MLIHHILl$HD$HIIHLIHHIL\$XIHD$Hd$HHIIHMIHMLHHHM1Ld$`MILIHHILl$ALJ@LIHHIHIMHIMLHHHM1HD$HHIILt$H\$hLIHHILIHHIHALJDIILIILHHILHIHHIHHLIIHHIHHLHIHHLHHHIHHILIHHIHHIH$LILHHHIHHILHHHIH$HLIL\$pLd$xLHHHIHHIH$HHt$HHHIHHD$IH$L$MHILH)H)ƉHIIALJ@H:A@HufD1HLWL_IHHIIHHHHIHt$Ht$HHIHIHHIHHL$HHIIHHIHHLHIHHHGLD$IHIHHIHHILIHHIHHIHG H4$1Lt$IHIHIIHIILIHIIHIILHHIIHG(HL$1Ll$H1HT$IHHd$HHM1LIHHILIHHIHG0IIIMIIMLd$MIIHD$HIHHM1MLl$LHd$HHILHd$HHIIIMIIMLHIIIHW8Lt$HT$IHIHHM1LHd$HHILHd$HHILHd$HHIHG@MIIIMIIMLd$ HD$IHIHHM1MILHd$HHILHd$HHILHd$HHIIIMIIMHD$HIIILd$(LgHHIHHM1LHd$HHILHd$HHILHd$HHIHD$Hd$HHIHGPIIIMIIMLl$0HD$IHIHHM1ILIHHILHd$HHIHD$Hd$HHIHD$Hd$HHIIIMIIMHD$HIIILL$8LOXHIHHM1LHd$HHIH`LIHHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHILIHIMHIMHD$@HHHHM1HLIHHILHd$HHIHD$IHHIHD$Hd$HHIHD$Hd$HHIIILIILHD$HIIHLHHHM1Ll$HILl$LIHHILHd$HHIHD$IHHIHD$Hd$HHIHD$Hd$HHIIHMIHMLHHHM1Lt$PILt$LIHHILHd$HHIHD$IHHIHD$Hd$HHIHIMHIMLHHHM1Ll$HD$HHIILIHHIH\$XHLHd$HHIHD$IHHIHD$Hd$HHIIILIILLHHHM1ML\$`ILIHHILl$LHd$HHIHD$IHHIIHMIHMLHHHM1MALJ@LIHHILl$HD$HIHILHd$HHILT$hIHD$IHHIHIMHIMLHHHM1H\$pMHLIHHILl$LHd$HHIIILIILLHIIHLHHHM1L\$xLt$LIHHILIHHIHIHLIHLHHILHHHHHHHL$LIHHHHHHLHHHHLHHHIHHIH$LIHHIHHIH$LILHHHIHHILHHHIH$HLILHHHIHHIH$HHt$HHHIHH$L$IALJDHD$HMILH)H)ƉHIIALJ@H:A@HuʺfD1HLWL_IHHIIHHHHIHt$Ht$HHIHIHHIHHL$HHIIHHIHHLHIHHHGLD$IHIHHIHHILIHHIHHIHG H4$1Lt$IHIHIIHIILIHIIHIILHHIIHG(Ll$HL$1H1HT$IHHd$HHM1LIHHIILIHHIIIMIIMLd$Lg0MHIHHM1ILHd$HHILd$MLl$LHd$HHIIIMIIMLHIIIHG8Lt$HD$IHIHHM1LHd$HHILHd$HHILHd$HHIHW@LIHIMHIMHD$ IHT$HIHHM1MLHd$HHILHd$HHILHd$HHIMIIIMIIMHD$HIIIHGHLl$(HD$IHIHHM1LHd$HHILHd$HHILHd$HHIHD$Hd$HHIHWPMLIHIMHIMIHT$HD$0HIHHM1MLHd$HHILHd$HHILHd$HHIIHD$Hd$HHIIIMIIMHD$HIIILL$8LOXHIHHM1LHd$HHILHd$HHILHd$HHIHD$Hd$HHIHD$Hd$HHIHG`IIIMIIMLd$@HD$IHIHHM1ILIHHILHd$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIIIMIIMHD$HIIILl$HLl$HhHHHHM1HLHd$HHILIHHILHd$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIIILIILLHHHM1Lt$PMILHd$HHILIHHILl$LHd$HHIHD$Hd$HHIHD$Hd$HHIIHMIHMHD$HIHILHHHM1Ld$XMILHd$HHILIHHILl$LHd$HHIHD$Hd$HHIHD$Hd$HHIHIMHIMLHHHM1MH\$`HLHd$HHIMLIHHILl$LHd$HHIHD$Hd$HHIIILIILHD$HIIHLHHHM1ML\$hILHd$HHIMLIHHILl$LHd$HHIHD$Hd$HHIIHMIHMLHHHM1MLT$pILHd$HHIMLIHHILl$LHd$HHIHIMHIMLHHHM1HD$HHIIMH\$xHLHd$HHIMALJ@ALJDLIHHILl$LHd$HHIIILIILLHHHM1ML$ILHd$HHIMLIHHILl$IHMIHMLHHHM1LHIHIL$MLd$LIHHILIHHIHHILHILHHILHIHHIHHLIIHHIHHLHIHHLHHHIHHILIHHIHHIH$LILHHHIHHILHHHIH$HLIH$L$LHHHIHHIH$HHt$HHHIHHD$IH$L$MHILH)H)ƉHIIALJ@fH:A@HujfDE1LLWLOMLLLLLHHHILIHIHHIHHL$LH\$LIIHHIHHLHIHHLD$LGLIHHHHHHLIHHHHHHHG H\$LH4$1ILIHHHHHHLIHHHHHHLHHHHHG(Lt$HL$1H1HT$ILHd$HHM1LIHHIMLIHHIHHMHHMHl$Ho0LHHHM1LHd$HHIHl$LLHd$HHIHILHILLHHIHHG8H\$HD$HLHHHM1LHd$HHILHd$HHILHd$HHIHW@LIHLIHLLt$ HT$ILIHHM1MLHd$HHILHd$HHILHd$HHIHHMHHMHD$HHHIHGHHl$(HD$HLHHHM1LHd$HHILHd$HHILHd$HHIHD$Hd$HHIHWPLHILHILH\$0HT$HLHHHM1LLHd$HHILHd$HHILHd$HHIHD$Hd$HHIIHLIHLHD$HIHHHGXLt$8HD$ILIHHM1LHd$HHILHd$HHILHd$HHIHD$Hd$HHIHD$Hd$HHIHW`MHHMHHMHl$@HT$HLHHHM1LLHd$HHILHd$HHILHd$HHIHD$Hd$HHIHD$Hd$HHIHILHILHD$HHIHH\$HH_hLHHHM1LHd$HHILHd$HHILHd$HHIHD$Hd$HHIHD$Hd$HHIHpHD$Hd$HHILIHLIHLHD$Lt$PLHHHM1MLHHHILHd$HHILHd$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHIHD$HHMHHMILHHHM1HD$HHIILHHHIHl$XMHl$LHd$HHIHHd$HHIHD$Hd$HHIHD$Hd$HHIHD$Hd$HHILLt$HIMHIMHD$`LHHHM1MLHHHIHHd$HHILHd$HHIHD$Hd$HHIHD$Hd$HHIIIMIIMLHHHM1HD$HIIIHHHHIML\$hLHd$HHIL\$LHd$HHIHD$Hd$HHIHD$Hd$HHIIIMIIMHHHHM1Hl$LT$pMLHHHILHd$HHIHHd$HHIHD$Hd$HHIIIMIIMLHHHM1HD$HIIILHHHIILL$xMHHd$HHIHl$HHd$HHIHD$Hd$HHIIIMIIMLHHHM1IL$MLHHHIHHd$HHIHl$HHd$HHIIIMIIMLHHHM1ILHHHIHHd$HHIHl$HD$HIIIL$MHHd$HHIIIMIIMLHHHM1L$IMLHHHIHHd$HHIHl$ALJ@IIMIIMLHHHM1HHIIILt$L$MLHHHIHIHHILALJDIILIILLHL$LHIHHIHHHHIHHIHHLHIHHHHHHIHHILHHHIHHIH$LMLHHHIHHIHHHHIH$HLML$HHHHIHHIH$HHt$HHHIIILH$H\$L$HMH)H)IHI#IALJ@H:A@Huf.@ATUIS1HIHPHHHLLHH{HP[]A\f.HWt3HHHHAhH08vxu%HH9uH'8u&H@H=m1HHH=!n1@ʸf.1f.1f.@f.1f.@f.H=m5@@f.f.@AE1RDD ?tl<(LpAA AHAD9fFvsDHcAAtM|@u%IAw@t HA)A}HcGHHtGIcLHH@+HH[]A\A]A^A_1H[]A\A]A^A_I11m1H=g1=1DEAWAVAAUATIUSHHHL$1E1f.AH;Ht=HcAAtM|@u$fDIAw@t H:HuHcM<EEtkE9uMlAA@IAuA@t H~:HtA9t0Lt$A)LIcHLK?AHL[]A\A]A^A_H1[]A\A]A^A_I111AWAVAUATUSH(A9A}H9D DzE1ҍAHHD$HBE8AE1HD$AE8A)1AA fDD9wCD:|uLlE:Mt!DD9vE1H(L[]A\A]A^A_@HT$H|$HtDL$DT$R=DT$DL$u뻐2H([]A\A]A^A_H+IHHt%HuHHVHO҈QuHHH=[f14;1AUATUSHHtaHID1H9Hxt6HDI|8HuH9HvfDHH9IDuHH[]A\A]1ff.AWAVAUATAUSH(HM[HRLD$L$Ht$H<$9I=3H<$L Ht$L$LD$IIHADT HtII9IADT HuI9҃-?+$?0>.A D$HE81II9gE115A0A9@ukI9wfI9uiD9ڽ}_II9tnMC\ut[ffۃ 7A)A"fDH([]A\A]A^A_@뢐MMc۽Mt$tIڅtL9tEt I9sA9uM1fII9s$LcH<$HT$:,ItHLCH<$DpHt7MLBDHLt&MTBDPMtHT$MBDPu LL_@AEA A fA J /Cf tPfvTf=wUf?ȀAIHtH=\12H1[]A\A]A^A_ˈf ƒ?fȀ?AʀQfDHxAWAVIAUATIUSIE1HIEI]@,IM9GC,7@\tT@DIMIEHYH9vHI}H9HBÉH}4HIMI]IEHYfINI9vCt7FHD$H[]A\A]fD1@LX1@H7b'~-1H"f.AWAVIAUATUSHH8HL$LD$(HHI90H|$MxHIHǾ&1LLb,HD$HD$1Hu,@I4LL/LH9LIR0I)HL9sL@0LcHǾ~&1LL+uH0DHD$HtL$1H8[]A\A]A^A_H|$uH|$0@Ht$HT$,L+tLJ$HL$HtYD$,HD$H8[]A\A]A^A_fDHcHHHD$oHIH01QHD$Gf.AWAVIAUATAUSHH Hi.HT$DADl$HL?HHtIc/HIufHHH".tFLHDHHT$ LH*tCMtD$ AH+/LfDH/L/1HĨ[]A\A]A^A_L.H.1AUATAUSHIH%HtcHHHtSHǾF$1HH)t-LDHHHl"HH[]A\A]fDHP"H1[]A\A]USHHHHHH[]+ff.IHHHH=!x-IHHHH=X-AWAVIAUATHUSIAMH$HHHHt}HM,HHHD$)#1HH(tHHT$LH(,t4HLDL(Hu5!H[]A\A]A^A_@H!ܐAWAVIAUATDUSAHHHT$1Z*HHH$HIH+LcHHHǾQ"1LH'tPLHHR+t>Ht$HLD'AHuAt,HT HD[]A\A]A^A_fHAJ,H* 3,HA AHA ,AWAVIAUATMUSIHH(|$`8HL$1LALL$< HILL$E11LLHߋl$+HI0H"HIL*HHD$`HHHǾ 1LHJ&HT$LH)LLHZ&uD$`L*H+L*T$`tL*HfDH([]A\A]A^A_f.E11LLH)HItH!HILq*L`*LX*fDLH*CL8*t$`dfL *L$`tL*H߽;fDAVAUMATUISHA Ht2HHMDLH H߉[]A\A]A^fDfAWAVMAUATIUSH5)IAH$HtU111HHDHHHt@"MDLLH H!H[]A\A]A^A_Dt"f.AVAUEATUISHAHt2HHEDLH'H߉[]A\A]A^fDfAWAVEAUATIUSH5(IAH#HtU111HHDHHHt@!EDLLHH H[]A\A]A^A_Dt!f.AWAVMAUATAUSHIMH~HtIHHLD$HHMMDHPH߉lXZH[]A\A]A^A_ffAWAVMAUATAUSIMHHt$H5'"Ht`111HHHHHtK HLMD$XMDHPHt$H߉cXZH[]A\A]A^A_øD f.AWAVIAUATIUSHEH(HT$HIHHLHcZHHH1LHT!L$Ht$HcH$tpHT$LHHtYEu$T$AHH(H[]A\A]A^A_t$HHIHt%LL‰D$뱐H%HH(1[]A\A]A^A_Df.AWAVEAUATIUSH5%IIH HtU111HH HHHtAELLLHHHHH[]A\A]A^A_1@c1Df.AVAUEATUHSIHIHHT$ "Ht6HHELHL?HH$HH[]A\A]A^@1ff.ATUISHHHDD$ DD$ HLHHމ[]A\XUSH5h$HHt1111HH HHHthHH[]fD1@K1USHHt0H111HHHHH[]f.1ff.USHH"H Ht]HlHH} Hu'111H HH~HH[]@HhH1[]1@HATUSHPLgMt=HLH v,8HHtEttqH"HP1[]A\fDAD$<0tnH5$JAD$HLHt1!Ht$H|$HD$dD$0C HPH[]A\ÐAD$<0t.H5IAD$DAD$0AD$9H5IAD$0AD$9H5Iq1f.HtsUSH5"HYHHtI111HHHHt+HHx Ht2xHH[]@HXH1[]1DAWAVIAUATIUSHHT H1HI LHHHMLHIHLzHIH,LLHHHuHHSHtsE1HuLMtLUMt$LH[]A\A]A^A_LH[]A\A]A^A_LHHtE11ҹHOHHiLKHHtv1HHL Htl'HA,MtLMtL2LH1EH[]A\A]A^A_E1E1HLMtL&MtLHL_Lf.AWAVAUATUSH(H|$Ht$cIĸM7HD$1E1@LHx.tHXH5XFHV tL}LJ4HIH|$H HI= I| HL$ID HHHL$HT$H5HH1LMLHXLL$LLHHtQHT$JD 1HeHAtDHH<HuHDH([]A\A]A^A_HtfHI<{HuLnHt$f.HILHt&1 fDI|HHuI}LL|GfUSHHtEHHHt5HǾS1HHHtHH[]D{H1H[]Df.Ht#HtHHfDfUSHHt-Ht(1H1H@H[]Ht fDf.@H1HËG +F HHuHGH+FfH=Q(1BfH9'HH0N@f.AWAVIAUATIUSAHLHAL|$PvV@uZ1APv1H[]A\A]A^A_1ɃMHL[H1]A\A]A^A_AfufHLL $L $.E%=@=|=DfHL $L$ 2L $tNEL$ %=tnxtm=@uAtpt{11AMLAх1DteAqDfSH5HH="( Hދ=([zf.=(1cH=ɒ(USIH H$( H$0 H$8 L$@ L$H t@)$P )$` )$p )$ )$ )$ )$ )$ HLibClamAH\$ HL$LҾH{HD$ HV WarninD$2 HD$(g:D$fD$0H$ D$ 0HD$H$ HD$V H5H=(Ƅ$ H-(=֣(Ht$HHxHSH޿@H []1ff.USIH H$( H$0 H$8 L$@ L$H t@)$P )$` )$p )$ )$ )$ )$ )$ HLibClamAH\$ HL$LҾH{HD$ HV Error:D$0 HD$(H$ D$D$ 0HD$H$ HD$ H5YH=(Ƅ$ H-s(~=(HtHHxHSH޿H []f1ff.USHH H$0 H$8 L$@ L$H t@)$P )$` )$p )$ )$ )$ )$ )$ HLibClamAH\$ HL$HH{HD$ HV info: D$HD$(H$ D$ 0HD$H$ HD$ HƄ$ HK(t!HMxHSH޿ H []D1@SIH H$( H$0 H$8 L$@ L$H t@)$P )$` )$p )$ )$ )$ )$ )$ HLibClamAHL$H|$1LҾH\$ HD$ HV debug:D$0 HD$(H$ D$D$ 0HD$H$ HD$ HY'HƄ$ H0fH [f.HGSHH=_ w+Ht[@HH=&<1o 1[H=w?H=h<H1N 1[f.HFSH=_ w+HGH=_ wHHH` w Ht[HH=E<1 1[H= ?&H=<H1 1[ÐHFSHH=_ wHt[@H=<1 1[H=>H=<H1 1[f.HFATUSHH=_ wIUHHt-H[]A\DH=<110 H[]A\H=J>TH=<1H MtL@HSt:HHt[H=>HH==1 1[H=<1 1[@f.USHHv$Hx;HtYH[]f.H==1 HHB[]@HH5=HRH D+HH[] CHH[]H=|=H0Hg=HHDHf.ATAUH=s(SHH DHHH1 H=J(D+@H[]A\AUATAUSAHHfD)HHŅtmHDtDym8tH満)H=<H1HĈ[]A\A]DHĈD)[]A\A]DHĈD[]A\A]AUATAUSAHHfD)HHŅtUHD y8tH満{H=<H1jHĈ[]A\A]HĈD[]A\A]Df.ATU1SH10t}ź1AHAtX HHuUfHD Hމ4Ha[D]A\UN[]A\É=D5AWAVIAUATUSHHL$t$T$\LD$MHH~dHD$0HD$lE1HD$(HD$@HD$hHD$HHD$pHD$8D$D$X@H HI4A}.D$hAE<<< D$bD$lLXIUHHHT$ DH|rHHHT$ 1A?//A$H5H1MtHt$HAփHHt$LL$(LD$PHL$XHT$Ht$$bAXAYD$lH HD$0H HIHD$0HL|$(1MH (LLMDl$\L1MA.fDH}Ht2 E1HH(I9pLD$HL$Mt$DHAƋE tH} AE<. A}|$hE1Ʌt t$X)IH|$(LL$PKHHHT$ VHHD$(HT$ LL$PHD$(1HDHT$lLHHEH HXIUHPHD$09fH5dHHL1@u4D$l_D$lKD$l;D$l+LD$L11HD$H[]A\A]A^A_ÐH ~ HIUHt$8IyHHIH$ILH)H)HD11LD$LHD$Ѕ`DLkM9v3HL$(HHH{(IH( H{ M9wH|$( DLHD$0Ht$p8H=5HL1v11LD$LHD$ЅHD$(HtE1MHzH;IH( H{ M9uTL$hHLD$HHD$HE|$81HA E4H "1T$hH|$8LL$ LD$HHD1HD$H LL$ MLs fDHȋO tHHf.H71HHfAWAVIAUATIUSMLHT$ D$D$uMtgAtMAWtDUSHH(H:1҅u$1E11HH1HH([]AWAVHcAUATHUSHIHXHD$(HRH|$Ht$0T$HHD$HHD$$H u 1H$H|$0 HD$0H\$HHHHL$ -H\$H<$wH|$I4$HH7I$HD$ID$HIHD$@HD$8LIMM9HHOHt$LӃPLt$ MIH\$?fHLAԅx>u" $nIIIII)D$I)M9MuA+yM9LMLt$ w3$IEIIMII)D$IM9MBHLINjD$?HD$0HT$MHLHD$8I)H)L9IO…lHcLHH)<$L :@HHI9NPuLML)I)H)L9IGHc~-HLH)HI@AIHM9ANPuIcH9LIcH9,1I)HLD$HD$0fD<$Hct$LL9HHHH@xQcDD$LMMLt$ H\$0HH\$H9\$@LD,$IH$HH\$@H9\$HshL)LIHIHH9fDLHӅ~9EH8IHUIHEM)L)H9|$sHMuŋEA+MHL|$@HD$@H;$uHX[]A\A]A^A_f.Ht$(LLDHH9HHHHHxHQB@<$HcL$Lt|f.A0HIHHAvPP@H|$AE+=4$H|$8IMHHIEHl$8D$ HL$(fIH0HIHHIvHPH|$0HT$HHHHHH(HIHMD4 HHcIH|$McIHHILAׅLLAׅLl$LLAׅMHMHD$LM4HHD$ LHD$HAׅ`LLAׅLd$LLAׅMIHD$ L4LLHD$HAׅ5HLAׅLt$HLAׅLILLAׅLLAׅLLA׋<$MIM<$Hct$HD$fDA $HHIHHAT$\LML)I)H)L9IGHcHcLH)Ѓ<$Hf.IH0HIHHIvHHIcH91H|$LHHLD$L $H$LD$L $<$HcL$HD$8IfA6HHIH@pAVKMILl$LL$A4$IڋA99f)ƅ39MIM%AׅLLAׅMIMHHHDHHHHHHHOHPLML)I)H)L9IGхHcLH)HLAׅLt$HLAׅLHH|$HcLcL A9MA29>AA)EHIA4$IOA9M4AAA)EINM)E.AA9AA)EEDA)MILI999MIMLLAׅLd$LLAׅMHAׅALl$LLAׅMIM%Ht$(HI $HHIHHHIT$cHL$(HI6HHIHHpIV9AA)LIT$IMAHcT$Ht0f.A $0HIHHAt$HHT$(DI $H0HIHHIt$HHhLd$0HD$LH(II9Ld$~D,$H$LL<$L9|$shMHI)LILI:f.HHAօ~4EHu[HEHHUHL)L)H9|$sMIuȋ+ELLH,$H$H9D$zHX[]A\A]A^A_AHcT$Ht%fA $0HIHHAt$HHT$(I $H0HIHHIt$HHM9A9xRDMMA9)IMIډM)IMI։M9xMILL$AWAVHcAUATHUSHIHhHD$8HRH|$ Ht$@LD$HT$,HD$XHD$ D$H u 1HD$H|$@ HD$@H\$ IILHN4XILl$X|$H\$ IHHIHD$ MD$HHHD$PHD$HLMIL9IMwHT$ HH|$AՃpLLd$0MLd$ INfLLH|$AօxCu%L$xIIUIIEI)D$I)L9MuAA+$yLL9MLd$0Iw2T$HIHII)D$HL9I&LMINjD$FHD$@H|$ HHL HD$HH)H)H9HOƅHcHH)Ѓ|$Lf.HHI9OPuLML)M)H)L9IG…Hc~/HLH)HH@A$IHL9AL$PuHcH9|IcH901I)HLL$ HD$@{@|$Hct$,LLf:HHHH@xJ[DLMMINjD$Ld$0H\$@HH\$ H9\$PLDd$IH\$HH\$PH9\$ skIHL)LMIH<@HLH|$Ӆ~9EMHEIHUIL)M)L9T$ sHIuA+EMHL|$PHD$PH;D$tHh[]A\A]A^A_@Ht$8LLDHH:HHHHHxHJ:@|$HcT$,L|DA $0HIHHAt$HJf.H|$ +3t$H|$HHHHHHl$HD$HT$8@I $H0HIHHIt$HHH\$@H|$ HHHH(L,HHIDMmC$McHJ'HcHHH|$HD$AׅHHt$H|$&AׅHHt$ H|$AׅHH\$ H\$K&ILLd$0MH|$LAׅHLH|$AׅHLH|$MAׅLIHD$0H|$I\L$HLAׅlLHH|$AׅLLH|$LAׅIILHt$H|$ALd$HLLAׅMLt$LHLA׋|$LI6|$HcT$,HD$ +A6HHIH@pANLML)M)H)L9IG…HcHcLH)Ѓ|$Hf.I $H8HIHHI|$HHHcH91LD$H|$ HLHLL$LT$HLL$LT$N|$HcT$,HD$HmA4$HHIH@pAL$HD$ MLHD$kH|$ AMAE79q)…9IIIAׅLt$HLLAׅLHHHLHHHHLGHHLML)M)H)L9IG҅HHcLH)LHH|$AׅLLH|$LAׅIHH\$ IcEH< Ic܋7LA9NAA)ELIAIOA9M$AA $A)EMOT I)A$A9AMAA)EAډA)MIMI99W9LIMIHLH|$AׅhHLH|$AׅIIILAׅHHt$ H|$AׅHI\$ H\$HT$8HI6HHIHHpINHT$8HI4$HHIHHpIL$9lj)LHI|$ IAHcT$,Lt'fAM0HIHHAuHNHT$8fDIMH0HIHHIuHHLd$@HD$ LH(II9Ld$5LDl$IH\$HH\$H9\$ seIHL)LMIH6fHLH|$Ӆ~5EMuWHEIHUIL)M)L9T$ sHIuA+EMHL|$HD$H9D$zHh[]A\A]A^A_AHcT$,Lt%fA $0HIHHAt$HHT$8I $H0HIHHIt$HHQAM99xUMMA 9AA)IMIډMAA)IMIԉM9xLMH|$ f.DHt;HLHHPH҈WtH9uHxuH)HHDHxuH)HfDAWAVAUATIUSHL/HOI9s)LfDx9tPI$HHBH9rI$uAD$u AD$Hw(I$ID$1H[]A\A]A^A_8]uH9sH-/e(HL)Ht:L5e(Lcf.LLHuB|=t,II.Huڃt/AT$pAD$bAFH[]A\A]A^A_AEVff.USHHhtHH[]ÐtHH[]fDHLcH Lc@LP1IMt fDNH (F HI9uKD H9t f.Hh HH H%H Hf.ATLgUSHHI9vR11%fHH4H]SL9TrtDH0BDFu΅~[]A\1fEuE Hu(HEHE[]A\ff.HHWH9r$OHu(H u(HGHHHH9v8[ux.uHS.HHHHKH9sHrH9v :.t=DSuCH5+u(H3Hs[f.Gk@z]uHH[ÐH9w | fUSHHH4HHHtHCHk H[]CuC Ht(HHCf.AUATUSHH)Lo(t6HHHw HIhHCHK(JH4H,iDHLIMgL9s,8}Lpu8IA~} M9M7uAGuAG fH_(I_(IIGIIIW(HپHLH)HEGEM7MgIO(M9sAPրv<A)S;A.qA[A(IG8H@hIG8L`hI  IG(KD@EOEOIIWH9s$HHH9v 8\)\LI  IG(KEGEIIOH9vLHPH9vC8\qAu2Mw(AGHX(IIGH1A$L@1Mw(EoHIEGIG8H@IG8@DMw(IIOLeA{ADD`HIHHAOMcFHLHKAGIG8@dIIODH9s%*HpH9v \IIOMw(DID(A\EgEuAGHOW(IGHHBIDAEA)AwtwDIW(HLIHLL)H6IW(EOL)EHLXLEGMw(E]IIOL11f.A*u#uEWEuAG HvV(IIGALKIIOH;L$ t(AWMNMO(IG8H@IG8@HI_(H9\$HH[]A\A]A^A_@IG8@$E_Ez1Ҿ(LIIOf.LIIO@EWEAG fDA}Awf.L`LH)Mw(I1IO1LvfDPLIW(L)5E_EuAGHT(IIG@x{IHLIoM'IGI9s A<$,LLIIOH9rcAwuAG I_(H9\$HpT(IIGXAGuAGHLT(IIGHH[]A\A]A^A_fDHPH9v 8\H9tz\tIHHH9uIl@:}uH9ZAO^AG QfIT$H9IL$qAT$HL$DPL19ÉAuAG HhS(IIG@HD$ M'LIOD$<^D$= D$>]IHD$(HL$D$?IG'HL$M'LIO[LpLIIOH96HPH9)fDLhLL@LL8LHD$cHD$Hfx}PMw(H1I1Lx)ERx)HI{1Ҿ L1ҾLf.AWAVAUATAUSAHtO AIHuUHsIǿHHŹ tH L$ I9v.HfL$ H[]A\A]A^A_LI9rI)LHH|@H|$0δHHD$(HD$8tLt$MHl$HLt$Lt$D$ D$@IF@IfHH@PHH9uHHHEHEHExHHEP)HDžpEx1E Dm$E@EDEHHEXE`HEhELHEdDD$ EHT$8AHBHE0AWLD$ HT$8HHRHU8HE(HD$8H|$(H4艽HHET$ HEE1E1E1AHpHHLQHHXtXHp!Hxt1LIIfDHB<u9uAAI됋ELAEЍPAĉULACtjMِA9uJM HEALcmQH~(088u"1fDD<8D8<0u L9uE!AIAupHD$8(EtkLnH>(HD3EtKH{LuHA@D2H1IH譣H!%tL-dHY>(@AWAVIAUATMUSIHH8HT$LL$ M9 M<$IL|$MIWf.H=DH= RH=(H9\$HIM9KJ4H%H=0SvH9 H9oH9I9_(vU3@ @t$NT$H8Wu0_t+I9_ s%0sHpHL_C1H8[]A\A]A^A_H=`LMM~NLL%H=X'AH=HH=P H=8uEAIcHID$L@ImHI)HT$L\$(HL$L)H9FID$LHLD$H&T$pL\$(HL$LD$A@IcI9t@J9MuMLÉT$pH=H9\$8HCHDI9_ >I9_({ HD$@$~fDID4I%IKHH9ufHD$HHPH9\$"H2H{B HCIG H9SI9_( H9sHp@_I9_(3HpHfI9_(; rfH=pMaH=xH=hIAHI+T$IHHLID$LMLMH(HD$xPLL$0HT$H^_ID$J,0{ HL$A$fAGAGAGI9_({ HL$A$DAGHD$@$@AHO|Ll$A/HDIO%IDH4LxL9LEHMLD$xHLPLL$0yHAXAYI$JH0J%H9uf.ID$8HL$ HH9YHHAD$xLML)HLPLt$0HT$MHAZA[:LMHHD$ @HD$ IT$8MHHHD$ AHI+T$IHLLID$MHLMHhHPD$xPLL$0HT$fHZYID$Jl01f.L\$HMD$xLHLPLL$0HT$HA^Z]L\$AO4;D$pdP6H9\$&fDHl$ MHD$H9Df.AWAVIAUATMUSIHH8HT$LL$ M9 M<$IL|$MIWf.H=DH= RH=(H9\$HIM9KJ4H%H=0SvH9 H9oH9I9_(vU3@ @t$T$H8Wu0_t+I9_ s%ФsHpHL_C1H8[]A\A]A^A_H=`LMM~NLL%H=X'AH=HH=P H=8uEAIcHID$L@ImHI)HT$L\$(HL$L)H9FID$LHLD$H讬&T$pL\$(HL$LD$A@IcI9t@J9MuMLÉT$pH=H9\$8HCHDI9_ >I9_({ HD$@$~fDID4I%IKHH9ufHD$HHPH9\$"H2H{B HCIG H9SI9_( H9苢sHp@_I9_(a3HpHfI9_(; rfH=pMaH=xH=hIAHI+T$IHHLID$LMLMH(HD$xPLL$0HT$H^_ID$J,0{ HL$A$fAGAGAGI9_({ HL$A$DAGHD$@$@AHO|Ll$A/HDIO%IDH4LxL9LEHMLD$xHLPLL$0yHAXAYI$JH0J%H9uf.ID$8HL$ HH9YHHAD$xLML)HLPLt$0HT$MHAZA[:LMHHD$ @HD$ IT$8MHHHD$ AHI+T$IHLLID$MHLMHhHPD$xPLL$0HT$fHZYID$Jl01f.L\$HMD$xLHLPLL$0HT$HA^Z]L\$AO4;D$pdP6H9\$&fDHl$ MHD$H9Df.AWAAVAUATUSHˉHD$8IH9ALAHL$DɽAL$A~L$M4H LHX?H0t_QHtH H(uA~Tf.HMH9u[]A\A]A^A_fAAL|$ILHH9Bf.|$%HrA0HI8@f.AWAVIAUATMUSHHHHGhH;w HT$(HL$ H_PHD$HG`HD$8FD$HE1HHP(uHD$ HAILH}HSHwAZL;}(A[HD$HD$|$ E7|$1E1A H}AtK~IDt$0LD$Lt$ H}HHwEAPLLI_AYuDt$0H}HD$At8|$H|$0認L$HH|$0B_t_fuZAt*H|$0wHAH|$0Q!A_\$؃t0H|$0BHH|$0Bf|$_ A${/Ld$HL$H_(Ht$C<,LHIEHL$试L;|$(HLLLd$8ILRHEHt$HHP(=H}HESHT$0MLHwL;}(HD$XZDt$|$ A fDH}G$E1A AtEj1AAt%AABA_AHHwLLD$EAPHT$0H}HD$Y^DEcH}A _DA_G$bAAEAĂ_HAE+@AHD$HH[]A\A]A^A_D$]@AWAVAUATIUSH8L9LD$HIIHEHJHD$JHƁHXHxHHLt$H|$HHH_]HhHXLt IUILLH;LD$HLHHI"I9uLD$ILLLHHLD$LLLHIMH;\$H8L[]A\A]A^A_ÐLD%HHHH9uHLIUILLH{LD$HLHHIbI9uIFH|$H\$HHEHHH8%Mt6fHEI^IHJ%IJIV%H9LDMHLLHI9uHMH\$HJ<2H|$&fH(tH0tHt IDII@%LH+UHHEIH{fHp%LH+UHHEIHPELIUILLHLD$HLHHII9uIFH\$ ML|$(H\$MHD$IH MIHLILLHI9tHLH\$ ML|$(t9LD$HL$HxIMwHxLMAWAVAAUATUSH?etHD[]A\A]A^A_@HGxEHD$uՋ@@AljD$AtAHD$DIIIHx(@vNHD$@$LEAHHHD$HHAHD$8HL$8H9L$IAT@$LEAHHHD$HHAHD$8HL$8H9L$wHD$L@XMHD$HH9{A\$LLd$ Ll$(HIAIL9 E8,$uHL$HL)HcQ`H9|HL~uL\$Ld$ Ll$(H9l$8HD$H|$8Ll$hL$HD$pD$Hp8HH0H$$L$HDŽ$HHHD$HL$HHDŽ$HH$HDŽ$H$HDŽ$IHDŽ$HDŽ$IH|$@HL\$xIHD$PH$D$IIHD$`ID$HLALLHD$8L$HMAP[]IHD$($HD$ D$X$@HD$HL$@H9D(L9D$(HD$ HDD$|$ HD$ 11|$A %A@t>~DHEt?Ht DHHHDEuH)H[1HuqH[1H1DIIIMHu7H9Hu 1IHH1HHHHHI9wsIH?At|@IHcH)ʉIM IIIHHLHH HIIHII9rDHH9sEI9u@HF1Ð11HHI1@I9r 11I9V1ҸfDH1fHy'HtH1Zmf.11GmHAs&Ht(UHSH/s&HHHHuH[]HUHbfs_enqueue: Can't allocate memory for bfs_list cli_ac_addpatt: Can't allocate memory for list node cli_ac_addpatt: Can't realloc ac_listtable cli_ac_addpatt: Can't allocate memory for pt->trans cli_ac_addpatt: Can't allocate memory for AC node cli_ac_addpatt: Can't allocate memory for new->trans cli_ac_addpatt: Can't realloc ac_nodetable ac_special_altexpand: Generic alternates cannot contain negations ac_special_altexpand: Unexpected expression larger than expected ac_addspecial_add_alt_node: Can't allocate new alternate node ac_uicmp: unhandled wildcard type ac_uicmp: unhandled wild typing ac_special_altexpand: Unexpected closing parenthesis ac_addspecial: Mismatch in parsed and expected signature ac_special_altexpand: Missing closing parenthesis ac_findmatch: Unknown metatype 0x%x ac_findmatch: Unknown special cli_ac_addpatt: Can't realloc ac_pattable cli_ac_buildtrie: AC pattern matcher is not initialised cli_ac_init: Can't allocate memory for ac_root cli_ac_init: Can't allocate memory for ac_root->trans cli_ac_init: Can't allocate memory for ac_root->filter cli_ac_chklsig: Syntax error: Missing opening parenthesis chklexpr: Syntax error: Missing number after '%c' cli_ac_chklsig: Syntax error: Missing closing parenthesis cli_ac_chklsig: Can't parse %s cli_ac_chklsig: Syntax error: Missing left argument cli_ac_chklsig: Syntax error: Missing right argument cli_ac_chklsig: Calculation of lval failed cli_ac_chklsig: Calculation of rval failed cli_ac_chklsig: Incorrect operator type cli_ac_init: Can't allocate memory for data->offset cli_ac_init: Can't allocate memory for data->offmatrix cli_ac_init: Can't allocate memory for data->lsigcnt cli_ac_init: Can't allocate memory for data->lsigcnt[0] cli_ac_init: Can't allocate memory for data->lsig_matches cli_ac_init: Can't allocate memory for data->lsigsuboff_(last|first) cli_ac_init: Can't allocate memory for data->lsigsuboff_(last|first)[0] cli_ac_caloff: Can't calculate relative offset in signature for %s lsig_sub_matched lsig %u:%u at %u lsig_sub_matched: cli_calloc failed for cli_lsig_matches lsig_sub_matched: cli_malloc failed for cli_subsig_matches struct lsig_sub_matched: cli_realloc failed for cli_subsig_matches struct Checking macro match: %u + (%u - %u) == %u Canceled false lsig macro match cli_ac_scanbuff: mdata == NULL cli_ac_scanbuff: VI match for offset %x cli_ac_scanbuff: Can't allocate memory for mdata->offmatrix[%u] cli_ac_scanbuff: Can't allocate memory for mdata->offmatrix[%u][0] Matched signature for file type %s cli_ac_addtype: Can't allocate memory for new type node cli_ac_scanbuff: Can't allocate memory for newres %lu Matched signature for file type %s at %u cli_ac_addsig: Signature for %s is too short cli_ac_addsig: missing closing square bracket cli_ac_addsig: incorrect range inside square brackets cli_ac_addsig: Can't allocate newspecial ac_addspecial: Expression exceeds maximum alternate nesting limit cli_ac_addsig: Can't realloc new->special_table ac_special_altstr: Can't duplicate alternate expression cli_ac_special_altstr: Can't allocate newspecial->str ac_special_altstr: Can't apply negation operation to generic alternate strings ac_special_altstr: Can't allocate subexpr container cli_ac_addpatt: cannot use filter for trie cli_ac_addsig: Can't find a static subpattern of length %u cli_ac_addsig: Can't allocate memory for root->ac_reloff cli_ac_addsig: Missing closing parenthesis f*dcd{ddEclffjihhhLhrqpoooPoqtbm_pattab cli_bm_initoff: Can't allocate memory for data->offtab cli_bm_initoff: Can't allocate memory for data->offset cli_bm_initoff: Can't calculate relative offset in signature for %s cli_bm_scanbuff: Can't calculate relative offset in signature for %s hm_addhash_bin: failed to allocate size hash hm_addhash_bin: failed to add item to hashtabhm_addhash_bin: failed to grow hash array to %u entries hm_addhash_bin: failed to grow virusname array to %u entries hm_addhash_str: NULL root or hash hm_addhash_str: null or invalid size (%u) hm_addhash_str: invalid hash %s -- FIXME! hm_addhash_str: invalid hash %s  cli_scanbuff: engine == NULL cli_caloff: offstr == NULL EP+EP-SL+S%u+%uEOF-VI$%u$nonameFP SIGNATURE: %s:%u:%s W32S.bytecode matchicon %s %s cli_scandesc: engine == NULL md5sha1sha256Detected.By.Callbackmatcher_run: pcre max filesize (buf) exceeded (limit: %llu, needed: %u) matcher_run: performing regex matching on buffer with no map: %u+%u(%u) cli_caloff: Offset string too long cli_caloff: Invalid offset shift value cli_caloff: Invalid offset value cli_caloff: Invalid section number cli_caloff: Invalid offset string cli_caloff: Invalid macro($) in offset: %s cli_caloff: at most 32 macro groups supported cli_caloff: Invalid offset type for target %u cli_caloff: Not a relative offset (type: %u) cli_checkfp(md5): Found false positive detection (fp sig: %s), size: %d cli_checkfp(md5): Found false positive detection (fp sig: %s), size: * cli_checkfp(sha1): Found false positive detection (fp sig: %s) cli_checkfp(sha1): Found false positive detection via catalog file cli_checkfp(sha256): Found false positive detection (fp sig: %s) cli_checkfp(pe): PE file whitelisted due to valid embedded digital signature cli_checkfp(pe): PE file whitelisted by catalog file bytecode: matchicon only works with PE files matcher_run: pcre max filesize (map) exceeded (limit: %llu, needed: %llu) matcher_run: performing regex matching on full map: %u+%u(%u) >= %zu CDBNAME:%s:%llu:%s:%llu:%llu:%d:%u:%u:%p inner file blacklisted by callback: %s hhX8h`No viruses detectedVirus(es) detectedMalformed databaseBroken or not a CVD fileCan't unpack some dataCan't parse dataCan't open file or directoryCan't create new fileCan't unlink fileCan't get file statusCan't read fileCan't set file offsetCan't write to fileCan't access fileCan't create temporary fileCan't map file into memoryCan't allocate memoryTime limit reachedCL_EMAXRECCL_EMAXSIZECL_EMAXFILESFailure in bytecode testmodeMutex lock failedScanner still activeUnknown error code.so.7.1.1/usr/lib64unrarlibclamunrar_iface%s support loaded from %s %s Initialized %s engine bytecode engine in test mode cli_unlink: failure - %s VirusesHeuristic.Limits.Exceededcli_updatelimits%s/%s.so.7.so.aNull argument passed to functionInvalid argument passed to functionCan't verify database integrityCan't duplicate file descriptorCan't create temporary directoryCL_EFORMAT: Bad format or broken dataError during bytecode executionBad state (engine not initialized, or already initialized)Cannot init ltdl - unrar support unavailablelt_dladdsearchdir failed for %s searching for %s, user-searchpath: %s searching for %s: %s not found Cannot dlopen %s: %s - %s support unavailable libclamunrar_iface_LTX_unrar_extract_next_prepareCannot resolve: %s (version mismatch?) - unrar support unavailable libclamunrar_iface_LTX_unrar_extract_nextlibclamunrar_iface_LTX_unrar_closelibclamunrar_iface_LTX_unrar_opencl_engine_new: Can't allocate memory for cl_engine cl_engine_new: Can't allocate memory for memory pool cl_engine_new: Can't allocate memory for roots cl_engine_new: Can't initialize dynamic configuration cl_engine_new: Can't initialize password databases cl_engine_new: Can't initialize root certificates cli_engine_new: Cannot initialize stats gathering mutex cli_engine_new: failed to initialize YARA MaxRecursion: the value of 0 is not allowed, using default: %u MaxEmbeddedPE: negative values are not allowed, using default: %u MaxHTMLNormalize: negative values are not allowed, using default: %u MaxHTMLNoTags: negative values are not allowed, using default: %u MaxScriptNormalize: negative values are not allowed, using default: %u MaxZipTypeRcg: negative values are not allowed, using default: %u cl_engine_set_num: The field is read only cl_engine_set_num: CL_ENGINE_BYTECODE_SECURITY cannot be set after engine was compiled cl_engine_set_num: CL_ENGINE_BYTECODE_MODE cannot be set after engine was compiled cl_engine_set_num: CL_BYTECODE_MODE_OFF is not settable, use dboptions to turn off! cl_engine_set_num: Incorrect field number cl_engine_get_num: engine == NULL cl_engine_get: Incorrect field number cl_engine_get_str: engine == NULL cl_engine_settings_copy: Unable to allocate memory for settings %llu cli_hashfile(): Can't open file %s cli_append_virus: no memory for json virus array cli_append_virus: no memory for json virus name object Limit %s Exceeded: scanning may be incomplete and additional analysis needed for this file. %s: scansize exceeded (initial: %lu, consumed: %lu, needed: %lu) %s: filesize exceeded (allowed: %lu, needed: %lu) %s: files limit reached (max: %u) cli_rmdirs: Can't remove temporary directory %s: %s cli_rmdirs: Unable to allocate memory for path %llu cli_rmdirs: Can't remove some temporary directories due to access problem. cli_rmdirs: Can't remove nested directory %s cli_bitset_init: Unable to allocate memory for bs %llu cli_bitset_init: Unable to allocate memory for bs->bitset %u `P@0 p`P@0 `p4DDl,||\L< ,l|l\L<, |l\L<, 4$nntdTD4$ntdT.{Ignoring signature %s EngineFileSizeEntryPointIconGroup1IconGroup2ContainerHandlerTypeIntermediates%u.%u-%ulsigattribs: Empty TDB PUA.countsigs: Can't parse %s .cbc.wdb.fp.ftm.cat.db.db2.db3.hdb.hdu.mdb.mdu.hsb.hsu.sfp.msb.msu.ndb.ndu.ldb.ldu.sdb.zmd.rmd.pdb.cud.cdb.crb.idb.ioc.yar.yara.pwdb (Clam)%s.UNOFFICIAL${%u-%u}%u$%c%u%c%s/([\W_]|\A)%s([\W_]|\Z)/%s%si(W)%s(W)%c%c%02xyesdefaultYARA.%stest-hex%s/%.*s/STRING_IS_NO_CASE %s STRING_IS_ASCII %s STRING_IS_WIDE %s STRING_IS_FULL_WORD %s %zu: [%s] [%s] [%s%s%s%s] cli_dbgets: gzread() failed cli_dbgets: fread() failed Empty database file HTML.PhishingEmail.Phishingbuilt-inexternalcli_loadftm: Invalid offset Empty %s filetype database Target:%s,Target:0Empty %s password database N/AMalformed pattern line %d cli_loadcrt: subject: %s cli_loadcrt: public key: %s Number of certs: %d .impbytecode %u -> %s .infoDSIG:100002049ClamAV-VDB:.ign.ign2Can't map cat: %s Can't load %s: %s %s skipped %s loaded cl_load: engine == NULL Bytecode engine disabled Loading databases from %s %sdaily.cld%s/daily.cld%slocal.gdb%s/local.gdb%sdaily.cfg%s/daily.cfgclamav- Total Rules: %u Rules Loaded: %u Complex Conditions: %u Empty Rules: %u %sdaily.cvd%s/daily.cvd/usr/share/clamavStat()ing files in %s cl_free: engine == NULL (ac_only mode)cl_countsigs: Can't stat %s countentries: Can't open file %s lsigattribs: Incorrect format of attribute '%s' lsigattribs: Unknown attribute name '%s' lsigattribs: For backward compatibility the Engine attribute must be on the first position lsigattribs: Invalid argument for %s lsigattribs: Unknown file type '%s' in %s lsigattribs: No intermediate container tokens found.lsigattribs: Incorrect parameters in '%s' lsigattribs: Can't parse parameters in '%s' lsigattribs: Can't allocate memory for tdb->str lsigattribs: Unknown attribute type '%u' lsigattribs: For backward compatibility all signatures using new attributes must have the Engine attribute present and set to min_level of at least 51 (0.96) Skipping signature %s - no PUA prefix Skipping signature %s - bad syntax Skipping signature %s - too long category name Skipping PUA signature %s - excluded category init_tdb: Not supported attribute(s) in signature for %s, skipping init_tdb: Signature for %s not loaded (required f-level: %u) init_tdb: No target specified in TDB init_tdb: Not supported target type in signature for %s, skipping init_tdb: IconGroup is only supported in PE (target 1) signatures init_tdb: EntryPoint/NumberOfSections is only supported in PE/ELF/Mach-O signatures ytable_add_attrib: hexsig cannot be found ytable_add_attrib: invalid sigopt %02x ytable_add_attrib: ran out of memory for offset ytable_add_string: out of memory for new ytable entry ytable_add_string: out of memory for hexsig copy ytable_add_string: failed to reallocate new ytable table ytable_add_string: failed to add default offset cli_virname: Empty virus name cli_virname: Can't allocate memory for newname cli_parseadd(): missing terminator $ cli_parseadd(): macro signatures only valid inside logical signatures cli_parseadd(): invalid macro signature format cli_parseadd(): only 32 macro groups are supported cli_parseadd(): PCRE subsig mismatched '/' delimiter cli_parseadd(): PCRE subsig must contain logical trigger cli_parse_add(): Problem adding signature: missing bracket cli_parse_add(): Alternative match contains unsupported ranged wildcard cli_parse_add(): Alternative match cannot contain unbounded wildcards cli_parse_add(): Problem adding signature (1). cli_parse_add():Can't extract part %d of partial signature. cli_parse_add(): Problem adding signature (2). cli_parse_add(): Problem adding signature (3). cli_parse_add(): Problem adding signature (4). cli_parseadd(): Problem adding signature (1b). cli_sigopts_handler: invalidly called multiple times! cli_parse_add: wide modifier [w] is not supported for regex subsigs cli_parse_add: unmatched '[' in signature %s Invalid or unsupported ldb signature format cli_loadldb: skipping %s due to callback Invalid or unsupported ldb logic load_oneldb: Too many subsignatures: %u (max %u) cli_loadldb: The number of subsignatures (== %u) doesn't match the IDs in the logical expression (== %u) cli_loadldb: Broken logical expression or too many subsignatures cli_loadldb: Can't allocate memory for lsig cli_loadldb: Can't allocate memory for lsig->logic cli_loadldb: Can't realloc root->ac_lsigtable Invalid or unsupported ldb subsignature format cli_loadldb: Signature for %s uses invalid option: %02x Initializing engine->root[%d] cli_initroots: Can't allocate memory for cli_matcher Initializing AC pattern matcher of root[%d] cli_initroots: Can't initialise AC pattern matcher cli_initroots: Initializing BM tables of root[%d] cli_initroots: Can't initialise BM pattern matcher cli_loadyara(): newident == NULL cli_loadyara: skipping %s due to callback load_oneyara: skipping %s due to callback load_oneyara: skipping NULL string %s load_oneyara: literal strings are unsupported, reorganize existing code parse_yara_hex_string: Single byte subpatterns unsupported in ClamAV load_oneyara[verify]: cannot allocate memory for test cli_matcher load_oneyara: cannot initialize test ac root load_oneyara: cannot allocate memory for test lsig load_oneyara: cannot allocate test root->ac_lsigtable load_oneyara[verify]: string is too short: %s load_oneyara[verify]: recovered from database loading error load_oneyara[verify]: string failed test insertion: %s load_oneyara: hex string: [%.*s] => [%s] load_oneyara: cannot allocate memory for converted regex string 7374756c747a676574737265676578load_oneyara: regex string: [%.*s] => [%s] load_oneyara: string is too short %s load_oneyara: cannot allocate memory for converted generic string load_oneyara: generic string: [%.*s] => [%s] load_oneyara: failed to add 'nocase' sigopt load_oneyara: failed to add 'ascii' sigopt load_oneyara[verify]: wide modifier [w] is not supported for regex subsigs load_oneyara: clamav cannot support %d input strings, skipping %s load_oneyara: failed to add 'wide' sigopt load_oneyara: failed to add 'fullword' sigopt load_oneyara: yara rule contains no supported strings, skipping %s load_oneyara: yara rule contains too many subsigs (%d, max: %d), skipping %s load_oneyara: Can't allocate memory for lsig load_oneyara: code start is NULL load_oneyara: successfully loaded %s cli_loadyara: problem parsing yara file %s, yara rule %s cli_loadyara: failed to parse or load %u yara rules from file %s, successfully loaded %u rules. cli_loadyara: empty database file cli_loadyara: loaded %u of %u yara signatures from %s load_oneyara: error in parsing yara hex string load_oneyara: attempting to load %s cli_dbgets: Line too long for provided buffer cli_dbgets: Invalid data or internal buffer too small cli_dbgets: Preliminary end of data cli_loadhash: Can't allocate memory for buffer_cpy cli_loadhash: Invalid value for the size field cli_loadhash: Minimum FLEVEL field must be at least 73 for wildcard size hash signatures. For reference, running FLEVEL is %d cli_loadhash: skipping %s (%s) due to callback cli_loadhash: Malformed hash string at line %u cli_loadhash: Empty database file cli_loadhash: Problem parsing database at line %u cli_loadldb: Can't allocate memory for buffer_cpy Problem parsing database at line %u cli_loadndb: Can't allocate memory for buffer_cpy cli_loadndb: skipping %s due to callback Signature for %s not loaded (required f-level: %d) Not supported target type in signature for %s Problem parsing database at line %d *** Self protection mechanism activated. cli_loadmd: Can't allocate memory for buffer_cpy cli_loadmd: Invalid value for the 'encrypted' field cli_loadmd: Invalid value for the 'original size' field cli_loadmd: Invalid value for the 'compressed size' field cli_loadmd: Invalid value for the 'compression method' field cli_loadmd: Invalid value for the 'file number' field cli_loadmd: Invalid value for the 'max depth' field cli_loadmd: skipping %s due to callback cli_loadmd: Can't compile regular expression %s in signature for %s cli_loadftm: File type signature for %s not loaded (required f-level: %u) cli_loadftm: Invalid value for the first field cli_loadftm: Can't decode the hex string cli_loadftm: Unsupported mode %u Problem parsing %s filetype database at line %u Loaded %u filetype definitions cli_loadidb: Can't allocate memory for buffer_cpy cli_loadidb: Malformed hash at line %u (wrong token count) cli_loadidb: Malformed hash at line %u (wrong length) cli_loadidb: skipping %s due to callback cli_loadidb: Malformed hash at line %u (bad chars) cli_loadidb: Malformed hash at line %u (bad size) cli_loadidb: Malformed hash at line %u (bad spread data) cli_loadidb: too many icon groups! cli_loadidb: Empty database file cli_loadidb: Problem parsing database at line %u cli_loadidb: Malformed hash at line %u (bad color data) cli_loadidb: Malformed hash at line %u (bad gray data) cli_loadidb: Malformed hash at line %u (bad bright data) cli_loadidb: Malformed hash at line %u (bad dark data) cli_loadidb: Malformed hash at line %u (bad edge data) cli_loadidb: Malformed hash at line %u (bad noedge data) cli_loadpwdb: skipping %s due to callback cli_loadpwdb: Can't allocate memory for attributes cli_loadpwdb: Invalid container specified to .pwdb signature cli_loadpwdb: Invalid value for PWStorageType (third entry) cli_loadpwdb: Can't decode or add new password entry cli_loadpwdb: Unsupported PWStorageType %u Problem processing %s password database at line %u Loaded %u (%u skipped) password entries cli_yara_init: failed to create YARA global cli_yara_init: failed to create the YARA arena cli_yara_init: failed to create the YARA rules table cli_yara_init: failed to create the YARA objects table Detected race condition, ignoring old file %s cli_load(): Can't open file %s cli_loaddb: Can't allocate memory for buffer_cpy cli_loaddb: skipping %s due to callback cli_loaddb: cli_parse_add failed on line %d cli_loadcrt: line %u: Invalid number of tokens: %u cli_loadcrt: line %u: Invalid minimum feature level cli_loadcrt: Cert %s not loaded (required f-level: %u) cli_loadcrt: line %u: Invalid maximum feature level cli_ladcrt: Cert %s not loaded (maximum f-level: %s) cli_loadcrt: line %u: Invalid trust specification. Expected 0 or 1 cli_loadcrt: line %u: Cannot convert serial to binary string cli_loadcrt: line %u: Cannot convert subject to binary string cli_loadcrt: line %u: Cannot convert public key to binary string cli_loadcrt: line %u: Invalid code sign specification. Expected 0 or 1 cli_loadcrt: line %u: Invalid time sign specification. Expected 0 or 1 cli_loadcrt: line %u: Invalid cert sign specification. Expected 0 or 1 cli_loadcbc: skipping %s due to callback Only loading signed bytecode, skipping load of unsigned bytecode! Turn on BytecodeUnsigned/--bytecode-unsigned to enable loading of unsigned bytecode cli_loadcbc: Can't allocate memory for bytecode entry Unable to load %s bytecode: %s Bytecode %s has logical kind, but missing logical signature! Bytecode %s(%u) has logical signature: %s Problem parsing logical signature %s for bytecode %s: %s Bytecode logical signature skipped, but bytecode itself not?Out of memory allocating memory for hook %uCan only load 1 BC_STARTUP bytecode, attempted to load 2nd! Previous BC_STARTUP: %d %d by %s Conflicting BC_STARTUP: %d %d by %s Bytecode: unhandled bytecode kind %u cli_loadinfo: .info files can only be loaded from within database container files 11088894983048545473659556106627194923928941791795047620591658697413581043322715912172496806525381055880964520618400224333320534660299233983755341740679502866829909679955734391392668378361221524205396631090105151641270857277080310734320951653700508941717419168723942507890702904702707587451621691050754307850383399865346487203798464178537392211402786481359824461197231102895415093770394216666324484593935762408468516826633192140826667923494822045805347809932848454845886971706424360558667862775876072059437703365380209101697738577515476935085469455279994113145977994084618328482151013142393373316337519977244732747977cli_loadinfo: Incorrect digital signature cli_loadinfo: engine->dbinfo already initialized cli_loadinfo: Can't parse header entry cli_loadinfo: Incorrect file format cli_loadinfo: Invalid value in the size field cli_loadinfo: Malformed SHA256 string at line %u cli_loadinfo: Digital signature not found cli_loadinfo: Problem parsing database at line %u cli_loadign: Can't initialise AC pattern matcher cli_loadign: No signature name provided cli_loadign: Malformed MD5 string at line %u cli_loadcdb: Can't allocate memory for buffer_cpy cli_loadcdb: Container signature for %s not loaded (required f-level: %u) cli_loadcdb: skipping %s due to callback cli_loadcdb: Unknown container type %s in signature for %s, skipping cli_loadcdb: Can't compile regular expression %s in signature for %s cli_loadcdb: Invalid encryption flag value in signature for %s cli_loadcdb: Can't allocate memory for res2 in signature for %s Failed to load certificates from cat: %s cli_load: unknown extension - skipping %s cli_loadign: Problem parsing database at line %u cli_loadcdb: Invalid value %s in signature for %s cl_load(): can't load new databases when engine is already compiled cl_load(): Access denied for path: %s cl_load(): No such file or directory: %s cl_load(): Too many symbolic links encountered in path: %s cl_load(): File size is too large to be recognized. Path: %s cl_load(): An I/O error occurred while reading from path: %s cl_load: Can't get status of: %s cli_loaddbdir(): Can't open directory %s cli_loaddbdir(): dirname ends with separator cli_loaddbdir(): dbfile == NULL cli_loaddbdir(): error loading database %s cli_loaddbdir: Can't allocate memory for dbfile cli_loaddbdir(): error parsing header of %s Skipping unofficial database %s cli_loaddbdir(): No supported database files found in %s cl_load(%s): Not supported database file type $$$$$$$$$$$$ YARA $$$$$$$$$$$$ Malformed/Unsupported Rules: %u cl_statdbdir(): Null argument passed. cl_statdbdir(): Can't open directory %s cl_statchkdir: can't allocate memory for fname cl_statfree(): Null argument passed cl_statinidir: Cant' allocate memory for fname Matcher[%u]: %s: AC sigs: %u (reloff: %u, absoff: %u) BM sigs: %u (reloff: %u, absoff: %u) PCREs: %u (reloff: %u, absoff: %u) maxpatlen %u %s Unable to compile/load bytecode: %s cl_engine_addref: engine == NULL cl_countsigs: Can't open directory %s cl_countsigs: Unsupported file type 0:0:0000000c6a5020200d0a870a:JPEG2000:CL_TYPE_ANY:CL_TYPE_GRAPHICS0:0:000001b3:MPEG video stream:CL_TYPE_ANY:CL_TYPE_IGNORED0:0:000001ba:MPEG sys stream:CL_TYPE_ANY:CL_TYPE_IGNORED0:0:1f8b:GZip:CL_TYPE_ANY:CL_TYPE_GZ0:0:23407e5e:SCRENC:CL_TYPE_ANY:CL_TYPE_SCRENC0:0:252150532d41646f62652d:PostScript:CL_TYPE_ANY:CL_TYPE_PS0:0:28546869732066696c65206d75737420626520636f6e76657274656420776974682042696e48657820342e3029:BinHex:CL_TYPE_ANY:CL_TYPE_BINHEX0:0:2e524d46:Real Media File:CL_TYPE_ANY:CL_TYPE_IGNORED0:0:3e46726f6d20:Mail:CL_TYPE_ANY:CL_TYPE_MAIL0:0:424d:BMP:CL_TYPE_ANY:CL_TYPE_GRAPHICS0:0:425a68:BZip:CL_TYPE_ANY:CL_TYPE_BZ0:0:446174653a20:Mail:CL_TYPE_ANY:CL_TYPE_MAIL0:0:44656c6976657265642d546f3a20:Mail:CL_TYPE_ANY:CL_TYPE_MAIL0:0:44656c69766572792d646174653a20:Mail:CL_TYPE_ANY:CL_TYPE_MAIL0:0:456e76656c6f70652d746f3a20:Mail:CL_TYPE_ANY:CL_TYPE_MAIL0:0:466f723a20:Eserv mail:CL_TYPE_ANY:CL_TYPE_MAIL0:0:46726f6d20:MBox:CL_TYPE_ANY:CL_TYPE_MAIL0:0:46726f6d3a20:Exim mail:CL_TYPE_ANY:CL_TYPE_MAIL0:0:474946:GIF:CL_TYPE_ANY:CL_TYPE_GRAPHICS0:0:48692e20546869732069732074686520716d61696c2d73656e64:Qmail bounce:CL_TYPE_ANY:CL_TYPE_MAIL0:0:494433:MP3:CL_TYPE_ANY:CL_TYPE_IGNORED0:0:49545346:MS CHM:CL_TYPE_ANY:CL_TYPE_MSCHM0:0:4d5a:MS-EXE/DLL:CL_TYPE_ANY:CL_TYPE_MSEXE0:0:4d6573736167652d49443a20:Mail:CL_TYPE_ANY:CL_TYPE_MAIL0:0:4d6573736167652d49643a20:Mail:CL_TYPE_ANY:CL_TYPE_MAIL0:0:4f676753:Ogg Stream:CL_TYPE_ANY:CL_TYPE_IGNORED0:0:504b0304:ZIP:CL_TYPE_ANY:CL_TYPE_ZIP0:0:504b3030504b0304:ZIP:CL_TYPE_ANY:CL_TYPE_ZIP0:0:52494646:RIFF:CL_TYPE_ANY:CL_TYPE_RIFF0:0:52494658:RIFX:CL_TYPE_ANY:CL_TYPE_RIFF0:0:52617221:RAR:CL_TYPE_ANY:CL_TYPE_RAR0:0:52656365697665643a20:Raw mail:CL_TYPE_ANY:CL_TYPE_MAIL0:0:52657475726e2d506174683a20:Maildir:CL_TYPE_ANY:CL_TYPE_MAIL0:0:52657475726e2d706174683a20:Maildir:CL_TYPE_ANY:CL_TYPE_MAIL0:0:535a4444:compress.exed:CL_TYPE_ANY:CL_TYPE_MSSZDD0:0:5375626a6563743a20:Mail:CL_TYPE_ANY:CL_TYPE_MAIL0:0:546f3a20:Mail:CL_TYPE_ANY:CL_TYPE_MAIL0:0:582d4170706172656e746c792d546f3a20:Mail:CL_TYPE_ANY:CL_TYPE_MAIL0:0:582d455653:EVS mail:CL_TYPE_ANY:CL_TYPE_MAIL0:0:582d456e76656c6f70652d46726f6d3a20:Mail:CL_TYPE_ANY:CL_TYPE_MAIL0:0:582d4f726967696e616c2d546f3a20:Mail:CL_TYPE_ANY:CL_TYPE_MAIL0:0:582d5265616c2d546f3a20:Mail:CL_TYPE_ANY:CL_TYPE_MAIL0:0:582d53696576653a20:Mail:CL_TYPE_ANY:CL_TYPE_MAIL0:0:582d53796d616e7465632d:Symantec:CL_TYPE_ANY:CL_TYPE_MAIL0:0:582d5549444c3a20:Mail:CL_TYPE_ANY:CL_TYPE_MAIL0:0:60ea:ARJ:CL_TYPE_ANY:CL_TYPE_ARJ0:0:626567696e20:UUencoded:CL_TYPE_ANY:CL_TYPE_UUENCODED0:0:763a0a52656365697665643a20:VPOP3 Mail (UNIX):CL_TYPE_ANY:CL_TYPE_MAIL0:0:763a0d0a52656365697665643a20:VPOP3 Mail (DOS):CL_TYPE_ANY:CL_TYPE_MAIL0:0:789f3e22:TNEF:CL_TYPE_ANY:CL_TYPE_TNEF0:0:7f454c46:ELF:CL_TYPE_ANY:CL_TYPE_ELF0:0:89504e47:PNG:CL_TYPE_ANY:CL_TYPE_GRAPHICS0:0:b6b9acaefeffffff:CryptFF:CL_TYPE_ANY:CL_TYPE_CRYPTFF0:0:d0cf11e0a1b11ae1:OLE2 container:CL_TYPE_ANY:CL_TYPE_MSOLE20:0:ffd8ff:JPEG:CL_TYPE_ANY:CL_TYPE_GRAPHICS0:0:fffb90:MP3:CL_TYPE_ANY:CL_TYPE_IGNORED1:*:3c4120*(68|48)(72|52)4546:HTML data:CL_TYPE_ANY:CL_TYPE_HTML1:*:3c4120*(68|48)(72|52)6566:HTML data:CL_TYPE_ANY:CL_TYPE_HTML1:*:3c484541443e:HTML data:CL_TYPE_ANY:CL_TYPE_HTML1:*:3c48544d4c3e:HTML data:CL_TYPE_ANY:CL_TYPE_HTML1:*:3c486561643e:HTML data:CL_TYPE_ANY:CL_TYPE_HTML1:*:3c48746d6c3e:HTML data:CL_TYPE_ANY:CL_TYPE_HTML1:*:3c494652414d45:HTML data:CL_TYPE_ANY:CL_TYPE_HTML1:*:3c494d47:HTML data:CL_TYPE_ANY:CL_TYPE_HTML1:*:3c496d67:HTML data:CL_TYPE_ANY:CL_TYPE_HTML1:*:3c4f424a454354:HTML data:CL_TYPE_ANY:CL_TYPE_HTML1:*:3c4f626a656374:HTML data:CL_TYPE_ANY:CL_TYPE_HTML1:*:3c534352495054:HTML data:CL_TYPE_ANY:CL_TYPE_HTML1:*:3c536372697074:HTML data:CL_TYPE_ANY:CL_TYPE_HTML1:*:3c5441424c45:HTML data:CL_TYPE_ANY:CL_TYPE_HTML1:*:3c6120*(68|48)(72|52)4546:HTML data:CL_TYPE_ANY:CL_TYPE_HTML1:*:3c6120*(68|48)(72|52)6566:HTML data:CL_TYPE_ANY:CL_TYPE_HTML1:*:3c686561643e:HTML data:CL_TYPE_ANY:CL_TYPE_HTML1:*:3c68746d6c3e:HTML data:CL_TYPE_ANY:CL_TYPE_HTML1:*:3c696672616d65:HTML data:CL_TYPE_ANY:CL_TYPE_HTML1:*:3c696d67:HTML data:CL_TYPE_ANY:CL_TYPE_HTML1:*:3c6f626a656374:HTML data:CL_TYPE_ANY:CL_TYPE_HTML1:*:3c736372697074:HTML data:CL_TYPE_ANY:CL_TYPE_HTML1:*:3c7461626c65:HTML data:CL_TYPE_ANY:CL_TYPE_HTML1:*:4d5a{60-300}50450000:PE:CL_TYPE_ANY:CL_TYPE_MSEXE1:*:504b0304:ZIP-SFX:CL_TYPE_ANY:CL_TYPE_ZIPSFX1:*:526172211a0700:RAR-SFX:CL_TYPE_ANY:CL_TYPE_RARSFX1:*:60ea{7}0002:ARJ-SFX:CL_TYPE_ANY:CL_TYPE_ARJSFX1:*:60ea{7}0102:ARJ-SFX:CL_TYPE_ANY:CL_TYPE_ARJSFX1:*:60ea{7}0202:ARJ-SFX:CL_TYPE_ANY:CL_TYPE_ARJSFX1:*:a3484bbe986c4aa9994c530a86d6487d41553321454130(35|36):AUTOIT:CL_TYPE_ANY:CL_TYPE_AUTOIT1:*:efbeadde4e756c6c736f6674496e7374:NSIS:CL_TYPE_ANY:CL_TYPE_NULSFT0:0:5349502d48495420285349502f48:SIP log:CL_TYPE_ANY:CL_TYPE_IGNORED1:0:3c2540204c414e4755414745203d:HTML data:CL_TYPE_ANY:CL_TYPE_HTML0:0:7b5c7274:RTF:CL_TYPE_ANY:CL_TYPE_RTF:300:257:7573746172:TAR-POSIX:CL_TYPE_ANY:CL_TYPE_POSIX_TAR0:0:5b616c69617365735d:mirc ini:CL_TYPE_ANY:CL_TYPE_SCRIPT1:0,1024:0a(46|66)726f6d3a20{-1024}0a(4d|6d)(49|69)(4d|6d)(45|65)2d(56|76)657273696f6e3a20:Mail file:CL_TYPE_ANY:CL_TYPE_MAIL1:0,1024:0a(46|66)726f6d3a20{-2048}0a(43|63)6f6e74656e742d(54|74)7970653a20:Mail file:CL_TYPE_ANY:CL_TYPE_MAIL1:0,1024:0a(4d|6d)(49|69)(4d|6d)(45|65)2d(56|76)657273696f6e3a20{-2048}0a(43|63)6f6e74656e742d(54|74)7970653a20:Mail file:CL_TYPE_ANY:CL_TYPE_MAIL1:0,1024:0a(4d|6d)6573736167652d(49|69)643a20{-1024}0a(43|63)6f6e74656e742d(54|74)7970653a20:Mail file:CL_TYPE_ANY:CL_TYPE_MAIL0:0:cefaedfe:Mach-O LE:CL_TYPE_ANY:CL_TYPE_MACHO:450:0:cffaedfe:Mach-O LE 64-bit:CL_TYPE_ANY:CL_TYPE_MACHO:450:0:feedface:Mach-O BE:CL_TYPE_ANY:CL_TYPE_MACHO:450:0:feedfacf:Mach-O BE 64-bit:CL_TYPE_ANY:CL_TYPE_MACHO:450:0:cafebabe:Universal Binary/Java Bytecode:CL_TYPE_ANY:CL_TYPE_MACHO_UNIBIN:46:720:0:377abcaf271c:7zip:CL_TYPE_ANY:CL_TYPE_7Z:470:0:52656365697665642d5350463a20:Mail file:CL_TYPE_ANY:CL_TYPE_MAIL1:0,2048:0a(52|72)656365697665643a20{-2048}0a(43|63)6f6e74656e742d(54|74)7970653a20:Mail file:CL_TYPE_ANY:CL_TYPE_MAIL0:0:303730373031:CPIO NEWC:CL_TYPE_ANY:CL_TYPE_CPIO_NEWC:450:0:303730373032:CPIO CRC:CL_TYPE_ANY:CL_TYPE_CPIO_CRC:450:0:303730373037:CPIO ODC:CL_TYPE_ANY:CL_TYPE_CPIO_ODC:450:0:71c7:CPIO OLD BINARY BE:CL_TYPE_ANY:CL_TYPE_CPIO_OLD:450:0:c771:CPIO OLD BINARY LE:CL_TYPE_ANY:CL_TYPE_CPIO_OLD:451:*:496e7374616c6c536869656c6400{292}0600000000000000????????????????0000000001:ISHIELD-MSI:CL_TYPE_ANY:CL_TYPE_ISHIELD_MSI:450:0:255044462d:PDF document:CL_TYPE_ANY:CL_TYPE_PDF:30:531:*:255044462d??2e*737461727478726566*2525454f46:PDF:CL_TYPE_ANY:CL_TYPE_PDF:54:541:*:377abcaf271c:7zip-SFX:CL_TYPE_ANY:CL_TYPE_7ZSFX1:*:257064662d??2e*737461727478726566*2525454f46:PDF:CL_TYPE_ANY:CL_TYPE_PDF:54:541:*:257064662d??2e:PDF:CL_TYPE_ANY:CL_TYPE_PDF:30:531:0:255044462d*737461727478726566*2525454f46:PDF document:CL_TYPE_ANY:CL_TYPE_PDF:54:540:0:255044462d:PDF document:CL_TYPE_ANY:CL_TYPE_PDF:551:*:255044462d??2e:PDF:CL_TYPE_ANY:CL_TYPE_PDF:551:*:257064662d??2e:PDF:CL_TYPE_ANY:CL_TYPE_PDF:550:0:53594d430100:SYM DATFILE:CL_TYPE_ANY:CL_TYPE_IGNORED1:0,128:2f5247420a49440affffffffffffffffffffffffffffffffffffffffffffffff:PDF image:CL_TYPE_ANY:CL_TYPE_IGNORED0:0:377f0682002de218:SQLite WAL:CL_TYPE_ANY:CL_TYPE_IGNORED0:0:377f0683002de218:SQLite WAL:CL_TYPE_ANY:CL_TYPE_IGNORED0:0:53514c69746520666f726d6174203300:SQLite database:CL_TYPE_ANY:CL_TYPE_IGNORED0:0:d9d505f920a163d7:SQLite journal:CL_TYPE_ANY:CL_TYPE_IGNORED0:0:5a5753:SWF (LZMA compressed):CL_TYPE_ANY:CL_TYPE_SWF:810:0:435753:SWF (zlib compressed):CL_TYPE_ANY:CL_TYPE_SWF:710:0:465753:SWF (uncompressed):CL_TYPE_ANY:CL_TYPE_SWF:710:0:4d53434600000000:MS CAB:CL_TYPE_ANY:CL_TYPE_MSCAB1:*:4d53434600000000:CAB-SFX:CL_TYPE_ANY:CL_TYPE_CABSFX1:*:014344303031{2043-2443}4344303031:ISO9660:CL_TYPE_ANY:CL_TYPE_ISO9660:710:0:5b616c69617365735d:TAR-POSIX-CVE-2012-1419:CL_TYPE_ANY:CL_TYPE_POSIX_TAR1:8,12:19040010:SIS:CL_TYPE_ANY:CL_TYPE_SIS1:0,1024:44656c6976657265642d546f3a{-256}52656365697665643a:Mail file:CL_TYPE_ANY:CL_TYPE_MAIL1:0:cafebabe0000000?:Universal Binary:CL_TYPE_ANY:CL_TYPE_MACHO_UNIBIN:731:0:cafebabe0000001?:Universal Binary:CL_TYPE_ANY:CL_TYPE_MACHO_UNIBIN:731:0:cafebabe0000002?:Java class file:CL_TYPE_ANY:CL_TYPE_JAVA:731:0:cafebabe0000003?:Java class file:CL_TYPE_ANY:CL_TYPE_JAVA:731:EOF-512:6b6f6c79:DMG container file:CL_TYPE_ANY:CL_TYPE_DMG:750:0:78617221:XAR container file:CL_TYPE_ANY:CL_TYPE_XAR:754:1024:482B0004:HFS+ partition:CL_TYPE_PART_ANY:CL_TYPE_PART_HFSPLUS:754:1024:48580005:HFSX partition:CL_TYPE_PART_ANY:CL_TYPE_PART_HFSPLUS:750:0:FD377A585A00:XZ container file:CL_TYPE_ANY:CL_TYPE_XZ:751:510:55AA:Disk Image - Master Boot Record:CL_TYPE_ANY:CL_TYPE_MBR:770:512:4546492050415254:Disk Image - GUID Partition Table:CL_TYPE_ANY:CL_TYPE_GPT:771:0:4552{510}504D0000:Disk Image - Apple Partition Map:CL_TYPE_ANY:CL_TYPE_APM:770:0:7b20224d61676963223a2022434c414d4a534f4e763022:Internal properties:CL_TYPE_ANY:CL_TYPE_INTERNAL:781:*:3c7864703a786470:Adobe XDP - Embedded PDF:CL_TYPE_ANY:CL_TYPE_XDP:791:0:3c3f786d6c2076657273696f6e3d22312e3022*3c776f7264446f63756d656e74:Microsoft Word 2003 XML Document:CL_TYPE_ANY:CL_TYPE_XML_WORD:801:0:3c3f786d6c2076657273696f6e3d22312e3022*3c??3a776f7264446f63756d656e74:Microsoft Word 2003 XML Document:CL_TYPE_ANY:CL_TYPE_XML_WORD:801:0:3c3f786d6c2076657273696f6e3d22312e3022*3c576f726b626f6f6b:Microsoft Excel 2003 XML Document:CL_TYPE_ANY:CL_TYPE_XML_XL:801:0:3c3f786d6c2076657273696f6e3d22312e3022*3c??3a576f726b626f6f6b:Microsoft Excel 2003 XML Document:CL_TYPE_ANY:CL_TYPE_XML_XL:800:0:49492a00:TIFF Little Endian:CL_TYPE_ANY:CL_TYPE_GRAPHICS:810:0:4d4d:TIFF Big Endian:CL_TYPE_ANY:CL_TYPE_GRAPHICS:810:4:d0cf11e0a1b11ae1:HWP embedded OLE2:CL_TYPE_ANY:CL_TYPE_HWPOLE20:0:48575020446f63756d656e742046696c652056332e3030201a0102030405:HWP 3.x Document:CL_TYPE_ANY:CL_TYPE_HWP3:821:0:efbbbf3c3f786d6c2076657273696f6e3d22312e3022*3c4857504d4c:HWPML Document:CL_TYPE_ANY:CL_TYPE_XML_HWP:821:0:(4d|6d)(49|69)(4d|6d)(45|65)2d(56|76)657273696f6e3a20{-1024}0a(43|63)6f6e74656e742d(54|74)7970653a20:MHTML file:CL_TYPE_ANY:CL_TYPE_MHTML:831:*:0a(4d|6d)(49|69)(4d|6d)(45|65)2d(56|76)657273696f6e3a20{-1024}0a(43|63)6f6e74656e742d(54|74)7970653a20:MHTML file:CL_TYPE_ANY:CL_TYPE_MHTML:83=մo_in cli_untgz_cleanup() in cli_untgz() cli_untgz: Unpacking %s wb%oin cli_tgzload_cleanup() COPYINGcli_tgzload: Can't load %s in cli_tgzload() cli_cvdparse: Not a CVD file MD5(.tar.gz) = %s in cli_cvdload() daily.cli_cvdload: dbinfo error cli_untgz: Can't duplicate descriptor %d cli_untgz: Can't gzdopen() descriptor %d, errno = %d cli_untgz: Can't allocate memory for path cli_untgz: Incomplete block read cli_untgz: Slash separators are not allowed in CVD cli_untgz: Directories are not supported in CVD cli_untgz: Unknown type flag '%c' cli_untgz: Cannot close file %s cli_untgz: Cannot create file %s cli_untgz: Invalid size in header cli_untgz: Wrote %d instead of %d (%s) cli_tgzload: Can't duplicate descriptor %d cli_tgzload: Can't gzdopen() descriptor %d, errno = %d cli_tgzload: Can't fdopen() descriptor %d, errno = %d cli_tgzload: Can't allocate memory for dbio->buf cli_tgzload: Incomplete block read cli_tgzload: Slash separators are not allowed in CVD cli_tgzload: Directories are not supported in CVD cli_tgzload: Unknown type flag '%c' cli_tgzload: Invalid size in header cli_tgzload: File %s not correctly loaded cli_tgzload: Invalid checksum for file %s cli_tgzload: File %s not found in .info cl_cvdparse: Can't allocate memory for cvd cli_cvdparse: Can't parse the creation time cli_cvdparse: Can't parse the version number cli_cvdparse: Can't parse the number of signatures cli_cvdparse: Can't parse the functionality level cli_cvdparse: Can't parse the MD5 checksum cli_cvdparse: Can't parse the digital signature cli_cvdparse: Can't parse the builder name cli_cvdparse: No creation time in seconds (old file format) cl_cvdhead: Can't open file %s cl_cvdhead: Can't read CVD header in %s cli_cvdverify: Can't read CVD header cli_cvdverify: Cannot generate hash, out of memory cli_cvdverify: MD5 verification error cli_cvdverify: Digital signature verification error Detected duplicate databases %s and %s. The %s database is older and will not be loaded, you should manually remove it from the database directory. Detected duplicate databases %s and %s, please manually remove one of them ****************************************************** *** Virus database timestamp in the future! *** *** Please check the timezone and clock settings *** ************************************************** *** The virus database is older than 7 days! *** *** Please update it as soon as possible. *** ******************************************************************* *** This version of the ClamAV engine is outdated. *** *** Read https://www.clamav.net/documents/installing-clamav *** cli_cvdload: Corrupted CVD header cl_cvdverify: Can't open file %s cld_cvdverify: Can't create new engine cli_ndecode: value out of range cli_decodesig: Can't allocate memory for 'plain' SECURITY WARNING: MD5 basic test failure. 118640995551645342603070001658453189751527774412027743746599405743243142607464144767361060640655844749760788890022283424922762488917565551002467771109669598189410434699034532232228621591089508178591428456220796841621637175567590476666928698770143328137383952820383197532047771780196576957695822641224262693037cli_versig: Decoded signature: %s cli_versig: Signature doesn't match. cli_versig: Digital signature is correct. 100001027in cli_scantar() in cli_scanscript() at line 2772Heuristics.Structured.SSNin cli_scanhtml() %s/nocomment.html%s/notags.html%s/javascript%s/rfc2397VBADir: %s _vba_project%s/%s_%upowerpoint documentProject content: %s_1_ole10native_5_summaryinformation_5_documentsummaryinformationHasMacrosin scanrar() RAR: Encrypted main header RAR: call to lseek() failed Heuristics.Encrypted.RARRAR: Call to lseek() failed RAR: infected with %s RAR: Exit code: %d in cli_scangzip() 1.2.11GZip: InflateInit failed: %d GZipGZip: Infected with %s Bzip: decompress error: %d Bzip: Can't write to file. BzipBzip: Infected with %s Heuristic.XZ.DicSizeLimitcli_scanxzcli_scanxz: Infected with %s in cli_scanarj() ARJ: Error: %s ARJ: call to lseek() failed ARJ: infected with %s ARJ: Exit code: %d MHTML signature found at %u XDP signature found at %u XML-XL signature found at %u NSIS signature found at %u AUTOIT signature found at %u DMG signature found at %u GPT signature found at %u MBR signature found at %u PDF signature found at %u cli_scanembpe%s found CRITICAL: engine == NULL at line 2873 at line 2879 at line 2887 at line 2893 at line 2910 at line 2940CLAMJSONv0Magic at line 2946RootFileType at line 2951ContainedObjects at line 2968 at line 2976 at line 2987 at line 2992 at line 3020FileMD5 at line 3031 at line 3042%s found in descriptor %d in cli_scanszdd() in cli_scanhtml_utf16() in cli_scanole2() OLE2: %s in cli_scanscrenc() CryptFF: Infected with %s Descriptor[%d]: %s at line 3597Small data (%u bytes) at line 3602CRITICAL: fmap() failed at line 3612Invalid offset: %ld Data truncated: %zu -> %zu cli_map_scan: [%ld, +%lu) full scanjson written to: %s %s: %d.%03ums, performance: %s found Possibly Unwanted: %s prescan cbpostscan cbcachefiletyperawraw containerbytecodekerneluserTar: Can't create temporary directory %s Can't create temporary directory for PDF file %s cli_scanscript: exiting (file larger than MaxScriptSize) cli_scanscript: Unable to malloc %u bytes cli_scanscript: Can't generate temporary file/descriptor cli_scanscript: saving normalized file to %s cli_scanscript: can't write to file %s cli_scanscript: could not map file %s cli_scanscript: short read during normalizing emax_reached: marked parents as non cacheable cli_magic_scandesc: file whitelisted by callback cli_magic_scandesc: file blacklisted by callback cli_magic_scandesc: ignoring bad return code from callback cli_magic_scandesc: returning %d %s cli_magic_scandesc: file whitelisted by post_scan callback cli_magic_scandesc: file blacklisted by post_scan callback cli_magic_scandesc: ignoring bad return code from post_scan callback cli_scan_structured: %u credit card numbers detected Heuristics.Structured.CreditCardNumbercli_scan_structured: %u social security numbers detected cli_scandir: Unable to allocate memory for filename cli_scandir: Can't open directory %s. cli_scanhtml: exiting (file larger than MaxHTMLNormalize) cli_scanhtml: Can't create temporary directory %s cli_scanhtml: using tempdir %s cli_scanhtml: skipping notags (normalized size over MaxHTMLNoTags) Starting cli_scanmail(), recursion = %u Mail: Can't create temporary directory %s VBADir: Decompress VBA project '%s_%u' VBADir: WARNING: VBA project '%s_%u' decompressed to NULL VBADir: WARNING: VBA project '%s_%u' cannot be dumped to file VBADir: WARNING: VBA project '%s_%u' failed to write to file VBADir: VBA project '%s_%u' dumped to %s VBADir: Decompress WM project macro:%d key:%d length:%d VBADir: WARNING: WM project '%s' macro %d decrypted to NULL VBADir: detected a '_5_summaryinformation' stream VBADir: detected a '_5_documentsummaryinformation' stream cli_vba_scandir: Unable to allocate memory for fullname VBADir: Can't open directory %s. Heuristics.OLE2.ContainsMacrosRAR: Can't create temporary directory %s RAR: %s, crc32: 0x%x, encrypted: %u, compressed: %u, normal: %u, method: %u, ratio: %u RAR: Encrypted files found in archive. GZip: Can't generate temporary file. GZip: Can't read %u bytes @ %lu. GZip: Bad stream, nothing in output buffer. GZip: Bad stream, data in output buffer. Bzip: DecompressInit failed: %d Bzip: Can't generate temporary file. Bzip: premature end of compressed stream cli_scanxz: nomemory for decompress buffer. cli_scanxz: DecompressInit failed: %i cli_scanxz: Can't generate temporary file. cli_scanxz: decompressing to file %s cli_scanxz: premature end of compressed stream cli_scanxz: decompress error: %d cli_scanxz: Can't write to file. cli_scanxz: decompress file size exceeds limits - only scanning %li bytes ARJ: Can't create temporary directory %s ARJ: cli_unarj_prepare_file Error: %s ARJ: cli_unarj_extract_file Error: %s XML-WORD signature found at %u XML-HWP signature found at %u RAR/RAR-SFX signature found at %u cli_scanraw: failed to generate temporary file. ZIP/ZIP-SFX signature found at %u CAB/CAB-SFX signature found at %u ARJ-SFX signature found at %u 7Zip-SFX signature found at %u ISO9660 signature found at %u ISHIELD-MSI signature found at %u Recognized GUID Partition Table file cli_scanraw: MaxEmbeddedPE exceeded *** Detected embedded PE file at %u *** cli_scanembpe: Can't create file %s cli_scanembpe: Can't write to temporary file cli_scanembpe: Infected with %s cli_scanraw: Type %u not handled in fpt loop cli_magic_scandesc: returning %d %s (no post, no cache) CRITICAL: engine not compiled cli_magic_scandesc: Archive recursion limit exceeded (%u, max: %u) cli_magic_scandesc: cli_filetype2 returned CL_TYPE_ERROR magic_scandesc: no memory for json properties object %02x%02x%02x%02x%02x%02x%02x%02x%02x%02x%02x%02x%02x%02x%02x%02xcli_magic_scandesc: Hit recursion limit, only scanning raw file Raw mode: No support for special files fmap not backed by file, dumping ... fmap_fd: failed to generate temporary file. MSEXPAND: Can't generate temporary file/descriptor MSEXPAND: Decompressed into %s cli_scanhtml_utf16: Can't create file %s cli_scanhtml_utf16: using tempfile %s cli_scanhtml_utf16: Can't write to file %s cli_scanhtml_utf16: fmap of %s failed cli_scanhtml_utf16: Decoded HTML data saved in %s Can't create temporary directory for tnef file %s Can't create temporary directory for uuencoded file %s OLE2: Can't create temporary directory %s CHM: Can't create temporary directory %s Heuristics.Exploit.W32.MS05-002Heuristics.Exploit.W32.MS04-028CryptFF: Can't allocate memory CryptFF: Can't create file %s CryptFF: Can't write to descriptor %d CryptFF: Scanning decrypted data CryptFF: Decompressed data saved in %s cli_magic_scandesc: Not checking for embedded PEs (zip file > MaxZipTypeRcg) Descriptor[%d]: cli_scanraw error %s Descriptor[%d]: Continuing after cli_scanraw reached %s Descriptor[%d]: Continuing after cli_scanraw error %s in cli_magic_scandesc (reclevel: %u/%u) magic_scandesc: Can't fstat descriptor %d cli_map_scandesc: [%ld, +%lu), [%ld, +%lu) internal map error: %lu, %llu; %lu, %llu cli_map_scan: Data truncated: %lu -> %lu cli_map_scan: Small data (%u bytes) cli_map_scan: map error occurred [%ld, %zu] cli_map_scan: writing nested map content to temp file %s cli_map_scan: cli_writen error writing subdoc temporary file. cli_map_scan: error unlinking tempfile %s cli_map_scan: could not map sub-file scan_common; gettimeofday error: %s scan_common: no memory for json serialization. scan_common: can't allocate memory for bc_ctx scan_common: running deprecated preclass bytecodes for target type 13 scan_common: Can't create json properties file, ret = %i. scan_common: cli_writen error writing json properties file. cli_found_possibly_unwanted: CL_VIRUS cli_found_possibly_unwanted called, but virname is not set [{FrFr*r*rFrFr{$||{{}}}y}P}desc_name RTF: waiting for more data(1) RTF: waiting for more data(2) Preparing to dump rtf embedded object, description:%s RTF: next state: wait_data_size Dumping rtf embedded object of size:%lu Warning: attempt to pop from empty stack! ScanRTF: Unable to allocate memory for stack states ScanRTF -> Can't create temporary directory %s RTF: Unable to load rtf action table Invalid control word: maximum size exceeded:%s Decoding ole object RTF: waiting for magic RTF: description length:%lu RTF: in WAIT_DESC RTF: in WAIT_DATA_SIZE RTF: next state: DUMP_DATA in cli_scanrtf() objdata RTF:Push failure! ПОh 0(  blobDestroy blobArrayDestroy: %d Reopening closed blob Growing closed blob fileblobDestroy: %s fileblobScan, ctx == NULL %s is infected %s is clean blobSetFilename: %s Attempt to close a previously closed blob blobClose: recovered all %lu bytes blobClose: recovered %lu bytes from %lu fileblobDestroy: not saving empty file fileblobDestroy: %s not saved: report to https://bugzilla.clamav.net fileblobDestroy: file not saved (%lu bytes): report to https://bugzilla.clamav.net fileblobDestructiveDestroy: %s fileblobAddData: Can't write %lu bytes to temporary file %s fileblobScan, fullname == NULL fileblobPartialSet: saving to %s fileblobPartialSet: unable to create file: %s fileblobSetFilename: fdopen failed fileblobSetFilename: file %s saved to %s rfc822comments: Unable to allocate memory for out %llu rfc822comments: contains a comment Nothing new to save in the bounce message parseMHTMLComment: unbounded xml tag parseMHTMLComment: cannot initialize xmlReader Can't create the directory '%s' Insecure partial directory %s (mode 0%o) newline_in_header, check "%s" boundaryStart: found %s in %s Couldn't decode binhex file to %s getline_from_mbox: fmap need failed Invalid call to getline_from_mbox(). Refer to https://www.clamav.net/documents/installing-clamav Viruses pointed to by URLs not scanned in large message getHrefs: calling html_normalise_mem getHrefs: html_normalise_mem returned rfc2047: Unable to allocate memory for out %llu Unsupported RFC2047 encoding type '%c' - if you believe this file contains a virus, submit it to www.clamav.net parseMimeHeader: cmd='%s', arg='%s' Invalid content-type '%s' received, no subtype specified, assuming text/plain; charset=us-ascii parseMimeHeader: Unable to allocate memory for buf %llu Content-type '/' received, assuming application/octet-stream parseEmailHeaders: check '%s' Nothing interesting in the header parseEmailHeaders: finished with headers, moving body parseEmailHeaders: Fullline unparsed '%s' parseEmailHeaders: no headers found, assuming it isn't an email in parseEmailBody, %u files saved so far parseEmailBody: hit maximum recursion level (%u) parseEmailBody: number of files exceeded %u text/plain: Assume no attachments Changing message/rfc822-headers to text/rfc822-headers Content-type 'multipart' handler Multipart/%s MIME message contains no boundary header Multipart has no subtype assuming alternative Multipart MIME message has no body Found MIME attachment before the first MIME section "%s" Multipart MIME message contains no boundary lines (%s) Multipart %d: End of header information Part %d starts with a continuation line Multipart %d: headers not terminated by blank line Multipart %d: About to parse folded header '%s' Part %d has %d lines, rc = %d multipart/knowbot parsed as multipart/mixed for now Unsupported multipart format `%s', parsed as mixed Find out the multipart type (%s) No HTML code found to be scanned parseRootMHTML: cannot initialize read html document parseRootMHTML: cannot initialize xmlTextReader Multipart alternative handler Save non mime and/or text/plain part MIME type 'message' cannot be decoded Partial message received from MUA/MTA - message cannot be scanned Attempt to send Content-type message/external-body trapped Unsupported message format `%s' - if you believe this file contains a virus, submit it to www.clamav.net Message received with unknown mime encoding - assume application Saving main message as attachment Non mime part bounce message is not mime encoded, so it will not be scanned cli_mbox: I believe it's plain text which must be clean Save non mime part bounce message Found the start of another bounce candidate (%s) Found a bounce message with no header at '%s' Saving text part to scan, rc = %d parseEmailBody() returning %d Cannot get multipart preclass array Cannot get message preclass object Cannot assign message preclass object to multipart preclass array Mixed message part %d is of type %d No mime headers found in multipart part %d Found binhex message in multipart/mixed mainMessage Found binhex message in multipart/mixed non mime part Mixed message text part disposition "%s" Treating inline as attachment Text type %s is not supported Found message inside multipart (encoding type %d) Unencoded multipart/message will not be scanned Encoded multipart/message will be scanned Found multipart inside multipart Only text and application attachments are fully supported, type = %d Message number %d is infected Extract attachments from email %d Found a header line with space that should be blank parseEmailFile: check '%s' fullline %p Ignoring consecutive blank lines in the body parseEmailFile: Fullline unparsed '%s' parseEmailFile: no headers found, assuming it isn't an email cli_mbox called with NULL dir rfc822comments '%s'=>'%s' 7bit8bittext/plainFromReceivedFound a bounce message bounceNot found a bounce message hrefcomment.xmlMHTML_ERROR_XML_READER_MEM%s/clamav-partialPartial directory %s: %s filename=%s%sMust reset to %s rfc1341: %s, %s of %s outname: %s Can't open '%s' for writingCan't open '%s' for readingMessage-Id: Date: Dex-binhexBinhex file decoded to %s >From PH:Phishing found filename=textportionSaving main message := parseEmailHeader '%s' ?=rfc2047 '%s' quoted-printableDecoded as '%*.*s' rfc2047 returns '%s' mimeArgs = '%s' filename=unknown=?parseEmailHeaders End of header information parseEmailHeaders: return UNKNOWNNOENCODING(inline)alternativemixedNOMIMEQUOTEDPRINTABLEParsing mail file EncodingTypeFilenamerfc822-headersmimeType = %d Not a mime encoded message boundaryBoundaryNow read in part %d Empty part Ignoring fake end of headers Contentfilename=The message has %d parts Multipart related handler in parseRootMHTML mhtml.htmlMHTML_ERROR_HTML_READRootHTMLCompressModeMHTML_ERROR_XML_READER_IOMixed message with %d parts textpartdelivery-statusDecode rfc822 disposition-notificationexternal-bodyContent-Type:text/htmlmultipart/message/rfc822Received: by clamd (bounce) BodyMimeTypeMimeSubtypeMultipartNo plain text alternative inlineMime subtype "%s" Adding part to main message filename=mixedtextportionFinished recursion, rc = %d ContainedObjectsIndexClamAVFileTypeContent-Typein mbox() Deal with message number %d Finished processing message P I parseEmailFile parseEmailFile: return Heuristics.Phishing.Emailcli_mbox returning %d o:documentpropertiesDocumentPropertieso:authoro:lastauthorLastAuthoro:revisionRevisiono:totaltimeTotalTimeo:createdCreatedo:lastsavedLastSavedo:pagesPageso:wordsWordso:charactersCharacterso:companyCompanyo:linesLineso:paragraphsParagraphso:characterswithspacesCharactersWithSpaceso:versiono:officedocumentsettingsDocumentSettingsw:worddocumentWordDocumentw:latentstylesLatentStylesheadHeadmetaMetalinkLinkBASE64EIGHTBITBINARYUUENCODEYENCODEEEXTENSIONAUDIOIMAGEMESSAGEMULTIPARTMEXTENSIONenrichedrichtextdigestsignedparallelrelatedreportappledoublefax-messagex-bfileknowbotknowbot-metadataknowbot-codeknowbot-stateContent-Transfer-EncodingContent-Disposition99+900HHx``base64chars = %d (%c %c %c) Received: BinHex=ybegin line=messageDedup messageDedup: out of memory Illegal hex character '%c' protocolEmpty content-type field messageSetMimeType: '%s' x-Empty content subtype messageAddArgument, arg='%s' *0*=*0=rfc2231 '%s' Invalid RFC2231 header: '%s' rfc2231 returns '%s' Add arguments '%s' Can't parse header "%s" Ignoring empty field in "%s" messageSetEncoding: '%s' 8 bitEncoding type %d is "%s" messageAddStr: out of memory %d trailing bytes to export begin sanitiseBase64 '%s' =yend name=attachment7-bit name=Set yEnc filename to "%s" Empty attachment not saved messageSavePartial %s/clamav-partial-%lu_%s-%umessageToFileblob messageToBlob multipartaudiovideobinaryx-uuencodex-yencodeus-asciix-uuemessageHasArgument: no '=' sign found in MIME header '%s' (%s) messageDedup reclaimed %lu bytes Discarding unwanted argument '%s' Incorrect MIME type: `plain', set to Text Unknown MIME type "%s" - guessing as %s (%d%% certainty) Unknown MIME type: `%s', set to Application - if you believe this file contains a virus, submit it to www.clamav.net rfc2331: out of memory, unable to proceed RFC2231 parameter continuations are not yet handled, returning "%s" rfc2331: out of memory for ret messageAddArgument, error from rfc2231() Possible data corruption fixed Possible data corruption not fixed messageAddArgument, '%s' contains no '=' Force mime encoding to application Unbalanced quote character in "%s" Can't parse header "%s" - if you believe this file contains a virus, submit it to www.clamav.net messageFindArgument: no '=' sign found in MIME header '%s' (%s) Broken content-transfer-encoding: '8 bit' changed to '8bit' Ignoring duplicate encoding mechanism '%s' Unknown encoding type "%s" - guessing as %s (%u%% certainty) Unknown encoding type "%s" - if you believe this file contains a virus, submit it to www.clamav.net messageAddLine: out of memory for m->body_last messageAddStrAtTop: out of memory messageMoveText sanity check: t not within old_message uudecode: buffer overflow stopped, attempting to ignore but decoding may fail messageExport: numberOfEncTypes == %d messageExport: Entering fast copy mode Unencoded attachment sent with no filename Not all decoding algorithms were run messageExport: enctype %d is %d messageExport: treat uuencode as text/plain Attachment sent with no filename Exported %lu bytes using enctype %d messageToText: export transfer method %d = %d messageToText: Unexpected attempt to handle uuencoded file Binhex messages not supported yet. @,**@,@,,*(This file must be converted with BinHex 4.0)Content-Transfer-Encoding>?456789:;<=  !"#$%&'()*+,-./0123tableInsert: Unable to allocate memory for table textMove fails sanity check textAdd fails sanity check textAdd: count = %d textToFileBlob, destroy = %d textMove: Unable to allocate memory for head textMove: Unable to allocate memory for head->next textCopy: Unable to allocate memory to clone object Couldn't grow the blob: we may be low on memory textToFileBlob to %s, destroy = %d bat_array index error [err name len: %d] [file] [dir ] [root] [unkn] r b u %s size:0x%.8x flags:0x%.8x OLE2: %s No root start block StreamsCL_TYPE_MSPPTCL_TYPE_MSWORDworkbookCL_TYPE_MSXLfileheaderHWP Document FileCL_TYPE_HWP5MSOOLE2: Can't create file %s ERROR: illegal Root Entry OLE2: filesize exceeded _xmlsignatures_signaturesHasDigitalSignatures%s/%.6dOLE2 dir entry: %s in cli_ole2_extract() OLE2 magic failed! Magic: 0x%x%x%x%x%x%x%x%x Minor version: 0x%x DLL version: 0x%x Byte Order: %d Big Block Size: %i Small Block Size: %i BAT count: %d Prop start: %d SBAT cutoff: %d SBat start: %d SBat block count: %d XBat start: %d XBat block count: %d Max block number: %lu OLE2: HWP signature: %.17s OLE2: HWP version: 0x%08x OLE2: HWP flags: 0x%08x OLE2: VBA project found OLE2: uniq_init() failed OLE2: no VBA projects found OLE2 [get_property_name2]: Unable to allocate memory for newname: %u OLE2 [get_property_name]: Unable to allocate memory for newname %u 0123456789abcdefghijklmnopqrstuvwxyzabcdefghijklmnopqrstuvwxyz._ole2: no memory for streams list or streams is not an array OLE2 [handler_writefile]: property name too long: %d OLE2 [handler_writefile]: Dumping '%s' to '%s' OLE2 [handler_writefile]: failed to create file: %s OLE2 [handler_writefile]: Unable to allocate memory for buff: %u OLE2 [handler_writefile]: init bitset failed OLE2 [handler_writefile]: Max block number for file size exceeded: %d OLE2 [handler_writefile]: Block list loop detected OLE2 [handler_writefile]: ole2_get_sbat_data_block failed scan_mso_stream: Invalid file descriptor argument scan_mso_stream: Can't stat file descriptor scan_mso_stream: Failed to get fmap for input stream scan_mso_stream: Can't generate temporary file scan_mso_stream: Can't initialize zlib inflation stream scan_mso_stream: Can't extract 4-byte prefix scan_mso_stream: stream prefix = %08x(%d) scan_mso_stream: Can't write to file %s scan_mso_stream: Error decompressing MSO file. No data decompressed. scan_mso_stream: Error decompressing MSO file. Scanning what was decompressed. scan_mso_stream: Decompressed %llu bytes to %s scan_mso_stream: declared prefix != inflated stream size, %llu != %llu scan_mso_stream: declared prefix == inflated stream size, %llu == %llu scan_mso_stream: Error reading MSO file OLE2 [handler_otf]: Dumping '%s' to '%s' OLE2: OTF handler init bitset failed OLE2: Max block number for file size exceeded: %d OLE2: Block list loop detected ole2_get_sbat_data_block failed likely_mso_stream: call to lseek() failed likely_mso_stream: reading from fd failed OLE2: detected a '_5_summaryinformation' stream OLE2: detected a '_5_documentsummaryinformation' stream OLE2: could not allocate new node for worklist! OLE2: work list is empty and ole2_list_pop() called! OLE2: Recursion limit reached (max: %d) OLE2: Property tree loop detected at index %d OLE2: files limit reached (max: %u) ERROR: unknown OLE2 entry type: %d cli_ole2_extract: failed to read header CAN'T PARSE: Invalid big block size (2^%u) CAN'T PARSE: Invalid small block size (2^%u) WARNING: Untested sbat cutoff (%u); data may not extract correctly OLE2 extract: Overflow detected CLSID: {%x%x%x%x-%x%x-%x%x-%x%x-%x%x%x%x%x%x} OLE2: identified HWP document create_vba_project: Unable to allocate memory for vba project structure create_vba_project: Unable to allocate memory for vba project elements get_unicode_name: Unable to allocate memory for newname get_unicode_name: odd number of bytes %d ppt_unlzw: inflateInit failed vba_read_project_strings: call to lseek() has failed call to lseek() in read name failed call to lseek() after get_unicode_name has failed vba_test_middle: call to lseek() failed vba_readdir: lseek() failed. Unable to guess VBA type vba_readdir: Unable to guess VBA type vba_readdir: call to lseek() while guessing big-endian has failed vba_readdir: Guessing big-endian vba_readdir: Guessing little-endian call to lseek() while checking alignment error has failed vba_readdir: VBA Record count %d vba_readdir: VBA Record count too big vba_readdir: zero name length vba_readdir: read name failed vba_readdir: cannot find project %s (%s) vba_readdir: project name: %s (%s) cli_decode_ole_object: can't create %s cli_decode_ole_object: decoding to %s cli_ppt_vba_read: Can't create temporary directory %s wm_readdir: No macros detected wm_readdir: macro offset: 0x%.4x wm_readdir: macro len: 0x%.4x wm_readdir: lseek macro_offset failed wm_readdir: read macro_info failed word_read_macro_info: Unable to allocate memory for macro_info->entries word_read_macro_entry: Unable to allocate memory for 'm' read macro_extnames failed to seek wm_readdir: unknown type: 0x%x cli_wm_readdir: Unable to allocate memory for vba_project cli_wm_decrypt_macro: Unable to allocate memory for buff %s/ppt%.8lx.docppt_unlzw: can't create %s [null]read name failed - rewinding length: %d, name: %s *\ghcdcall to lseek() has failed middle not found middle found lseek failed in cli_vba_readdir() vba_readdir: offset: %u ppt_stream_iter: seek failed ppt_unlzw failed in ppt_read_atom_header read ppt_header failed version: 0x%.2x instance: 0x%.2x type: 0x%.4x length: 0x%.8x read word_fib failed read macro_info failed macro count: %d read %d macro_entries failed read oxo3 record1 failed oxo3 records1: %d read oxo3 record2 failed read oxo3 failed lseek oxo3 failed oxo3 records2: %d read menu_info failed menu_info count: %d read macro_extnames failed ext names size: 0x%x read macro_intnames failed intnames count: %u skip_macro_intnames failed lllklklllllllllljjjlllllllllllllllllllllllllllllllllllllllllllllj.E .`M  E..`M MSEXPAND: Not supported file format MSEXPAND: File size from header: %u MSEXPANDversioninfo_cb: type: %x, name: %x, lang: %x, rva: %x WSAGetServiceClassNameByClassIdAWSAGetServiceClassNameByClassIdWOleCreatePropertyFrameIndirectcli_hashsect: skipping hash calculation for too big section cli_hashsect: unable to read section data scan_pe: import table data directory does not exist scan_pe: invalid rva for import table data scan_pe: failed to acquire fmap buffer scan_pe: invalid rva for dll name scan_pe: failed to read name for dll scan_pe: cannot duplicate dll name scan_pe: invalid rva for image first thunk scan_pe: cannot allocate import table json object scan_pe: cannot duplicate function name scan_pe: invalid name for imported function scan_pe: cannot allocate memory for imphash string cli_parseres_special: failed to read resource directory at:%lu cli_parseres_special: resources broken, ignoring cli_parseres_special: invalid resource table entry: %lu + %lu Can't read new header address cli_scanpe: Can't read file header Invalid PE signature (probably NE file) SizeOfOptionalHeader too small Can't read optional file header Incorrect SizeOfOptionalHeader for PE32+ SizeOfUninitializedData: 0x%x ------------------------------------ Can't allocate memory for section headers Found misaligned section, using 0x200 Broken PE file - Section %d starts or exists beyond the end of file (Offset@ %lu, Total filesize %lu) Section data (from headers - in memory) Section contains executable code Section's memory is executable Section's memory is writeable MDB hashset: %u:%02x%02x%02x%02x%02x%02x%02x%02x%02x%02x%02x%02x%02x%02x%02x%02x scan_pe_mdb: unable to read section data scan_pe_mdb: cli_malloc failed! MDB: %u:%02x%02x%02x%02x%02x%02x%02x%02x%02x%02x%02x%02x%02x%02x%02x%02x scan_pe: scan_pe_mdb failed: %s! Found PE values with sign bit set First section is in the wrong place Virtually misplaced section (wrong order, overlapping, non contiguous) cli_scanpe: can't allocate memory for bc_ctx cli_scanpe: NULL argument supplied kriz: using #%d as size counter kriz: loop out of bounds, corrupted sample? Polipos: Checking %d xsect jump(s) UPX/FSG/MEW: empty section found - assuming compression MEW: found MEW characteristics %08X + %08X + 5 = %08X MEW: Win9x compatibility was set! MEW: Win9x compatibility was NOT set! MEW: ESI is not in proper section MEW: section size (%08x) + diff size (%08x) exceeds max size of unsigned int (%08x) MEW: offdiff (%08x) exceeds section size + diff size (%08x) MEW: ssize %08x dsize %08x offdiff: %08x MEW: Can't read %d bytes [read: %lu] MEW: lzma proc out of bounds! MEW: Unpacked and rebuilt executable saved in %s MEW: Unpacked and rebuilt executable ***** Scanning rebuilt PE file ***** Upack: probably malformed pe-header, skipping to next unpacker Upack: Can't read raw data of section 0 Upack: Can't read raw data of section 1 Upack: Unpacked and rebuilt executable saved in %s Upack: Unpacked and rebuilt executable FSG: Size mismatch (ssize: %d, dsize: %d) FSG: xchg out of bounds (%x), giving up Can't read raw data of section %d FSG: Bad destination buffer (edi is %x should be %x) FSG: Source buffer out of section bounds FSG: Array of functions out of bounds FSG: Unpacked and rebuilt executable saved in %s FSG: Unpacked and rebuilt executable FSG: Successfully decompressed FSG: Support data out of padding area Can't read %d bytes from padding area FSG: Bad destination (is %x should be %x) FSG: Original section %d is misaligned FSG: Original section %d is out of bounds FSG: Unable to allocate memory for sections %llu FSG: Can't read raw data of section %d UPX: Size mismatch or dsize too big (ssize: %d, dsize: %d) UPX: Can't read raw data of section %d UPX: Looks like a NRV2B decompression routine UPX: Looks like a NRV2D decompression routine UPX: Looks like a NRV2E decompression routine UPX: UPX1 seems skewed by %d bytes UPX: Successfully decompressed UPX: Preferred decompressor failed UPX: NRV2B decompressor failed UPX: Successfully decompressed with NRV2B UPX: NRV2D decompressor failed UPX: Successfully decompressed with NRV2D UPX: NRV2E decompressor failed UPX: Successfully decompressed with NRV2E UPX: All decompressors failed UPX/FSG: Can't create file %s UPX/FSG: Can't write %d bytes UPX/FSG: Decompressed data saved in %s ***** Scanning decompressed file ***** Petite: v2.%d compression detected Petite: level zero compression is not supported yet Petite: Can't allocate %d bytes Petite: Unpacked and rebuilt executable saved in %s Petite: Unpacked and rebuilt executable PESping: Unable to allocate memory for spinned %lu PEspin: Unpacked and rebuilt executable saved in %s PEspin: Unpacked and rebuilt executable yC: Unable to allocate memory for spinned %lu yC: Unpacked and rebuilt executable saved in %s yC: Unpacked and rebuilt executable WWPack: Can't read %d bytes from headers WWpack: Probably hacked/damaged file. WWPack: Can't read %d bytes from wwpack sect WWPack: Unpacked and rebuilt executable saved in %s WWPack: Unpacked and rebuilt executable Aspack: Probably hacked/damaged Aspack file. Aspack: Unpacked and rebuilt executable saved in %s Aspack: Unpacked and rebuilt executable NsPack: Found *start_of_stuff @delta-%x NsPack: Unable to allocate memory for dest %u NsPack: Unpacked and rebuilt executable saved in %s NsPack: Unpacked and rebuilt executable bytecode PE hook: Unpacked and rebuilt executable saved in %s bytecode PE hook: Unpacked and rebuilt executable cli_peheader: Can't read file header cli_peheader: Unable to init vinfo hashset cli_peheader: parsing version info @ rva %x (%u/%u) cli_peheader: Unable to add rva to vinfo hashset VersionInfo (%x): '%s'='%s' - VI:%s cli_genhash_pe: cli_malloc failed! Section{%u}: failed to generate hash for section Imphash: failed to generate hash for import table (%d) WS2_32.dllwsock32.dllgetsockoptlistenselectsendtosetsockoptsocketGetAddrInfoWGetNameInfoWWSApSetPostRoutineFreeAddrInfoWWPUCompleteOverlappedRequestWSAAddressToStringAWSAAddressToStringWWSACloseEventWSAConnectWSACreateEventWSADuplicateSocketAWSADuplicateSocketWWSAEnumNameSpaceProvidersAWSAEnumNameSpaceProvidersWWSAEnumNetworkEventsWSAEnumProtocolsAWSAEnumProtocolsWWSAEventSelectWSAGetOverlappedResultWSAGetServiceClassInfoAWSAGetServiceClassInfoWgethostbyaddrgethostbynamegetprotobynamegetprotobynumbergetservbynamegetservbyportWSAInstallServiceClassAWSAInstallServiceClassWWSALookupServiceBeginAWSALookupServiceBeginWWSALookupServiceEndWSALookupServiceNextAWSALookupServiceNextWWSAProviderConfigChangeWSARecvDisconnectWSARemoveServiceClassWSAResetEventWSASendDisconnectWSASetServiceAWSASetServiceWWSASocketAWSASocketWWSAStringToAddressAWSAStringToAddressWWSAWaitForMultipleEventsWSCDeinstallProviderWSCEnableNSProviderWSCEnumProtocolsWSCGetProviderPathWSCInstallNameSpaceWSCInstallProviderWSCUnInstallNameSpaceWSCUpdateProviderWSCWriteNameSpaceOrderWSCWriteProviderOrderfreeaddrinfoWSAAsyncSelectWSAAsyncGetHostByAddrWSAAsyncGetHostByNameWSAAsyncGetProtoByNumberWSAAsyncGetProtoByNameWSAAsyncGetServByPortWSAAsyncGetServByNameWSACancelAsyncRequestWSASetBlockingHookWSAUnhookBlockingHookWSACancelBlockingCallWSAIsBlockingWSAStartupWSACleanup__WSAFDIsSetoleaut32.dllSysAllocStringSysReAllocStringSysAllocStringLenSysReAllocStringLenSysFreeStringSysStringLenVariantClearVariantCopyIndVariantChangeTypeVariantTimeToDosDateTimeDosDateTimeToVariantTimeSafeArrayDestroySafeArrayGetElemsizeSafeArrayGetUBoundSafeArrayGetLBoundSafeArrayLockSafeArrayAccessDataSafeArrayUnaccessDataSafeArrayGetElementSafeArrayPutElementSafeArrayCopyDispGetParamDispGetIDsOfNamesDispInvokeCreateDispTypeInfoCreateStdDispatchRegisterActiveObjectRevokeActiveObjectSafeArrayAllocDescriptorSafeArrayAllocDataSafeArrayDestroyDescriptorSafeArrayDestroyDataSafeArrayRedimSafeArrayAllocDescriptorExSafeArrayCreateExSafeArrayCreateVectorExSafeArraySetRecordInfoSafeArrayGetRecordInfoVarParseNumFromStrVarNumFromParseNumVarI2FromUI1VarI2FromDateVarI2FromStrVarI2FromDispVarI2FromBoolVarI4FromUI1VarI4FromDateVarI4FromStrVarI4FromDispVarI4FromBoolVarR4FromUI1VarR4FromDateVarR4FromStrVarR4FromDispVarR4FromBoolSafeArrayGetVartypeVarR8FromUI1VarR8FromDateVarR8FromStrVarR8FromDispVarR8FromBoolVarDateFromUI1VarDateFromI2VarDateFromI4VarDateFromR4VarDateFromR8VarDateFromCyVarDateFromStrVarFormatDateTimeVarCyFromUI1VarCyFromDateVarCyFromStrVarCyFromDispVarCyFromBoolVarBstrFromUI1VarBstrFromI2VarBstrFromI4VarBstrFromR4VarBstrFromR8VarBstrFromCyVarFormatPercentVarBoolFromUI1VarBoolFromI2VarBoolFromI4VarBoolFromR4VarBoolFromR8VarBoolFromCyVarBoolFromStrVarFormatCurrencyVarWeekdayNameVarMonthNameVarUI1FromI2VarUI1FromI4VarUI1FromR4VarUI1FromR8VarUI1FromCyVarUI1FromDateVarUI1FromStrVarUI1FromDispVarUI1FromBoolVarFormatFromTokensVarTokenizeFormatStringVarAddVarAndVarDivDllGetClassObjectDispCallFuncVariantChangeTypeExSafeArrayPtrOfIndexSysStringByteLenSysAllocStringByteLenDllRegisterServerVarEqvVarImpVarModVarMulVarPowVarSubCreateTypeLibLoadRegTypeLibQueryPathOfRegTypeLibLHashValOfNameSysLHashValOfNameSysAVarXorVarAbsVarFixOaBuildVersionClearCustDataVarIntVarNegVarNotVarCmpLoadTypeLibExSystemTimeToVariantTimeVariantTimeToSystemTimeUnRegisterTypeLibVarDecFromUI1VarDecFromI2VarDecFromI4VarDecFromR4VarDecFromR8VarDecFromDateVarDecFromCyVarDecFromStrVarDecFromDispVarDecFromBoolGetErrorInfoSetErrorInfoVarI2FromUI2VarI2FromUI4VarI2FromDecVarI4FromUI2VarI4FromUI4VarI4FromDecVarR4FromUI2VarR4FromUI4VarR4FromDecVarR8FromUI2VarR8FromUI4VarR8FromDecVarDateFromI1VarDateFromUI2VarDateFromUI4VarDateFromDecVarCyFromUI2VarCyFromUI4VarCyFromDecVarBstrFromI1VarBstrFromUI2VarBstrFromUI4VarBstrFromDecVarBoolFromI1VarBoolFromUI2VarBoolFromUI4VarBoolFromDecVarUI1FromI1VarUI1FromUI2VarUI1FromUI4VarUI1FromDecVarDecFromI1VarDecFromUI2VarDecFromUI4VarI1FromUI1VarI1FromDateVarI1FromStrVarI1FromDispVarI1FromBoolVarI1FromUI2VarI1FromUI4VarI1FromDecVarUI2FromUI1VarUI2FromI2VarUI2FromI4VarUI2FromR4VarUI2FromR8VarUI2FromDateVarUI2FromCyVarUI2FromStrVarUI2FromDispVarUI2FromBoolVarUI2FromI1VarUI2FromUI4VarUI2FromDecVarUI4FromUI1VarUI4FromI2VarUI4FromI4VarUI4FromR4VarUI4FromR8VarUI4FromDateVarUI4FromCyVarUI4FromStrVarUI4FromDispVarUI4FromBoolVarUI4FromI1VarUI4FromUI2VarUI4FromDecBSTR_UserSizeBSTR_UserMarshalBSTR_UserUnmarshalBSTR_UserFreeVARIANT_UserSizeVARIANT_UserMarshalVARIANT_UserUnmarshalVARIANT_UserFreeLPSAFEARRAY_UserSizeLPSAFEARRAY_UserMarshalLPSAFEARRAY_UserUnmarshalLPSAFEARRAY_UserFreeLPSAFEARRAY_SizeLPSAFEARRAY_MarshalLPSAFEARRAY_UnmarshalDllUnregisterServerOACreateTypeLib2VarCyMulI4VarCyRoundVarCyCmpR8VarBstrCatVarBstrCmpVarR4CmpR8VarR8RoundVarCatVarDateFromUdateExGetRecordInfoFromGuidsGetRecordInfoFromTypeInfoSetVarConversionLocaleSettingGetVarConversionLocaleSettingSetOaNoCacheVarCyMulI8VarDateFromUdateVarUdateFromDateGetAltMonthNamesVarI8FromUI1VarI8FromDateVarI8FromStrVarI8FromDispVarI8FromBoolVarI8FromUI2VarI8FromUI4VarI8FromDecVarI2FromUI8VarI4FromUI8VarR4FromUI8VarR8FromUI8VarDateFromI8VarDateFromUI8VarCyFromUI8VarBstrFromI8VarBstrFromUI8VarBoolFromI8VarBoolFromUI8VarUI1FromI8VarUI1FromUI8VarDecFromI8VarDecFromUI8VarI1FromUI8VarUI2FromI8VarUI2FromUI8OleLoadPictureExOleLoadPictureFileExSafeArrayCreateVectorSafeArrayCopyDataVectorFromBstrBstrFromVectorOleCreatePropertyFrameOleLoadPictureOleCreatePictureIndirectOleCreateFontIndirectOleTranslateColorOleLoadPictureFileOleSavePictureFileOleLoadPicturePathVarUI4FromI8VarUI4FromUI8VarI8FromUI8VarUI8FromI8VarUI8FromUI1VarUI8FromI2VarUI8FromR4VarUI8FromR8VarUI8FromCyVarUI8FromDateVarUI8FromStrVarUI8FromDispVarUI8FromBoolVarUI8FromI1VarUI8FromUI2VarUI8FromUI4VarUI8FromDecUnRegisterTypeLibForUserord%uImportTable.ocx.sysAMD64803868048680586R30000 (big-endian)R3000R4000R10000DEC Alpha AXPDEC Alpha AXP 64bitPowerPCIA64M68kMIPS16MIPS+FPUMIPS16+FPUHitachi SH3Hitachi SH3-DSPHitachi SH3-EHitachi SH4Hitachi SH5THUMBAM33Infineon TriCoreCEFEFI Byte CodeM32RCEEEUnknownNative (svc)Win32 GUIWin32 consoleOS/2 consolePOSIX consoleNative Win9x driverWinCE GUIEFI applicationEFI driverEFI runtime driverEFI ROM imageXboxBoot application(NULL)Heuristics.W32.Magistr.A.damHeuristics.W32.Magistr.AHeuristics.W32.Magistr.B.damHeuristics.W32.Magistr.Bcli_scanpe: ctx == NULL Can't read DOS signature Invalid DOS signature Heuristics.Broken.Executablee_lfanew == %d Not a PE file DLLFile type: DLL Machine type: %s ArchTypeBadNumberOfSectionsPE file contains %d sections PE file contains no sections NumberOfSections: %d TimeDateStamp: %sTimeDateStampSizeOfOptionalHeaderBadOptionalHeaderSizeBadOptionalHeaderSizePE32PlusFile format: PE MajorLinkerVersion: %d MinorLinkerVersion: %d SizeOfCode: 0x%x SizeOfInitializedData: 0x%x AddressOfEntryPoint: 0x%x BaseOfCode: 0x%x SectionAlignment: 0x%x FileAlignment: 0x%x MajorSubsystemVersion: %d MinorSubsystemVersion: %d SizeOfImage: 0x%x SizeOfHeaders: 0x%x NumberOfRvaAndSizes: %d MajorLinkerVersionMinorLinkerVersionSizeOfCodeSizeOfInitializedDataSizeOfUninitializedDataNumberOfRvaAndSizesMajorSubsystemVersionMinorSubsystemVersionBaseOfCodeSectionAlignmentFileAlignmentSizeOfImageSizeOfHeadersFile format: PE32+ Subsystem: %s SubsystemBad virtual alignment Bad file alignment Can't read section header Possibly broken PE file RawSizeRawOffset0x%08xVirtualAddressWritableSignedSection %d Section name: %s VirtualSize: 0x%x 0x%x VirtualAddress: 0x%x 0x%x SizeOfRawData: 0x%x 0x%x PointerToRawData: 0x%x 0x%x Section contains free space VirtualAddress is misaligned scan_pe: cli_malloc failed! MDB: %u:notgenerated EntryPoint out of file EntryPointOffsetEntryPoint offset: 0x%x (%d) IMP: %s:%u ImphashHeuristics.W32.Parite.Bin kriz kriz: using #%d as pointer Heuristics.W32.KrizHeuristics.W32.Polipos.AHeuristics.Trojan.Swizzor.GenHasEmptySectionMEW: mew section is empty MEWMEW: Size mismatch: %08x MEW: %u (%08x) bytes read PackerMEW: Can't create file %s MEW: Unpacking failed Upack characteristics found. Upack: var set Upack: var NOT set UpackUpack: Can't create file %s Upack: Unpacking failed FSGFSG: New ESP out of bounds FSG: New ESP (%x) is wrong FSG: New stack out of bounds FSG: found old EP @%x FSG: Can't create file %s FSG: Unpacking failed UPXuu Atx uR1ɃrFtuVSPUWVSUPX/FSG: lseek() failed PetitePetite: Can't create file %s Petite: Unpacking failed PEspinPESpin: Can't read %lu bytes PESpin: Can't create file %s PESpin: Size exceeded PEspin: Unpacking failed :3¬ՁU@SVWyC: Can't read %lu bytes yC%d,%d,%d,%d yC: Can't create file %s yC: Unpacking failed WWPackWWPack: Can't create file %s WWPack: Unpacking failed SU3AspackAspack: Can't create file %s Aspack: Unpacking failed NsPackNsPack: OEP = %08x NsPack: Can't create file %s NsPack: Unpacking failed SizeOfOptionalHeader: %x in cli_peheader Broken PE file Authenticode: %s Section{%u}: %u:%s Imphash: %s:%u +AWmʁ'=SuÂق'=Si׃/Qg}Մ-CYoۅ3Uk׆/QgӇ+AWrÈو5Kawω)?Zu׊%;Qg}ˋ%;Qg}ˌ/E[qɍߍ !7Mcyǎݎ 5K^tɏߏ&H^t̐$:Rh̑,BXrҒ*@VlГ 6Lb}ڔ7Mcyѕ.DZpȖޖ 6Lbxėߗ+AWmŘۘ3I_u͙%;Qg}՚-CYoǛݛ 5Ph~<œڜ ":Ph~؝<<0HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH0HHHHH< 4| Dt <DDd  >?456789:;<=  !"#$%&'()*+,-./0123%s() err %d %s() err %m <%zd %d> %s() %d %s() %d %d, %d %s() %d %d, %zd r+b%s() failed at %d %s() wrong mode %s() failed %d %s() failed to extract %d cli_scanmschmmspack_fmap_openmspack_fmap_readmspack_fmap_writemspack_fmap_seekcli_scanmscabMZ@ !L!This file was created by ClamAV for internal use and should not be run. ClamAV - A GPL virus scanner - http://www.clamav.net $PELCLAM  .clam%.2dPetite: Old EP: %x Petite: Sections dump: Petite: Rebuilding failed Petite: In troubles while attempting to decrypt old EP, using bogus %x Petite: Skipping section %d, Raw: %x, RSize:%x Petite: .SECT%d RVA:%x VSize:%x ROffset: %x, RSize:%x Petite: maximum number of sections exceeded, giving up. Petite: probably invalid file Petite: Found petite code in sect%d(%x). Let's strip it. Petite: Encrypted EP: %x | Array of imports: %x in wwunpack WWPack: Out of bits WWPack: decompression error WWPack: Array of structs out of section WWPack: Compressed data out of file WWP: src: %x, szd: %x, srcend: %x - %x WWPack: Unable to allocate memory for compd WWPack: unpack memory address out of bounds. WWPack: structs pointer out of bounds %p %x %p %x nspackunsp: table size = %d unspack: Unable to allocate memory for table Aspack: Unable to allocate dictionary Aspack: unpacking block rva:%x - sz:%x Aspack: unpacking failure Aspack: OOM - rebuild failed Aspack: rebuild failed Aspack: successfully rebuilt MEW: rete: %p %d %p %d %d || %p %d %p %d %d MEW: retf %p %p+%08x=%p, %p %p+%08x=%p FSG: Rebuilding failed FSG: .SECT%d RVA:%x VSize:%x ROffset: %x, RSize:%x MEWlzma: entering do while loop contain error! %p %08x ecx: %p [%p] contain error! %p %08x p0: %p [%p] MEW: base (%08x) + PE section RVA (%08x) exceeds max size of unsigned int (%08x) MEW: Buffer pointer (%08zx) + offset (%08zx) exceeds max size of pointer (%08lx) MEW: Data reference exceeds size of provided buffer. MEW unpacking section %d (%p->%p) Possibly programmer error or hand-crafted PE file, report to clamav team MEW: Section %i [%d, %d] exceeds destination size %u MEW: couldn't access lzma 'special' tag MEW: lzma %swas used, unpacking MEW: lzma initialization data not available! MEWlen: %08x ? %08x special MEW: WTF - please report MEW: Out of memory MEW: Rebuilding failed p0: %p p1: %08x p2: %08x state[%d] = %08x Upack: %p %p %08x %08x Upack: EBX: %08x Upack: DEST: %08x, %08x Upack: ecx counter: %08x Upack: before_fixing Upack v 1.1/1.2 Upack: alvalue out of bounds Upack: callfixerr Upack: Rebuilding failed Upack: EP: %08x original: %08X || %08x Upack: context bits out of bounds Upack: Context Bits parameter used with lzma: %02x, %02x Upack: loc_edi > end_edi breaks cli_rebuildpe() bb#11216 Upack: data initialized, before upack lzma call! Upack: EP: %08x original %08x Upack: something's wrong, report back Upack: probably hand-crafted data, report back Upack(alt begin): loc_edi > end_edi breaks cli_rebuildpe() bb#11216 Upack: loops: %08x search value: %02x Upack: callfixerr %p %08x = %p, %p Upack: Rebuilt section exceeds allocated buffer; breaks cli_rebuildpe() bb#11282 lineCreate: Unable to allocate memory for ret lineLink: linkcount too large (%s) In untar(%s) cli_untar: pos = %lu cli_untar: block read error cli_untarustarcli_untar: size = %d cli_untar: skipping entry %s/tar%02ucli_untar: extracting to %s cli_untar: Candidate checksum = %d, [%o in octal] cli_untar: Invalid checksum in tar header. Skip to next... cli_untar: Invalid checksum found inside archive! cli_untar: Checksum %d is valid. cli_untar: Incorrect magic string '%s' in tar header cli_untar: unknown type flag %c cli_untar: Invalid size in tar header cli_untar: would exceed limit, will try up to maxcli_untar: got negative skip size, giving up cli_untar: Can't create temporary file %s: %s cli_untar: Approaching limit... cli_untar: only wrote %d bytes to file %s (out of disc space?): %s cli_untar: No bytes read! Forcing end of file content. BBBBBB777777B777%s/zip.%03ucli_unzip: zinit failed cli_unzip: bzinit failed cli_unzip: extracted to %s cli_unzip: extraction failed %s/zip.decrypt.%03ucli_unzip: lh - out of file cli_unzip: lh - wrkcomplete cli_unzip: lh - bad magic Heuristics.Encrypted.Zipcli_unzip: ch - wrkcomplete cli_unzip: ch - fname: %s checking for %i: %s in cli_unzip cli_unzip: file too big cli_unzip: file too short cli_unzip: central @%x in cli_unzip_single cli_unzip: bad offset in unzip_search_add DEBUGGING MESSAGE GOES HERE! in unzip_search unzip_search: file too short unzip_search: central @%x in unzip_search_single cli_unzip: attempting to inflate stored file with inconsistent size cli_unzip: trimming output size to maxfilesize (%lu) cli_unzip: falied to write %lu inflated bytes cli_unzip: falied to write %lu bunzipped bytes cli_unzip: explode_init() failed cli_unzip: falied to write %lu exploded bytes cli_unzip: unsupported method (%d) cli_unzip: unknown method (%d) cli_unzip: call to lseek() failed cli_unzip: failed to create temporary file %s cli_unzip: decrypt - skipping encrypted file cli_unzip: decrypt - (v%u) >> 0x%02x 0x%x (moddate) cli_unzip: decrypt - (v%u) >> 0x%02x 0x%x (crc32) cli_unzip: decrypt - (v%u) >> 0x0000%02x%02x 0x%x (moddate) cli_unzip: decrypt - (v%u) >> 0x0000%02x%02x 0x%x (crc32) cli_unzip: decrypt - password [%s] matches cli_unzip: decrypt - decrypted %u bytes to %s cli_unzip: decrypt - failed to create fmap on decrypted file %s cli_unzip: decrypt - failed to acquire buffer on decrypted file %s cli_unzip: decrypt - skipping encrypted file, no valid passwords cli_unzip: decrypt - failed to create temporary file %s cli_unzip: lh - fname out of file cli_unzip: lh - ZMDNAME:%d:%s:%u:%u:%x:%u:%u:%u cli_unzip: lh - header has got unusable masked data cli_unzip: Encrypted files found in archive. cli_unzip: lh - has data desc cli_unzip: lh - extra out of file cli_unzip: lh - skipping empty file cli_unzip: lh - stream out of file cli_unzip: lh - data desc out of file cli_unzip: ch - flags %x - method %x - csize %x - usize %x - flen %x - elen %x - clen %x - disk %x - off %x cli_unzip: ch - fname out of file cli_unzip: ch - extra out of file cli_unzip: ch - comment out of file cli_unzip: ch - local hdr out of file cli_unzip: Can't create temporary directory %s cli_unzip: Files limit reached (max: %u) cli_unzip: central not found, using localhdrs unzip_search_add: adding %s (len %llu) unzip_search: cannot locate central directory HHHHHxHhhHHHHHHHHHHHooxml_updatelimits: Can't fstat descriptor %d ooxml_content_cb: xmlReaderForFd error for [Content_Types].xml application/vnd.openxmlformats-package.core-properties+xmlcli_process_ooxml: failed to find core properties file "%s"! ooxml_content_cb: found core properties file "%s" @ %x application/vnd.openxmlformats-officedocument.extended-properties+xmlcli_process_ooxml: failed to find extended properties file "%s"! ooxml_content_cb: found extended properties file "%s" @ %x application/vnd.openxmlformats-officedocument.custom-properties+xmlcli_process_ooxml: failed to find custom properties file "%s"! ooxml_content_cb: found custom properties file "%s" @ %x application/vnd.openxmlformats-package.digital-signature-xmlsignature+xmlOOXML_ERROR_MULTIPLE_CORE_PROPFILESCorePropertiesMissingFileCountOOXML_ERROR_MISSING_CORE_PROPFILEScli_process_ooxml: file does not contain core properties file OOXML_ERROR_MULTIPLE_EXTN_PROPFILESExtendedPropertiesMissingFileCountOOXML_ERROR_MISSING_EXTN_PROPFILEScli_process_ooxml: file does not contain extended properties file OOXML_ERROR_MULTIPLE_CUSTOM_PROPFILESCustomPropertiesMissingFileCountOOXML_ERROR_MISSING_CUST_PROPFILEScli_process_ooxml: file does not contain custom properties file ooxml_parse_document: xmlReaderForFd error ooxml_parse_document: encountered issue in parsing properties document ooxml_hwp_cb: xmlReaderForFd error ooxml_hwp_cb: encountered issue in parsing properties document cli_process_ooxml: failed to find version.xml! cli_process_ooxml: failed to find Contents/content.hpf! cli_process_ooxml: failed to find [Content_Types].xml! cli_process_ooxml: found [Content_Types].xml @ %x in ooxml_content_cb OOXML_ERROR_XML_READER_FDContentTypePartNameCorePropertiesFileCountExtendedPropertiesFileCountCustomPropertiesFileCountDigitalSignaturesCountin ooxml_parse_document properties.xmlin ooxml_extn_cb OOXML_ERROR_EXTN_XMLPARSEROOXML_ERROR_EXTN_MALFORMEDin ooxml_core_cb OOXML_ERROR_CORE_XMLPARSEROOXML_ERROR_CORE_MALFORMEDin ooxml_hwp_cb ooxml_hwp.xmlin cli_process_ooxml OOXML_ERROR_TIMEOUTOOXML_ERROR_NO_HWP_VERSIONOOXML_ERROR_NO_HWP_CONTENTOOXML_ERROR_NO_CONTENT_TYPESOOXML_ERROR_OUTOFMEMOOXML_ERROR_EMAXSIZEOOXML_ERROR_EMAXFILEShcfversionHCFVersionpackageLanguageMetaFieldscorepropertiesCorePropertiessubjectcreatorkeywordscommentsCommentsdescriptionlastmodifiedbymodifiedModifiedcategoryCategorycontentstatusContentStatusExtendedPropertiesApplicationappversionAppVersiondigsigDigSigdocsecurityDocSecurityhiddenslidesHiddenSlideshlinksHLinkshyperlinkbaseHyperlinkBasehyperlinkschangedHyperlinksChangedlinksuptodateLinksUpToDatemanagerManagermmclipsMultimediaClipsnotesNotespresentationformatPresentationFormatscalecropScaleCropshareddocSharedDocstemplateTemplatebindataBinaryData @` ` @6Hx 0 !1Aa  0@` #+3;CScsA@!  a`10  `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W3w7 g' G  _ c? o/ O       inflate 1.2.3 Copyright 1995-2005 Mark Adler in cli_check_mydoom_log() Heuristics.Worm.Mydoom.M.login cli_check_jpeg_exploit() Photoshop 3.0Found Photoshop segment read bim failed 8BIMmissed 8bim ID: 0x%.2x%.2x found thumbnail Exploit found in thumbnail in cli_check_riff_exploit() RIFXACONanihLISTPROPCAT suspiciousswizz_j48: %u, %u, %u cli_detect_swizz_str: %s cleancli_detect_swizz: gn: %lu, cli_detect_swizz: global: %s riff_read_chunk: recursion level exceeded riff_read_chunk: read list type failed cli_detect_swizz_str: %u, %u, %u cli_detect_swizz_str: %s, %u words cli_detect_swizz: %lu/%lu, version:%d, manifest: %d cli_detect_swizz: resources broken, ignoring in cli_binhex cli_binhex: file is empty cli_binhex(data)cli_binhex(resources)cli_binhex: file too short for header cli_binhex: decoding '%s' - %u bytes of data to %s - %u bytes or resources to %s cli_binhex: call to lseek() has failed cli_binhex: skipping resources (too small) cli_binhex: scanning partially extracted data fork cli_binhex: scanning partially extracted resource fork cli_binhex: broken file (missing stream start identifier) cli_binhex: Invalid character (%02x)   !"#$%&'()*+,-./0123456789:;<=>?ustar cli_tngs: file too small, ignoring tnef_header: ignoring trailing newline message tag 0x%x, type 0x%x, length %d Corrupt TNEF header detected - length %d TNEF body not being scanned - if you believe this file contains a virus, submit it to www.clamav.net TNEF: Incorrect length field in tnef_message TNEF: Error reading TNEF message attachment tag 0x%x, type 0x%x, length %d tnef_attachment: Unable to allocate memory for string TNEF - unsupported attachment tag 0x%x type 0x%d length %d TNEF: Incorrect length field in tnef_attachment TNEF: Error reading TNEF attachment TNEF - unknown level %d tag 0x%x Saving dump to %s: refer to https://www.clamav.net/documents/installing-clamav cli_tnef: flushing final data Saving TNEF portion with an unknown name cli_tnef: file truncated, returning CLEAN TNEF - found message TNEF - found attachment TNEF filename %s tnefcli_tnef: returning %d autoit: getbits() - not enough bits available autoit: no FILE magic found, extraction complete autoit: original filename '%s' autoit: bad file size - giving up autoit: advertised uncompressed size %x autoit: compressed size too small, skipping autoit: failed to read compressed stream. broken/truncated file? autoit: bad magic or unsupported version autoit: uncompressed size again: %x autoit: decompression error after %u bytes - partial file may exist autoit: file is not compressed autoit: cannot write %d bytes autoit: file successfully extracted autoit: call to lseek() has failed autoit: no FILE magic found, giving up autoit: magic string too long to print autoit: decompression error after %u bytes - partial file may exist autoit: script has got %u lines autoit: not enough space for an int autoit: not enough space for an int64 autoit: not enough space for a double autoit: not enough space for size autoit: size too big - needed %d, total %d, avail %d autoit: found unknown op (%x) autoit: decompilation aborted - partial script may exist autoit: %s successfully extracted autoit: Can't create temporary directory %s autoit: Extracting files to %s autoit: EA06 support not available(cannot extract ea06 doubles, unknown floating double representation). autoit: magic string '%s' autoit: skipping empty file autoit: compressed size: %x autoit: ref chksum: %x autoit: file is compressed autoit: file is too short %s/autoit.%.3uautoit: Can't create file %s autoit: file extracted to %s >>>AUTOIT SCRIPT<<<0x%08x 0x%016lx %g autoit: %s extracted to %s cli_autoit<>[+=-=/=&=in scanautoit() autoit: unknown method ?p@UNARJ: bounds exceeded Not an ARJ archive ERROR: bounds exceeded in cli_unarj_open Not in ARJ format ARJ Main File Header First Header Size: %d Min version: %d Host OS: %d Flags: 0x%x Security version: %d File type: %d Comment: %s Extended header size: %d Failed to read main header in cli_unarj_prepare_file ARJ File Header Method: %d Compressed size: %u Original size: %u in cli_unarj_extract_file PASSWORDed file (skipping) Target offset: %lu %s/file.uarin arj_unstore UNARJ: bounds exceeded - probably a corrupted file. arj_read_header: invalid header_size: %u Format error. First Header Size < 30 UNARJ: Unable to allocate memory for filename UNARJ: Unable to allocate memory for comment arj_read_file_header: invalid header_size: %u `r^^^gp^^^^^^^^^^q`qnlmtno]q5lkij>gEkfd%s/content.%.3u%s/headersNSIS: empty file found NSISNSIS: extraction complete NSIS: Empty file found. notin scannulsft() NSIS: Extracting files to %s NSIS: Overlays found NSIS: call to lseek() failed NSIS: reached EOF - extraction complete NSIS: reached CRC - extraction complete NSIS: next file is outside the archive NSIS: cannot read %u bytes at nsis/nulsft.c:236 NSIS: unable to create output file %s - aborting.NSIS: cannot write output file at nsis/nulsft.c:248 NSIS: decompressor init failed at nsis/nulsft.c:254 NSIS: cannot write output file at nsis/nulsft.c:269 NSIS: xs looping, breaking out at nsis/nulsft.c:283 NSIS: cannot write output file at nsis/nulsft.c:294 NSIS: bad stream at nsis/nulsft.c:301 NSIS: decompressor init failed NSIS: cannot read %u bytes at nsis/nulsft.c:322 NSIS: xs looping, breaking out at nsis/nulsft.c:340 NSIS: bad stream at nsis/nulsft.c:347 NSIS: cannot write output file at nsis/nulsft.c:376 NSIS: xs looping, breaking out at nsis/nulsft.c:385 NSIS: cannot write output file at nsis/nulsft.c:394 NSIS: bad stream at nsis/nulsft.c:401 NSIS: bad stream at nsis/nulsft.c:411 NSIS: Can't create temporary directory %s NSIS: Header info - Flags=%x, Header size=%x, Archive size=%x NSIS: Possibly truncated file NSIS: solid compression%s detected NSIS: bzip2 %u - lzma %u - zlib %u NSIS: Successully extracted file #%u 0pP@p  !1Aa  0@`pp #+3;CScs     ??endstreamcli_pdf: bad length %d endobj%s/pdf%02u_c/ColorsPDFStatsBigColorsJavascriptObjectsJBIG2Objects/KidsIncorrectPagesCount/CountAuthor_base64Creator_base64Producer_base64ModificationDateModificationDate_base64CreationDate_base64Title_base64Subject_base64Keywords_base64InvalidObjectCountJavaScriptObjectCountDeflateObjectCountActiveXObjectCountFlashObjectCountColorCountAsciiHexDecodeObjectCountAscii85DecodeObjectCountEmbeddedFileCountImageCountLZWCountRunLengthDecodeCountFaxDecodeCountJBIG2DecodeCountDCTDecodeCountJPXDecodeCountCryptCountStandardCountSignedCountOpenActionCountLaunchCountPageCountRichMediaCountAcroFormCountXFACountBadVersionBadHeaderPositionBadTrailerTooManyObjectsEncryptedDecryptableTruncatedObjects/Encrypt/EncryptMetadata/IDpdfcan't mmap pdf extracted obj /Subject/Keywords/Title/Creator/ModDate/CreationDate/Producer/Authorcli_pdf: %s: %s U: O: Computed UCandidate encryption keycomputed U (R2)fileIDcomputed U (R>=3)%%EOFdictionary not terminatedescaped common pdfnameduplicate stream filtersbad pdf versionbad pdf header positionbad pdf trailertoo many pdf objsbad deflate streambad deflate stream startbad stream startunknown filter usedbad ASCII decodehex javascriptreferencing nonexistent objhas /OpenActionhas /LaunchActionbad /Length, too smallPDF is encryptedlinearized PDFmore than 2 filters per objdecryptable PDFcli_pdf: enc is v2 cli_pdf: enc is aesv2 cli_pdf: enc is aesv3 cli_pdf: no key cli_pdf: enc is identity cli_pdf: enc is none cli_pdf: enc is unknown pdf_extract_obj: obj %u %u cli_pdf: dumping obj %u %u %s/pdf%02u/Length/XRef/DecodeParms/DP/JavaScript/JScli_pdf: encrypted string bytesleft: %d ... to %s cli_pdf: unknown filter %s /Hcli_pdf: found fileID ObjectsWithoutDictionariesObjectsWithBrokenDictionariesIdentity/CFMcli_pdf: %s CFM: %s AESV2AESV3Nonetruefalse/Pcli_pdf: invalid P /Standardcli_pdf: /Standard not found cli_pdf: invalid length: %d /Rcli_pdf: invalid R /StmF/StrF/EFF/CFcli_pdf: StmF: %s cli_pdf: StrF: %s cli_pdf: EFF: %s cli_pdf: EncryptMetadata: %s /UE/Ocli_pdf: invalid O: %d invalid Otoo long O/Ucli_pdf: invalid U: %u invalid Utoo long Udecryptablein cli_pdf(%s) cli_pdf: mmap() failed (1) %PDF-PDFVersionBadVersionLocationcli_pdf: mmap() failed (2) cli_pdf: %%%%EOF not found NoEOFstartxrefcli_pdf: startxref not found NoXREFcli_pdf: found xref cli_pdf: found /XRef cli_pdf: mmap() failed (3) Heuristics.Encrypted.PDFcli_pdf: flags 0x%02x cli_pdf: returning %d ASCIIHexDecodeASCII85DecodeA85AHxEmbeddedFileFlateDecodeFlLZWDecodeLZWRunLengthDecodeRLCCITTFaxDecodeCCFJBIG2DecodeDCTDecodeDCTJPXDecodeCryptLinearizedFilterLaunchRichMediaAcroFormXFA@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@t\\$$$$$$$$$$\Ԟ(N^NuAdNV..h>/ dSiztdTD4$tLPp hhhhhhhhhhcli_pdf: aes_decrypt: key length: %d, data length: %zu cli_pdf: aes_decrypt: key length is %d! cli_pdf: aes_decrypt: len is <32: %zu aes_decrypt: Calling rijndaelSetupDecrypt cli_pdf: aes_decrypt: nrounds = 0 aes_decrypt: Beginning rijndaelDecrypt cli_pdf: aes_decrypt: bad pad: %x (extra len: %zu) cli_pdf: aes_decrypt: bad pad: %x != %x cli_pdf: aes_decrypt: length is %zu cli_pdf: %s not found in dict cli_pdf: %s is invalid in dict pdf_readstring: Invalid, truncated dictionary. pdf_readstring: Unable to allocate buffer cli_pdf: unable to allocate memory... cli_pdf: %s has bad hex value cli_pdf: %s is invalid string in dict cli_pdf: can't create temporary file %s: %s cli_pdf: Found Encrypt dictionary but failed to parse objid cli_pdf: Found Encrypt dictionary but failed to parse genid cli_pdf: Encrypt dictionary in obj %lu %lu cli_pdf: can't allocate memory for bc_ctxcli_pdf: UE length is not 32: %zu check_user_password: Cannot allocate memory for pdf->key cli_pdf: Candidate encryption keycli_pdf: R value out of range cli_pdf: user password is empty cli_pdf: user/owner password would be required for decryption cli_pdf: out of memory parsing objects (%u) cli_pdf: Failed to parse object genid (%u) cli_pdf: Failed to parse object objid (%u) cli_pdf: %%EOF detected before end of file, at %zu cli_pdf: There appears to be an additional revision. Continuing to parse... cli_pdf: %s flagged in object %u %u cli_pdf: failed to parse object length cli_pdf: failed to parse object genid cli_pdf: length is in indirect object %lu %lu cli_pdf: indirect object not found cli_pdf: next object not found cli_pdf: failed to parse object length from indirect object cli_pdf: length out of file: %lld + %lld > %lld cli_pdf: calculated length %lld cli_pdf: calculated length %zu < %zu cli_pdf: orig length: %lld, length: %lld, size: %zu pdf_extract_obj: length and size both 0 -------------EXPERIMENTAL------------- cli_pdf: failed to locate DecodeParms dictionary start cli_pdf: extracted %td bytes %u %u obj cli_pdf: dumping contents %u %u cli_pdf: %u %u obj: no dictionary cli_pdf: %u %u obj: broken dictionary cli_pdf: %u %u obj broken dictionary cli_pdf: pdfname %s is escaped cli_pdf: duplicate stream filter %s cli_pdf: looking for trailer in linearized pdf: %ld - %ld cli_pdf: failed to parse object objid cli_pdf: found %s stored in indirect object %lu %lu cli_pdf: %u %u obj flags: %02x cli_pdf: pdf_handle_enc no file ID cli_pdf: can't find encrypted object %d %d cli_pdf: R value outside supported range [2..5] cli_pdf: invalid value for %s bool cli_pdf: Encrypt R: %d, P %x, length: %u cli_pdf: wrong key length, not multiple of 8 not decryptable, stream will probably fail to decompresscli_pdf: no PDF- header found cli_pdf: bad pdf version: %.8s cli_pdf: PDF header is not at position 0: %lld cli_pdf: failed to parse PDF trailer xref cli_pdf: did not find valid xref cli_pdf: (pre hooks) returned %d cli_pdf: (pre hooks) returning %d cli_pdf: found %d %d obj @%lld cli_pdf: Failed to parse object, likely an oversight in parser design. cli_pdf: unexpected return code %d. Timeout reached in the PDF parser cli_pdf: encrypted pdf found, %s! cli_pdf: (parsed hooks) returned %d cli_pdf: bad format object, skipping to next Heuristics.PDF.ObfuscatedNameObjectUTF-16array[%lu][%lu]: %s dict[%lu][%s]: %s dict[%lu][%s]: Array => pdf_convert_utf: could not initialize iconv for encoding %s: %s Malformed PDF: Alleged size of obj in PDF would extend further than the PDF data. t\D,/Typecli_pdf: Type: %s /Namecli_pdf: Name: %s %s/pdf%02u_%02uiJBIG2DECODEdetectiondecoding breakdecoding errorDCTDECODEJPXDECODEFAXDECODE~>cli_pdf: no EOF marker found cli_pdf: unexpected 'z' cli_pdf: inflateInit failed /EarlyChangecli_pdf: EarlyChange: %s cli_pdf: lzwInit failed cli_pdf: failed to decrypt stream cli_pdf: decrypted %zu bytes from %u total bytes cli_pdf: can't create intermediate temporary file %s: %s cli_pdf: decoded filter %d obj %u %u cli_pdf: failed to write output file cli_pdf: no filters or stream on obj %u %u cli_pdf: detected %lu applied filters cli_pdf: skipping decoding => non-filter CRYPT (reason: xref) cli_pdf: decoding => non-filter CRYPT cli_pdf: decoding [%d] => ASCII85DECODE cli_pdf: cannot allocate memory for decoded output cli_pdf: last quintet contains %d bytes cli_pdf: invalid last quintet (only 1 byte) cli_pdf: invalid character 0x%x @ %lu cli_pdf: deflated %lu bytes from %lu total bytes cli_pdf: error occurred parsing byte %lu of %lu cli_pdf: decoding [%d] => RLDECODE cli_pdf: required source length (%lu) exceeds remaining length (%lu) cli_pdf: cannot reallocate memory for decoded output cli_pdf: end-of-stream marker @ offset %lu (%lu bytes remaining) cli_pdf: decoded %lu bytes from %lu total bytes cli_pdf: decoding [%d] => FLATEDECODE cli_pdf: Z_OK on stream inflation completion cli_pdf: inflated %lu bytes from %lu total bytes (%lu bytes remaining) cli_pdf: after writing %lu bytes, got error "%s" inflating PDF stream in %u %u obj cli_pdf: after writing %lu bytes, got error %d inflating PDF stream in %u %u obj cli_pdf: no bytes were inflated. cli_pdf: decoding [%d] => ASCIIHEXDECODE cli_pdf: decoding [%d] => CRYPT cli_pdf: decoding [%d] => LZWDECODE cli_pdf: LZW_OK on stream inflation completion cli_pdf: unimplemented filter type [%d] => %s cli_pdf: unknown filter type [%d] cli_pdf: empty content, breaking after %d (of %lu) filters cli_pdf: stopping after %d (of %lu) filters (reason: %s) cli_pdf: no non-forced filters decoded, returning raw stream X hhspin: bogus opcode %x spin: bad emucode in unspin spin: Key8 is %x, Len is %x spin: Key is %x, Len is %x spin: Decrypting sects (xor) spin: done spin: POLY1 len is %x spin: poly1 out of bounds spin: cannot exec poly1 spin: cannot exec section spin: malloc(%zu) failed spin: malloc(%u) failed spin: Unpack failure spin: Not growing sect%d spin: decompression complete spin: Resources grown spin: No res?! spin: free bitmap is %x spin: Unable to allocate memory for spinned spin: Not spinned or bad version spin: len out of bounds, giving up spin: prolly not spinned, expect failure spin: password protected, expect failure spin: key out of bounds, giving up spin: crc out of bounds, giving up spin: Key32 is %x - XORbitmap is %x spin: sect %d out of file, giving up spin: POLYbitmap is %x - decrypting sects (poly) spin: poly1 emucode is out of file? spin: Compression bitmap is %x spin: Growing sect%d: was %x will be %x spin: Resources (sect%d) appear to be compressed uncompressed offset %x, len %x compressed offset %x, len %x spin: Failed to grow resources, continuing anyway spin: memory allocation failed, continuing anyway spin: Cannot write unpacked file yC: Bounds check assertion. Heuristics.BoundsCheckyC: Unhandled opcode %x yC: offset: %x, length: %x yC: decrypting sect%d yC: decrypting decryptor on sect %d yC: bad emulation length limit %u yC: Cannot write unpacked file ELF: Section type: Dynamic linking information ELF: Section type: Symbols for dynamic linking ELF: Section type: Array of pointers to termination functions ELF: Section type: Symbol hash table ELF: Section type: Array of pointers to initialization functions ELF: Section type: Empty section (NOBITS) ELF: Section type: Note section ELF: Section type: Null (no associated section) ELF: Section type: Array of pointers to preinit functions ELF: Section type: Program information ELF: Section type: Relocation entries w/o explicit addends ELF: Section type: Relocation entries with explicit addends ELF: Section type: String table ELF: Section type: Symbol table ELF: Section type: Provided symbol versions ELF: Section type: Required symbol versions ELF: Section type: Symbol Version Table ELF: Section contains writable data ELF: Section contains executable code ELF: File is little-endian - conversion not required ELF: File is big-endian - data conversion enabled ELF: Number of program headers: %d ELF: Suspicious number of program headers ELF: phentsize != sizeof(struct elf_program_hdr32) ELF: Program header table offset: %u ELF: Can't allocate memory for program headers ELF: Possibly broken ELF file ELF: Segment virtual address: 0x%x ELF: Segment virtual size: 0x%x ELF: Can't calculate file offset of entry point ELF: Entry point address: 0x%.8x ELF: Entry point offset: 0x%.8x (%d) ELF: phentsize != sizeof(struct elf_program_hdr64) ELF: Program header table offset: %lu ELF: Segment virtual address: 0x%lx ELF: Segment real size: 0x%lx ELF: Segment virtual size: 0x%lx ELF: Entry point address: 0x%.16lx ELF: Entry point offset: 0x%.16lx (%li) ELF: Number of sections > 2048, skipping ELF: Suspicious number of sections ELF: shentsize != sizeof(struct elf_section_hdr32) ELF: Section header table offset: %d ELF: Can't allocate memory for section headers ELF: Can't read section header ELF: shentsize != sizeof(struct elf_section_hdr64) ELF: Section header table offset: %lu ELF: Machine type: Intel 80386 ELF: Machine type: Motorola 68000 ELF: Machine type: MIPS RS3000 ELF: Machine type: IBM System/370 ELF: Machine type: PowerPC 64-bit ELF: Machine type: Digital Alpha ELF: Machine type: SPARC v9 64-bit ELF: Machine type: AMD x86-64 ELF: Machine type: Unknown (0x%x) ELF: Section type: Unknown ELF: Section occupies memory ELF: Can't read file header ELF: Not an ELF file ELF: ELF class 1 (32-bit) ELF: ELF class 2 (64-bit) ELF: Unknown ELF class (%u) ELFELF: Can't read segment #%d ELF: Segment #%d ELF: Segment type: 0x%x ELF: Segment offset: 0x%x ELF: Segment real size: 0x%x ELF: Segment offset: 0x%lx ELF: Number of sections: %d ELF: Section %u ELF: Section offset: %u ELF: Section size: %u ELF: Section offset: %lu ELF: Section size: %lu in cli_scanelf ELF: File type: None ELF: File type: Relocatable ELF: File type: Executable ELF: File type: Core ELF: File type: Unknown (%d) ELF: Machine type: None ELF: Machine type: SPARC ELF: Machine type: HPPA ELF: Machine type: PowerPC ELF: Machine type: IBM S390 ELF: Machine type: ARM ELF: Machine type: IA64 in cli_elfheader DCCCC4C4CEEE4C4C4CEtE4C4C4C4C4CTE4C4C4C4C4EED4C4C4C4C4C4C4C4C4C4C4C4C4C4C4C4C4CDD4CD4C4C4C4C4C4CC4C4C4C4C4C4C4C4C4C4C4CF6ETEDDDTETETEDxDTETETETETEXDTETETETE8DDCTETETETETETETETETETETETETETETETETECCTECTETETETETETE BTETETETETETETETETETETEESIS: OOM SIS: Unable to read string %s (%s - @%x, len %d) SIS: skipping %x %s/sis9x%02dSIS: Inflate failure (%d) simplecomponentrunnullmimesub siscontainer sisuninstall textnot to be installedSIS: Unable to read header SIS: Application name: SIS: Provides: SIS: Depends on: UID: %x v. %d.%d.%d aka: SIS: Package is%s compressed SIS: Read failed during GETD SIS: EOF SIS: Pkgtype: %d Original filename: %s Installed to: %s OOM Skipping empty file Unpacking failure %s/sis%02dSIS: I'm an option SIS: #if SIS: #elsif SIS: #else SIS: #endif SIS: Refusing to seek back SIS: Read failed during SKIP in scansis() SIS: unable to read UIDs SIS: UIDS %x %x %x - %x SIS: UIDs failed to match InvalidArrayCompressedVersionRangeUidUnusedControllerSupportedLanguagesSupportedOptionsPrerequisitesDependencyPropertyLogoFileDescriptionHashElseIfInstallBlockDataUnitFileDataSupportedOptionControllerChecksumDataChecksumSignatureBlobSignatureAlgorithmSignatureCertificateChainDataIndexCapabilitiesUK EnglishDanishNorwegianFinnishAmericanSwiss FrenchSwiss GermanIcelandicRussianHungarianDutchBelgian FlemishAustralian EnglishBelgian FrenchAustrian GermanNew Zealand EnglishInternational FrenchCzechSlovakPolishSlovenianTaiwanese ChineseHong Kong ChinesePRC ChineseJapaneseThaiAfrikaansAlbanianAmharicArabicArmenianTagalogBelarussianBengaliBulgarianBurmeseCatalanCroationCanadian EnglishInternational EnglishSouth African EnglishEstonianFarsiCanadian FrenchGaelicGeorgianCyprus GreekGujaratiHebrewHindiIndonesianIrishSwiss ItalianKannadaKazakhKmerKoreanLaoLatvianLithuanianMacedonianMalayMalayalamMarathiMoldovianMongolianNorwegian NynorskBrazilian PortuguesePunjabiRomanianSerbianSinhaleseSomaliInternational SpanishAmerican SpanishSwahiliFinland SwedishReservedTamilTeluguTibetanTigrinyaCyprus TurkishTurkmenUkrainianUrduVietnameseWelshZuluOtherSIS: Unable to read lengths and pointers SIS: %d:Got %s(%x) field with size %x SIS: %d:Got invalid(%x) field with size %x SIS: %d:Got dataunit element with size %x SIS: %d:Got filedata element with size %x SIS: File is%s compressed - size %x -> %x SIS: Warning: expected size %lx but got %lx SIS: File successfully inflated SIS: unable to create output file %s - aborting.SIS: Too many or too few languages found SIS: Unable to read languages SIS: Application without a name? SIS: Application without capabilities? SIS: No dependencies set for this application SIS: Unable to read dependencies SIS: File details: Options: %d Type: %s SIS: Read failed during GETD2 Unpacking lang#%d - ptr:%x csize:%x osize:%x Skipping ghost or otherwise out of archive file SIS: Unknown PKGtype, expect troubles SIS: Can't create temporary directory %s ^_a`_^^ocacccccc{cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccH]^_^^Yg\uudecode %s found uuencode file Message is not in uuencoded format Phishcheck: Unable to allocate memory for string_assign_dup Phishcheck: Encountered a host without a tld? (%s) Phishcheck: Weird, a name with only 2 levels (%s) Phishcheck: Real URL without protocol: %s Phishcheck: Unable to allocate memory for string_assign_concatenated Phishcheck:skipping invalid host Phishcheck: Unable to allocate memory for initialization Initializing phishcheck module Phishcheck: Compiling regex: %s Phishcheck: Error in compiling regex:%s Disabling phishing checks Phishcheck: Error in compiling regex, disabling phishing checks. Additionally an Out-of-memory error was encountered while generating a detailed error message Phishcheck module initialized Link URL is cloaked (null byte %00)Link URL contains username, and real<->displayed hosts don't match.Visible links is SSL, real link is notPhishcheck:Checking url %s->%s Looking up hash %s for %s(%u)%s(%u) Hash is whitelisted, skipping not analyzing, not a real url: %s Phishcheck:URL after cleanup: %s->%s Displayed 'url' is not url:%s Phishcheck: Phishing scan result: %s Heuristics.Phishing.Email.Cloaked.NumericIPHeuristics.Phishing.Email.Cloaked.NullHeuristics.Phishing.Email.SSL-SpoofHeuristics.Phishing.Email.Cloaked.UsernameHeuristics.Safebrowsing.Suspected-malware_safebrowsing.clamav.netHeuristics.Phishing.URL.BlacklistedHeuristics.Safebrowsing.Suspected-phishing_safebrowsing.clamav.netHeuristics.Phishing.Email.SpoofedDomainPhishcheck:host:%s ..%d.%d.%d.%d%nCleaning up phishcheck Freeing phishcheck struct Phishcheck cleaned up CleanURLs are way too differentBlacklistedUnknown return codeReal 'url' is not url:%s This hash matched: %s Hash matched for: %s svsymvmybvcvszaemzbzyemtczmqccazttlvmmaqmfbmytbfcmwfcfmwjemrtwmobocobdsgmxbgcgjmcalrqasnmklbgybncntkcisjgqtjgmgfmhgwkyuyiqmupmgbkzgdcuuzzmdkrupwggyunfzwkmfmdjkwginrkrfrzaglgppknapnkguaghnihkhnknfkkiukfivnvifjkpeheumobicoopasiaaeroarpaorgteljobsgovtravelmuseumproxn--g6w251dxn--80akhbyknj4fxn--0zwm56dxn--11b5bs3a9aj6gxn--deba0adxn--zckzahxn--jxalpdlpeduxn--hlcj6aya9esc7axn--kgbechtvxn--hgbk6aj7f53bbabizxn--9t4b11yi5aW`H0HЊגΒŒŒŒwa!g;s7Y%U"Ip uN6!HX2%{s@w\F+_: q_2'PT1        ^ *(http|https|ftp:(//)?)?[0-9]{1,3}(\.[0-9]{1,3}){3}[/?:]? *$ftp:http:https:mailto://mailto:hrefsrc><asp.netado.net.netPhishcheck: Unable to allocate memory for init_domainlist Phishing: looking up in whitelist: %s:%s; host-only:%d Phish_whitelist: Unable to allocate memory for whitelist_match add_pattern_suffix: Unable to allocate memory for regex add_newsuffix: Unable to allocate memory for new->pattern regex_list_match: Unable to allocate memory for buffer calc_pos_with_skip: skip:%llu, %llu - %llu "%s","%s" Ignoring false match: %s with %s, mismatched character: %c Lookup result: not in regex list new_preg: Unable to reallocate memory new_preg: Unable to allocate memory Unable to load regex list (null file) Regex list failed to initialize! regex list line %s not loaded (required f-level: %u) load_regex_matcher: skipping %s due to callback add_hash: Unable to allocate memory for path->virname add_hash: failed to add BM pattern regexLooking up in regex_list: %s calc_pos_with_skip:%s Got a match: %s with %s Before inserting .: %s No dot here:%s After inserting .: %s Lookup result: in regex list Regex list not loaded! Building regex list Loading regex_list phishingMalformed regex list line %d Overlong regex line %d Skipping hash %s Error loading line: %d, %c Error loading at line: %d make_charclass: Unable to allocate memory for character class make_node: Unable to allocate memory for new node dup_node: Unable to allocate memory for duplicate node make_node: Unable to allocate memory for leaf class parse_char_class: Unable to allocate memory for bitmap regex_suffix: Error compiling regular expression %s: %s regex_suffix: Error compiling regular expression: %s `80000000000000000008000000000000000000000000000(ȝ0000000000000000000000000000000ԟ|Rԟ,entconv: Destroying iconv pool:%p entconv: iconv:registering atexit entconv: failed to register atexit entconv: EBCDIC encoding is not supported in line mode entconv: encoding name is not valid, ignoring entconv: !Out of memory allocating TLS iconv instance entconv: Initializing iconv pool:%p entconv: !Unable to get TLS iconv cache! entconv: iconv not found in cache, for encoding:%s entconv: !Out of mem in iconv-pool entconv: iconv_open(),for:%s -> %p entconv: Encoding not accepted by iconv_open(): %s entconv: iconv stall (no output) in_iconv_u16: unprocessed bytes: %lu entconv: outleft overflown, ignoring entconv: closing iconv:%p UCS-4UCS-4LEUCS-4BEentconv: Encoding %s UTF32BEUTF32LEISO-10646/UTF8UTF-32BEUTF32ISO-10646/UCS2ISO-10646/UTF-810646-1:1993/UCS4ISO-10646UTF-32LEISO-10646/UCS410646-1:1993UTF-32rsaquoKcyemsp13clubsTaubcongocircUpsilondashvhairsppivfrac13aacgrvDashEtaboxUreurodblacspadesgelfrac15rArrdollarAcircang90scarondjcylcyblk34numeroosolnbspNJcysharpgcydrcropshchcypuncsptauboxDRagraveboxVrAringboxDrdgrssmileltrieboxHUbumpthere4thetaslceiljnodotbumpedlcroplegidigrboxVhsqcupgimelOmegaupsifrac38kgrOcircyacyhorbarIdigrbottomregxdtriIgrBcycuescuArrMgrflatDJcyEacutelarrPgrlArrnaturEumlNuecoloncrossljcydscydaggerTHgrconintXiSigmaangsphboxvlAumllsquorsqufordmJukcyTHORNboxuLkjcyheartsxutriDScyOmicrondarrmacruplusIcirctelrecbernoufrac45bcyellzwjOacutezwnjmdashVcynldrrfloorEpsilonPiverbarldotlElpardieogrbepsiutrifocircurrenpermilomegaefDotblockodashprsimxcircRgrsigmavGgrUgravelowbarbsimEgravessetmnshydivonxboxulffligoumlOtildemicrosqubgrZetaffiligboxhDsigmafYIcyolinenjcypgrmiddotomicronpcyasympblk12OslashsemiplusmnlowastdivideinodotbecauslfloorsquaremcylgrograveAlphaVerbarRhocoprodfrac34rxhyphensextfcyboxhulozPSgrUacgrBgriacuteradicXgrdrcornIacutesfrownDaggerSOFTcysup3eeacgrlsqbharrCaprparangstIumlboxUltwixtPrimeYumlepsilonZgrupsihbetaogonPcyLlubrcyohmhalfycyparabprimeesdotUbrcyboxVRboxVlnsubgammadincarerdquooacuteEEgridiagrwreathboxhdffllignablayicycaretgammaNcypsgrrhoiffboxdRfrac25acircNgrphgrsccueaacutemaltChicommadeltaszligblankOHgrtradedlcornrlmboxdLkappavltimesUcircperpboxhnotinurcropAEligboxHuboxVLfrac16hArralephsbquoIukcyicircintcaldzcyNtildeUgrequivboxDLiukcyominusforallsupErpargtsfgrEcirchardcycuveelozfboxvrboxdlmodelsIOcyboxvhfrac56YacuteuarrboxVHcoloneYUcyrthreecrarruacgrJsercyaposcupreprapRcythinspoeligeegrtdotgapLcyigraveDZcyboxurboxvRforkGgvcyaumlzetaCupdegbsimeoastboxvLthksimjsercyOumlrdquorugraveLgrrgrIacgrkhcythkapudiagrfrac35gsimOEligraquosungrsqbfrasltprimeatildephiiocylthreeDotDotsstarffrac12ulcropgjcyBarwedboxURboxhUAtildeegsthetasymAacgrgEtgrtshcyKHgrsbsolMujukcyboxHdmnpluspercntuumlyucytargetETHrhovlambdathgrMcyboxdrsup2boxDlmarkerrangbreveecircdArrrceilblk14sqsupaeligxgryencueprrsquoUumlAgryacuteucircrtrieegravecopycuwedthetavLambdaohgrepsiviecyfrac18ldquorphonelsaquoLJcydtrifsqsubeKHcysubEboxULquotphmmatuhblkugrsectvellipboxuRperiodlaquoplancksamalgsmidupsilonbrvbarsqsupesparHARDcyeDotudigrggrgsdotOgrlcubYAcyAacutehybullurcornPHgruacutelrmlagranmgrboxVxifrac58Upsirsquoremsp14sqcapzhcylsquortimeslpargtUdigrfemaleplusdootildercubecirdiamwedgeqisinorderFcyTSHcyyumlfnoftimesbIgravelhblkulcornltrifGtldquoKJcyGcyZHcyThetascechiKappaVvdashboxvthorncireequalstscyboxHCcedilYcyTgrfrac23sqsubsup1angmsdGJcyOacgrOHacgrUacutezgrbarwedemspohacgrLtiumlcompfnphivrtrifbowtieBetaScaronordfeacutescsimvpropotimesnexistcommateumlOgravediamsbethscapfrac14IotacheckminusbAgraveerDotlapTScyvprimeSHCHcyepsislangboxvHinfinoplusngrpoundfrac78oacgrphisenspgElVdashvltriiotaEEacgriquestSuphamiltoSDeltaDgrndashsoftcymldrcopysriacgralefsymntildesdotblsimdalethveebararinghelliplEgiexclnumsposlashrealKgrweierpvrtribdquoPsiccedilkappaIEcyPhiboxHDkhgrsigmaGammathetaplusb0123456789abcdefhashtab.c: new capacity: %llu Table %p size after grow:%llu hashtab.c: Impossible - unable to rehash tablehashtab.c: capacity problem growing from: %llu hashtab.c: Warning: growing open-addressing hashtables is slow. Either allocate more storage when initializing, or use other hashtable types! hashtab.c:Growing hashtable %p, because it has exceeded maxfill, old size:%llu hashtab.c: Unable to allocate memory for thekey hashtab.c: Growing hashtable %p, because its full, old size:%llu. hashtab.c: Unable to grow hashtable /* TODO: include GPL headers */static struct cli_element %s_elements[] = { const struct cli_hashtable %s = { %s_elements, %llu, %llu, %lluhashtab: Invalid load factor: %u, using default of 80%% hashtab.c: Unable to allocate memory for hs->keys hashtab.c: Unable to allocate memory for hs->bitmap hashtab.c: Unable to allocate memory pool for hs->keys hashtab.c: Unable to allocate/initialize memory for hs->keys hashtab: Freeing hashset, elements: %u, capacity: %u hashtab: Growing hashset, used: %u, capacity: %u hashtab.c: Unable to allocate memory for array hashtab.c: Unable to allocate memory for v->value %ld %s #include }; {NULL,0,0}, {DELETED_KEY,0,0}, {"%s", %ld, %llu}, %d %1023sARCHIVEDOCUMENTPHISHINGBYTECODESTATSPCREOnOff** Off **Module PE: %s * Submodule %10s: %s Module ELF: %s Module MACHO: %s Module ARCHIVE: %s Module DOCUMENT: %s Module MAIL: %s Module OTHER: %s Module PHISHING %s Module BYTECODE %s Module STATS %s Module PCRE %s PE:ELF:MACHO:ARCHIVE:DOCUMENT:MAIL:OTHER:PHISHING:BYTECODE:STATS:PCRE:PARITEKRIZMAGISTRPOLIPOSMD5SECTSWIZZORPETITEPESPINYCWWPACKNSPACKUPACKASPACKCATALOGCERTSMATCHICONIMPTBLGZIPBZIPCPIOISHIELD7zipPASSWDHTMLSKIPRAWJSNORMOOXMLMSPMLMBOXJPEGDLPMYDOOMLOGPREFILTERINGPDFNAMEOBJPRTNINTXNENGINEENTCONVINTERPRETERJIT X86JIT PPCJIT ARMPESECTION DISABLEDSUPPORTOPTIONSGLOBALDynamic engine configuration settings: Problem parsing configuration file at line %u cli_LzmaInit: ignoring late size override cli_7unz: Encrypted header found in archive. cli_7unz: Encrypted files found in archive. cli_unz: extraction failed with %d cli_7unz: completed successfully Heuristics.Encrypted.7Zip7unzcli_7unz: extracting %s cli_7unz: Saving to %s cli_7unz: unsupported cli_7unz: oom cli_7unz: crc mismatch cli_7unz: encrypted cli_7unz: error %d 0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-wb+SzReadSubStreamsInfo: more streams exist than specified, ignoring. SzReadSubStreamsInfo: more streams exist than specified, ignoring(2). mLX>>>>>=<<=|=~%=||--!=!==++^=&&БЎВ M6664 D6 666666666666666666666666666666666666666l6666666666666666-S7x|+jϓ;FF\Aggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggg 2#gg7#g(-7-2ggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzz2zzz(zzzzzzzzzzzzzzz-z #zzzzzzzzzzzzzzzzzzzzzzzzzzzzzzfiltering: unknown wildcard character: %d Don't know how to create filter for: %s filter rejecting %s due to very bad score: %ld Subpattern too short: %s +ؼ2fmap_unneed: inconsistent map state fmap_unneed: unneed on a unlocked page fmap_readpage: lock count exceeded fmap_readpage: fstat failed: %s fmap_readpage: file changed as we read it fmap_readpage: pread error: %s fmap_readpage: pread fail: asked for %lu bytes @ offset %lu, got %lu funmap: unable to unmap memory segment at address: %p with length: %zu fmap_unneed: attempted void unneed fmap: attempted mapping with unaligned offset fmap_dump_to_file: dumping fmap not backed by file... fmap_dump_to_file: failed to generate temporary file. fmap_dump_to_file: write failed to %s! fmap_dump_to_file: lseek failed fmap_aging: kernel hates you fmap: attempted oof unneed fmap: attempted void mapping fmap: attempted oof mapping fmap: map allocation failed fmap: fstat failed bytecode: function type not accepted for constant: %u End of line encountered while reading number bytecode: type kind mismatch: %u != %u bytecode: type numElements mismatch: %u != %u bytecode: contained type mismatch: %u != %u cli_bytecode: call to lseek() has failed interpreter: Unable to allocate memory for global map: %zu interpreter: Unable to allocate memory for globalBytes: %u interpreter: unsupported elsize: %u interpreter: Unable to allocate memory for map: %zu bytecode: global out of range: %u > %u, for instruction %u in function %u bytecode: operand out of range: %u > %u, for instruction %u in function %u bytecode: called function out of range: %u > %u bytecode: call operands don't match function prototype Out of memory when allocating operand sizes bytecode: gep1 of alloca is not allowed bytecode: typeid out of range %u >= %u bytecode: invalid type for gep (%u) bytecode: invalid gep type, must be pointer: %u bytecode: invalid gep type, must be pointer to nonint: %u bytecode: gep offset out of range: %d >= %d Bytecode: unhandled opcode: %d unhandled type kind %d, cannot parsebytecode: already turned off, can't turn it on again! bytecode: in test mode but JIT/bytecode is about to be disabled: %d bytecode: in JIT mode but JIT is about to be disabled: %d Basic block ID out of range: %u Out of memory allocating %u types Invalid basic block header: %c Newline encountered while reading number Operand index exceeds bounds: %u >= %u! Out of memory allocating operands Called function out of range: %u >= %u Called undeclared API function: %u Opcode %u with too many operands: %u? Invalid instructions or operands More instructions than declared in total: %u > %u! Missing basicblock terminator, got: %c invalid number of dbg nodes, expected: %u, got: %u Unable to allocate memory for dbg nodes: %u Trailing garbage in basicblock: %d extra bytes Out of memory allocating cli_bytecode_context_reset bytecode: function ID doesn't exist: %u bytecode: error allocating memory for parameters bytecode: error allocating memory for opsizes bytecode: param index out of bounds: %u bytecode: parameter type mismatch Pointer parameters are not implemented yet! cli_sigperf_print: statistics requested but no bytecodes were loaded! Unable to load bytecode (null file) Unable to load bytecode (empty file) Missing file magic in bytecodeSkipping bytecode with (format) functionality level: %u (current %u) Data start marker missing: %c Line ended while reading data Cannot allocate memory for data bytecode: string missing \0 terminator: %s Skipping bytecode with (engine) functionality level %u-%u (current %u) Invalid bytecode header at %u Magic numbers don't match: %lx%lx, %u Out of memory allocating %u functions Out of memory allocating line of length %u Invalid function types header: %c Type start id mismatch: %u != %u Function with no return type? %u Out of memory allocating containedType bytecode: Invalid api header: %c bytecode using API %u, but highest API known to libclamav is %u, skipping bytecode: attempting to describe more APIs than max: %u > %u Out of memory allocating apis bitset Out of memory allocating apity2ty bytecode: API id %u out of range, max %u bytecode: API %u name mismatch: %s expected %s bytecode: API %u prototype doesn't match bytecode: Parsed %u APIcalls, maxapi %u bytecode: Invalid globals header: %c bytecode using global %u, but highest global known to libclamav is %u, skipping bytecode: OOM allocating memory for %u globals bytecode: OOM allocating memory for %u global types bytecode: constant has too many subcomponents, expected %u bytecode: constant has too few subcomponents: %u < %u Trailing garbage in globals: %d extra bytes Unable to parse number of elements bytecode: Parsed %u nodes total Found more functions than declared: %u >= %u Invalid function arguments header: %c Invalid function locals header: %c Invalid number of arguments/locals Out of memory allocating function arguments Invalid function body header: %c Out of memory allocating instructions Out of memory allocating basic blocks Parsed different number of instructions than declared: %u != %u Parsed %u BBs, %u instructions sigperf_events_init: events table full. Increase MAX_BC cli_event_define error for time event id %d sigperf_events_init(): adding sig ids starting %u for %s sigperf_events_init: cli_event_define() error for time event id %d sigperf_events_init: cli_event_define() error for matches event id %d Loaded less functions than declared: %u vs. %u Unable to parse number of MD nodes Unable to parse (format) functionality level in bytecode header bytecode has to be prepared either for interpreter or JIT! bytecode triggered but running bytecodes is disabled Bytecode %u: executing in interpreter mode Bytecode %u: executing in JIT mode bytecode %d encountered %u JIT and %u interpreter errors bytecode %d execution different with JIT and interpreter, see --debug for details bytecode %d encountered %u JIT and %u interpreter warnings Failed to allocate memory for globals Failed to allocate memory for globaltypes Failed to allocate memory for func Failed to allocate memory for types Failed to allocate memory for BB Failed to allocate memory for insts Failed to allocate memory for constants Failed to allocate memory for instructions Failed to prepare selfcheck bytecode Failed to allocate bytecode context bytecode self test failed: %s Bytecode: failed to run selfcheck in %s mode: %s No bytecodes loaded, not running builtin test Bytecode: disabled on X86 via DCONF Bytecode: disabled on PPC via DCONF Bytecode: disabled on ARM via DCONF Bytecode: JIT not supported on this architecture, falling back Bytecode: failed to allocate bytecode context Out of memory allocating bytecode ClamBCafhhbfkjmld|afefdfggifnf```aa```|biacflfafmfbfcfmb`cnbacacmbachcccmbgfbfcc`ccchcbfdf``bgcaap`clamcoincidencejb:4096 Teddaaahdabahdacahdadahdaeahdafahdagahebfgebidebegebdgebgdebkdebcgebbgebageb`gebofebnfebmfebedeblfebkfebjfebadcbgab`bb`bb`bb`bb`bb`bb`bbifbifbifbifbifbifbifahahahahahahahahahebneebifaaaaaaaab`baabb`bb`baacb`bbadb`baacb`bboeb`baacb`bb`bb`baadb`bbadb`bb`baadb`bbadbadb`bdbadahdbkaahdbbcahdbibahdb`eahdbddahdbodahdbdaahdaiahdakahdamahdahahdbncahdbnbah Ebjdaibcdbbf|bcaefnfgfifnfefoedfcfofnfffoelfeffgeflf``bbdbbf|bkaefnfgfifnfefoeffegnfcfdgifofnfaflfifdgigoelfeffgeflf``agbcf|baadfefbfeggfoe`gbgifnfdgoeegifnfdg``bcabcf|afdgefcgdgbc``afbdf|b`adfefbfeggfoe`gbgifnfdgoecgdgbg``bhdbef|b`agfefdgoeefnffgifbgofnfmfefnfdg``aabff|afdgefcgdgac``bidbgf|bdadfifcgafbflfefoebfigdgefcfofdfefoeifff``bjdbgf|aodfifcgafbflfefoejfifdgoeifff`` G`b`c`@`b`aAa`bfgBifBkeBccBdcBmeBhcBfcB`bBdfBefBdgBefBcfBdgBefBdfBlbB`bBjdBidBdeB`bBnfBefBefBdfBcgB`bB`gBefBnfBdgBifBegBmfB`bBofBbgB`bBbfBefBdgBdgBefBbg@`bidBifBccBhcBfc@`bidBifBdcBhcBfc@`begBcdB`eBeeB`bBdfBofBefBcgBnfBgbBdgB`bBcgBegB`gB`gBofBbgBdgB`bBcdBmdBodBfeBlbB`bBggBofBegBlfBdfB`bBnfBefBefBdfB`bB`cBnbBicBgcB`bBhbBldBldBfeBmdB`bBbcBnbBhcBibB`bBdgBofB`bBggBofBbgBkfBab@`bidBifBecBhcBfc@`bdgB`gBefBnfBdgBifBegBmf@`bidBifBfcBhcBfc@`bgdBkfBfc@`bidBkfBfcBmbBbc@`bidBkfBfcBmbBcc@`bkdBafBdgBhfBlfBofBnf@`bcgBafBdgBhfBlfBofBnfBmbBdgBbfBifBbgBdf@`bbgBggBifBnfBcfBhfBifB`gBmbBcfBfc@`bagBggBifBnfBcfBhfBifB`gBbc@`bgdBcfBcc@`b`gBbeBgeBheB`bBmfBafB`gB`gBifBnfBgfB`bBdfBefBnfBifBefBdfBnb@`bofBneBceBedBldBifBnfBegBhgB`bBifBcgB`bB`gBbgBefBfgBefBnfBdgBifBnfBgfB`bBgbBefBhgBefBcfBmfBefBmfBgbB`bBafBcfBcfBefBcgBcgBnbAjBbeBegBnfB`bB`bBgbBcgBefBdgBcgBefBbfBofBofBlfB`bBmbB`eB`bBcfBlfBafBmfBdfBoeBegBcgBefBoeBjfBifBdgB`bBofBnfBgbBnb@`bnfBneB`eBafBheB`bBifBcgB`bB`gBbgBefBfgBefBnfBdgBifBnfBgfB`bBgbBmfB`gBbgBofBdgBefBcfBdgBgbB`bBafBcfBcfBefBcgBcgBnbAjBbeBegBnfB`bBgbB`gBafBhgBcfBdgBlfB`bBmbBcfBmfB`bBlcBefBhgBefBcfBegBdgBafBbfBlfBefBncBgb@`bmfBneBbeBgeBheB`bBmfBafB`gB`gBifBnfBgfB`bBdfBefBnfBifBefBdfB`bBffBofBbgB`bBegBnfBkfBnfBofBggBnfB`bBbgBefBafBcgBofBnfBnbB`eBlfBefBafBcgBefB`bBbgBefB`gBofBbgBdgB`bBdgBofB`bBhfBdgBdgB`gBjcBobBobBbfBegBgfBcgBnbBcfBlfBafBmfBafBfgBnbBnfBefBdgAj@`bed@`blfBcgBdgBafBbgBdgBegB`gBjcB`bBbfBigBdgBefBcfBofBdfBefB`bBefBhgBefBcfBegBdgBifBofBnfB`bBifBnfB`bBafBegBdgBofB`bBmfBofBdfBef@`bkfBcgBdgBafBbgBdgBegB`gBjcB`bBbfBigBdgBefBcfBofBdfBefB`bBefBhgBefBcfBegBdgBifBofBnfB`bBggBifBdgBhfB`bBifBnfBdgBefBbgB`gBbgBefBdgBefBbgB`bBofBnfBlfBig@`bjfBcgBdgBafBbgBdgBegB`gBjcB`bBbfBigBdgBefBcfBofBdfBefB`bBdfBifBcgBafBbfBlfBefBdf@`bad@Ab`bad@Ac`bad@Ad`bad@Ae`bad@Af`bad@Ag`bad@Ah`bad@Ai`bad@Aj`bad@Ak`bad@Al`bad@Am`bad@An`bad@Ao`bad@B`a`bad@Baa`bad@Bba`bad@Bca`bad@Bda`bad@Bea`bad@Bfa`bad@Bga`bad@Bha` A`b`bLblib`bab`b`b`b`bneab`b`bad`ah`aa`bad`ah`aa`b`f`bad`b`b`aa`b`b`aa`b`b`b`b`b`b`aa`b`b`aa`b`b`aa`b`b`aa`b`b`aa`b`b`aa`b`b`aa`b`b`aa`b`b`aa`b`b`aa`b`b`aa`b`b`aa`b`b`b`b`bad`ah`b`b`b`b`aa`b`b`bad`ah`aa`ah`b`b`b`b`aa`b`b`b`b`aa`b`b`b`b`bad`ah`aa`bad`ah`aa`b`b`aa`b`b`b`b`aa`aa`aa`aa`aa`b`b`b`b`b`b`ah`aa`bcd`b`b`aa`bcd`b`b`bcd`b`b`aa`b`b`aa`b`b`b`b`aa`bad`ah`b`b`aa`b`b`aa`bad`ah`b`b`b`b`bad`ah`b`b`b`b`bad`ah`b`b`b`b`b`b`b`b`b`b`b`b`b`b`b`b`b`b`b`b`bad`ah`b`b`b`b`bcd`b`b`b`b`b`b`bad`ah`b`b`b`b`bcd`b`b`b`b`bcd`b`b`aa`b`b`bcd`b`b`aa`b`b`bcd`b`b`aa`b`b`b`b`aa`b`b`b`b`aa`b`b`b`b`Fbbnbec Bb`badabbbhdacClnadbadaedbboeacBdadahafgbaeaaageaahaf@aTaaagblaaa BbadahdbboeacB`adahaigbahaaajeaahaiAaaTaaajabbaa Bb`fakdbboeacAidbadaldbb`fak@db`bamkbalBja`Aedaaaneab`bam@db`b`bbAadabTaaanadac Bb`baokbalBka`Aedaab`aeab`bao@db`bab`ab`ab`b`bbababTbaad Bb`bbaabbabbaab`bbbaabcbjdBia`@dbaab`bbcaab`bbdaabdaiab`bbcaBicdTaabdaaebaa Bb`bbeakbalBma`Aedaabfaeab`bbea@db`b`bbAadaaTaabfab`aaf Bb`bbgakbalBna`Ahdaabhaeab`bbga@db`b`bbAadaaTaabhab`aag Bb`bbiakbalBoa`Aedaabjaeab`bbia@db`b`bbAadaaTaabjab`aah Bb`bbkakbalB`b`Acdaablaeab`bbka@db`b`bbAadaaTaablab`aai Bb`bbmakbalBab`Aedaabnaeab`bbma@db`b`bbAadaaTaabnab`aaj Bb`bboakbalBbb`Aedaab`beab`bboa@db`b`bbAadaaTaab`bb`aak Bb`bbabkbalBcb`Agdaabbbeab`bbab@db`b`bbAadaaTaabbbb`aal Bb`bbcbkbalBdb`Amdaabdbeab`bbcb@db`b`bbAadaaTaabdbb`aam Bb`bbebkbalBeb`Akdaabfbeab`bbeb@db`b`bbAadaaTaabfbb`aan Bb`bbgbkbalBfb`Aidaabhbeab`bbgb@db`b`bbAadaaTaabhbb`aao Bb`bbibkbalBgb`Acdaabjbeab`bbib@db`baa`abjbb`b`bbaaaaTbab`a Bb`bbkbbbaabkbb`bblbabcbjdBla`@dbkbTbabaa BbadbmbdbboeacBeadahbnbgbbmbb`bbob`abnbb`bb`ck`bobAadaabaceab`bb`c@dTaabacbbabha Bb`bbbcabcbjdBhb`@dAadbadbccdbboeacBaadahbdcgbbccaabeceaahbdcAjaTaabecbcabla Bahbfcgbbmbb`bbgc`abfcb`bbhck`bgcAbdaabiceab`bbhc@dTaabicbeabda Bb`bbjcabcbjdBib`@dAadTbabla Bb`bbkck`bgcAhdaablceab`bbkc@dTaablcbgabfa Bb`bbmcabcbjdBjb`@dAadTbabla Bb`bbncabcbjdBkb`@dAadTbabla BbadbocdbboeacBaadahb`dgbbocaabadeaahb`dAjaTaabadbjabia BbadbbddbboeacBbadahbcdgbbbdaabddeaahbcdAfaTaabddbjabla Bb`bbedk`bobB`adaabfdeab`bbed@dTaabfdblabka Bb`bbgdabcbjdBjb`@dAadTbabla Bb`bbhdabcbidBlb`@d@daabidnab`bbhdAadTaabidb`bbma Baabjdnab`bbhdAbdTaabjdboabna Baabkdeab`bbhdAbdTaabkdbcbbdb Baabldeab`bbhdAadTaabldbbbbdb Baabmdeab`bbhd@dTaabmdbabbdb Bb`bbndabbafBmb`@dTbabdb Bb`bbodabbafBnb`@dTbabdb Bb`bb`eabbafBob`@dTbabdb Bahbaegbaeaabbeeaahbae@aTaabbebfbbeb BbcdbcedbboeacAddb`bbdegbbceaabeeeab`bbde@db`b`bbEamjnmd`Taabeebdcbfb BbcdbfedbboeacAfdb`bbgegbbfebcdbhedbboeacAedb`bbiegbbheaabjeiab`bbgebieb`b`bbEbmjnmd`Taabjebdcbgb Bb`bbkeab`bbdaableeab`bbiebkeb`b`bbEcmjnmd`Taablebhbbdc Bb`bbmegbbfeb`bbneab`bcdaaboeeab`bbmebneb`b`bbEdmjnmd`Taaboebibbdc Bbadb`fdbboeacAndahbafgbb`fb`bbbf`abafaabcflbb`bbdf`abcfaabefeab`bbbfbdfb`b`bbEemjnmd`Taabefbjbbdc BbadbffdbboeacBaadahbgfgbbffb`bbhf`abgfb`bbifh`bhfBhadbadbjfdbboeacB`adahbkfgbbjfb`bblf`abkfb`bbmfh`blfBdadbadbnfdbboeacBcadahbofgbbnfb`bb`g`abofb`bbagh`b`gB`adb`bbbggbbheb`bbcgh`bbgAhdb`bbdggbbfeb`bbegl`bmfbifb`bbfgl`begbcgb`bbggl`bfgbdgb`bbhgl`bggbagb`bbigh`bbfBladbadbjgdbboeacAodahbkggbbjgb`bblg`abkgb`bbmgh`blgBhadbcdbngdbboeacAddb`bboggbbngb`bb`hl`bogbigb`bbahl`b`hbmgbadbbhdbboeacBeadahbchgbbbhb`bbdh`abchb`bbehh`bdhBhadbcdbfhdbboeacAcdb`bbghgbbfhb`bbhhl`behbghbcdbihdbboeac@db`bbjhgbbihaabkheab`bbhgbjhTaabkhblbbkb Bb`bblhabaagbhgTcab`bEfmjnmd BbcdbmhdbboeacAadb`bbnhgbbmhaaboheab`bbahbnhTaabohbnbbmb Bb`bb`iabaagbahTcab`bEgmjnmd BbcdbaidbboeacAbdb`bbbigbbaiaabcieab`bbhhbbiTaabcib`cbob Bb`bbdiabaagbhhTcab`bEhmjnmd Bb`bbeiabbaaHonnkm``odHm``oonnkdaabfieab`bbeiHhgfedcbadTaabfibbcbac Bb`bbgiabaagbeiTcab`bEimjnmd Bb`bbhiababcaDm``odaabiieab`bbhiDo``mdb`b`bbHnejkjgjmd`Taabiibdcbcc Bb`bbjiabaagbhiTcab`bF`amjnmd Bb`bbkibb`bkiTcab`bbkiE Failed to load builtin %s bytecode Failed to prepare %s %s bytecode for interpreter Bytecode: BC_STARTUP failed to run, disabling ALL bytecodes! Please report to https://bugzilla.clamav.net Bytecode: disable status is %d Bytecode: selftest failed with code %08x. Please report to https://bugzilla.clamav.net Bytecode: %u bytecode prepared with JIT Bytecode: JIT required, but not all bytecodes could be prepared with JIT Bytecode: Test mode, but not all bytecodes could be prepared with JIT Bytecode: needs interpreter, but interpreter is disabled Bytecode: ALL bytecodes disabled Bytecode: %d failed to prepare for interpreter mode Bytecode: %u bytecode prepared with JIT, %u prepared with interpreter, %u total Failed to prepare %s %s bytecode for interpreter: %s Failed to execute %s %s bytecode: %s Bytecode initialized in %s mode Bytecode executing hook id %u (%u hooks) Bytecode: executing bytecode %u (lsig matched) Bytecode %u failed to run: %s Bytecode runhook found virus: %s Bytecode set BREAK flag in hook! Bytecode %u unpacked file saved in %s ***** Scanning unpacked file ****** Scanning unpacked file by bytecode %u found a virus Bytecode: executed %u bytecodes for this hook Bytecode: no logical signature matched, no bytecode executed hook lsig id %d matched (bc %d) Running bytecode for logical signature match Bytecode %u returned code: %u Bytecode format functionality level: %u Bytecode metadata: compiler version: %s generic, not loadable by clamscan/clamd bytecode functionality level: %u - %u bytecode logical signature: %s files matching logical signaturePE files matching logical signature (unpacked)PE files matching logical signaturePRECLASS files matching logical signature number of functions: %u number of types: %u number of global constants: %u found %d extra types of %d total, starting at tid %d TID KIND INTERNAL------------------------------------------------------------------------bytecode diagnostic: funcid [%u] outside bytecode numfuncs [%u] found %d values with %d arguments and %d locals found a total of %d constants found a total of %u total values opcode %u[%u] of type %u is not implemented yet!apicall FID %d not yet implemented! %d = %s[%d] (p.%d, %d, %d, %d, %d)%d = %s[%d] (p.%d, %d, p.%d, %d)type %u apicalls not yet implemented! FUNCTION ID: F.%d -> NUMINSTS %d BB IDX OPCODE [ID /IID/MOD] INST|||||||||||||ZZZ||||||||||||LL| |̢ĤĤĤĤ|||̢8(qLƽƽƽƽƽƽƽƽƽƽLL**[1DD|&GlDlD4D4DC b ^]]\\\\tat\t\]]l]L]4aa```_aaT\4\T\4\T\4\|_\_<_^l^L^,^____`l`L`,``\\ ],]TaaabbybTbbaaamabﾭޭޭޭﾭޭﾭInvalid number type: %c Invalid number part: %c type %d size is 0 alloc i%dinvalid type func ( { %d x Bytecode: mode changed to %d Invalid type id: %llu Error parsing type Found too many basic blocks Invalid opcode: %u unknown inst type: %d Invalid type or operand "noname"No event triggered for %s #runsBytecode name%-*s %*s %*s %*s %*s usecs avgusecs total#matches%-*s %*lu %*lu %*lu %*.2f untrustedLoading %s bytecode ClamBCInvalid data part: %c%c Expected : but found: %c Invalid number: %s Error parsing type %u Invalid type kind: %u Error at bytecode line %u Invalid local types Invalid instructions count Invalid basic block count Parsed %d functions No memory for events table Error reading type kind bytecode: JIT disabled bytecode self test running bytecode self test succeeded JITbuiltinloadedBytecode: mode is %d BC_STARTUPBytecode: %s running (%s) interpreterBytecode %u returned %u Bytecode %u unpacked file ftruncate failed on %d Bytecode found virus: %s BC.Heuristics(null bytecode) compiled on: (%d) %s compiled by: %s target exclude: %d bytecode type: run on startup (unique)logical onlyPE unpacker hookall PE hookpreclass hookUnknown (type %u) virusname prefix: %s virusnames: %u bytecode triggered on: N/A (loaded in clambc only)all PE files! (unpacked)PDF filesall PE files!all PRECLASS files!N/A (unknown type) number of debug nodes: %u bytecode APIs used: %3d: %-20sfound a total of %zu globals GID ID VALUEVID ID VALUE%3u [%3u]: unknownargumentCID ID VALUE%3u [%3u]: %lu(0x%lx) %-20s[%-3d/%3d/%3d]%-35s%d = %d + %d%d = %d - %d%d = %d * %d%d = %d / %d%d = %d %% %d%d = %d << %d%d = %d >> %d%d = %d & %d%d = %d | %d%d = %d ^ %d%d = %d trunc %lx%d = %d sext %lx%d = %d zext %lxbr %d ? bb.%d : bb.%djmp bb.%dret %dret void%d = (%d == %d)%d = (%d != %d)%d = (%d > %d)%d = (%d >= %d)%d = (%d <= %d)%d = (%d < %d)%d = %d ? %d : %d)%d = call F.%d (%d, %d = %s[%d] (p.%d, %d)p.%d = %s[%d] (%d)%d = %s[%d] ()p.%d = %s[%d] (%d, %d)%d = %s[%d] (%d, %d, %d)%d = %s[%d] (p.%d, %d, %d)cp %d -> %d%d = gep1 p.%d + (%d * %d)%d = gepz p.%d + (%d)illegal opcode, impossiblestore %d -> p.%dload %d <- p.%d%d = memset (p.%d, %d, %d)%d = memcpy (p.%d, p.%d, %d)%d = memmove (p.%d, p.%d, %d)%d = memcmp (p.%d, p.%d, %d)%d = isbigendian()ABORT!!%d = bswap16 %d%d = bswap32 %d%d = bswap64 %d%d = ptrdiff32 p.%d p.%d%d = ptrtoint64 p.%dINVALID!!%3d %3d OP_BC_NULLOP_BC_ADDOP_BC_SUBOP_BC_MULOP_BC_UDIVOP_BC_SDIVOP_BC_UREMOP_BC_SREMOP_BC_SHLOP_BC_LSHROP_BC_ASHROP_BC_ANDOP_BC_OROP_BC_XOROP_BC_TRUNCOP_BC_SEXTOP_BC_ZEXTOP_BC_BRANCHOP_BC_JMPOP_BC_RETOP_BC_RET_VOIDOP_BC_ICMP_EQOP_BC_ICMP_NEOP_BC_ICMP_UGTOP_BC_ICMP_UGEOP_BC_ICMP_ULTOP_BC_ICMP_ULEOP_BC_ICMP_SGTOP_BC_ICMP_SGEOP_BC_ICMP_SLEOP_BC_ICMP_SLTOP_BC_SELECTOP_BC_CALL_DIRECTOP_BC_CALL_APIOP_BC_COPYOP_BC_GEP1OP_BC_GEPZOP_BC_GEPNOP_BC_STOREOP_BC_LOADOP_BC_MEMSETOP_BC_MEMCPYOP_BC_MEMMOVEOP_BC_MEMCMPOP_BC_ISBIGENDIANOP_BC_ABORTOP_BC_BSWAP16OP_BC_BSWAP32OP_BC_BSWAP64OP_BC_PTRDIFF32OP_BC_PTRTOINT64OP_BC_INVALIDDFunctionTypeDPointerTypeDStructTypeDPackedStructTypeDArrayTypereturnvaluebcapi_writeread offsetread datadebug messagedebug intmemmem 1memmem 2extracted filesread errorsdisasm failsbytecode executebytecode: registered ctx variable at %p (+%u) id %u Bytecode run timed out in interpreter after %u opcodes bytecode attempted to execute udiv#0 bytecode attempted to execute sdiv#0 bytecode attempted to execute urem#0 bytecode attempted to execute shl greater than bitwidth bytecode attempted to execute lshr greater than bitwidth bytecode attempted to execute ashr greater than bitwidth cli_stack_free: wrong free order: %p, expected %p cli_stack_free: last_size is corrupt! bytecode: type %u apicalls not yet implemented! cli_stack_alloc: Attempt to allocate more than STACK_CHUNKSIZE bytes: %u! cli_stack_alloc: Unable to allocate memory for stack-chunk: bytes: %zu! bytecode: stack depth exceeded bytecode warning: found GEP with negative offset %d! bytecode warning: GEP with negative offset %d! bytecode warning: untested case for GEP1 Opcode %u of type %u is not implemented yet! interpreter bytecode run finished in %luus, after executing %u opcodes interpreter finished with error cli_stack_free: stack empty! yyhx:Jkk]Č9X͗9{zon^onm’m>ՈQww˔pv0hȐ5f@fu|pqdjhee`cslltd`M`__ba7baddmar`gccF_(_ _^caEa2c2c2c2c2cd_d_d_d_d_^]iX\ZXTpVXTpVXT}~Zp?~X~Ϗmzuuɡcۋf[lzzndfmlգ*x||ޘ{4ܟքrrGqL׉ȜbHǕxjhhhhhiiiiigX:~gȠȠȠȠȠBBBBBWWWWW`<>T>=>>>o>> %lu Bytecode must be BC_STARTUP to call disable_bytecode_if Bytecode: disabling completely because %s Bytecode must be BC_STARTUP to call disable_jit_if Bytecode: disabling JIT because %s check_platform(0x%08x,0x%08x,0x%08x) = match cli_pdf: bytecode set_flags %08x -> %08x cli_pdf: bytecode setobjflags %08x -> %08x bytecode api[json_get_object]: invalid json objid requested bytecode api[json_get_object]: unnamed object queried bytecode api[json_get_object]: assigned %s => ID %d bytecode api[json_get_type]: invalid json objid requested bytecode api[json_get_type]: unrecognized json type %d bytecode api[json_array_get_length]: invalid json objid requested bytecode api[json_array_get_idx]: invalid json objid requested bytecode api[json_array_get_idx]: assigned array @ %d => ID %d bytecode api[json_get_string_length]: invalid json objid requested bytecode api[json_get_string]: invalid json objid requested bytecode api[json_get_boolean]: invalid json objid requested bytecode api[json_get_int]: invalid json objid requested ēD4$̓A9B.?ddtest1readseeksetvirusnamedebug_print_strdebug_print_uintdisasm_x86trace_directorytrace_scopetrace_sourcetrace_optrace_valuetrace_ptrpe_rawaddrfile_findfile_byteatmalloctest2get_pe_sectionfill_bufferextract_newread_numberhashset_newhashset_addhashset_removehashset_containshashset_donehashset_emptybuffer_pipe_newbuffer_pipe_new_fromfilebuffer_pipe_read_availbuffer_pipe_read_getbuffer_pipe_read_stoppedbuffer_pipe_write_availbuffer_pipe_write_getbuffer_pipe_write_stoppedbuffer_pipe_doneinflate_initinflate_processinflate_donebytecode_rt_errorjsnorm_initjsnorm_processjsnorm_doneilog2ipowiexpicosmemstrhex2uiatoidebug_print_str_startdebug_print_str_nonlentropy_buffermap_newmap_addkeymap_setvaluemap_removemap_findmap_getvaluesizemap_getvaluemap_donefile_find_limitengine_functionality_levelengine_dconf_levelengine_scan_optionsengine_db_optionsextract_set_containerinput_switchget_environmentdisable_bytecode_ifdisable_jit_ifversion_comparecheck_platformpdf_get_obj_numpdf_get_flagspdf_set_flagspdf_lookupobjpdf_getobjsizepdf_getobjpdf_getobjidpdf_getobjflagspdf_setobjflagspdf_get_offsetpdf_get_phasepdf_get_dumpedobjidmatchiconrunning_on_jitget_file_reliabilityjson_is_activejson_get_objectjson_get_typejson_get_array_lengthjson_get_array_idxjson_get_string_lengthjson_get_stringjson_get_booleanjson_get_int__clambc_match_offsets__clambc_kind__clambc_match_counts__clambc_filesize__clambc_pedatacli_cache_init: mpool malloc fail cli_cache_init: Caching disabled. cli_cache_init: mutex init fail cache_add: Caching disabled. Not adding sample to cache. cache_add: alert found within same topfile, skipping cache cacheset_add: cache chain in a bad state cacheset_add: end of chain reached cache_add: %02x%02x%02x%02x%02x%02x%02x%02x%02x%02x%02x%02x%02x%02x%02x%02x (level %u) cacheset_add: tree has got no end nodes cache_remove: Caching disabled. cacheset_remove: node not found in tree cache_remove: %02x%02x%02x%02x%02x%02x%02x%02x%02x%02x%02x%02x%02x%02x%02x%02x cache_check: error reading while generating hash! cache_check: Caching disabled. Returning CL_VIRUS. cache_lookup_hash: cache_lookup_hash: mutex lock fail cache_check: %02x%02x%02x%02x%02x%02x%02x%02x%02x%02x%02x%02x%02x%02x%02x%02x is %s cli_add: mutex lock fail negativepositive/proc/self/statusPaX:/proc/filesystems/selinux/enforceselinuxfs environment detected: Engine version: %s Host triple: %s Host CPU: %s OS: %s OS release: %s OS version: %s OS hardware: %s OS LLVM category: %d Has JIT compiled: %d check_platform(0x%08x, 0x%08x, 0x%08x) check_platform(0x%02x %01x %01x %02x %02x,0x%01x %01x %02x %02x %02x,0x%02x %02x %02x %02x) check_platform( OS CPU COM FL DCONF,BE PTR CXX VV.VV.VV, FLG CC VV.VV.VV) ------------------------------------------------------ events: %s event id out of rangeev_stringev_dataev_data_fastev_data_intev_time%s: ev_chain %u %s (%u): %s %d bytes %08x checksum, %u bytes (%u): 0x%llx (%u): %d.%06us diff: %s count %u vs %u diff: %s events: out of memory allocating %u bytes cli_event_define: event id out of rangecli_event_define: can only sum ev_int, ev_time, and ev_data_fastcli_event_define: ev_data_fast can only be sumedcli_event_define: only ev_data can be concatenatedcli_event_int must be called with ev_int typecli_event_time* must be called with ev_time typecli_event_string must be called with ev_string typecli_event_string must be called with ev_data typecli_event_fastdata must be called with ev_data_fastcli_event_diff: comparing incompatible eventsdiffall: incompatible event maximums %u vs %u 0 8X0((B8`Ӭwt>̰Tدadc_decompress: avail_in %llu avail_out %llu state %u adc_decompress: bad LOOKBACK offset %u adc_decompress: too large LOOKBACK offset %u adc_decompress: stream ended mid-phrase, state %u adc_decompress: invalid state %u $taadmg_stripe_zeroes: stripe %u dmg_stripe_bzipcli_scandmg: Invalid context %s/toc.xmldictblkxcli_scandmg: Matched blkx plistcli_scandmg%s/dmg%02udmg_stripe_store: stripe %u dmg_stripe_zeroes: error writing bytes to file (out of disk space?) dmg_stripe_adc: stripe %u initial len %lu expected len %lu dmg_stripe_adc: fmap need failed on stripe %u dmg_stripe_adc: adc_decompressInit failed dmg_stripe_adc: expected size exceeded! dmg_stripe_adc: failed write to output file dmg_stripe_adc: after writing %lu bytes, got error %d decompressing stripe %u dmg_stripe_adc: stripe %u actual len %lu expected len %lu dmg_stripe_inflate: stripe %u dmg_stripe_inflate: fmap need failed on stripe %u dmg_stripe_inflate: inflateInit failed dmg_stripe_inflate: expected size exceeded! dmg_stripe_inflate: failed write to output file dmg_stripe_inflate: after writing %lu bytes, got error "%s" inflating stripe %u dmg_stripe_inflate: after writing %lu bytes, got error %d inflating stripe %u dmg_stripe_bzip: stripe %u initial len %lu expected len %lu dmg_stripe_bzip: bzDecompressInit failed dmg_stripe_bzip: expected size exceeded! dmg_stripe_bzip: expected more stream dmg_stripe_bzip: decompress error: %d dmg_stripe_bzip: error writing to tmpfile dmg_stripe_bzip: output does not match expected size! cli_scandmg: Sizing problem for DMG archive. cli_scandmg: Invalid DMG trailer block cli_scandmg: Found koly block @ %ld cli_scandmg: No koly magic, %8x cli_scandmg: data offset %lu len %d cli_scandmg: The embedded XML is way larger than necessary, and probably corrupt or tampered with. cli_scandmg: XML out of range for this file cli_scandmg: XML offset %lu len %d cli_scandmg: Embedded XML length is zero. cli_scandmg: Cannot create temporary directory %s cli_scandmg: Extracting into %s cli_scandmg: Extracting XML as %s cli_scandmg: Can't create temporary file %s: %s cli_scandmg: Not all bytes written! cli_scandmg: retcode from scanning TOC xml: %s cli_scandmg: Failed parsing XML! cli_scandmg: Excessive nesting in DMG TOC. cli_scandmg: Not blkx data element cli_scandmg: blkx data element is empty cli_scandmg: Next node not text dmg_decode_mish: failed base64 decoding on mish block %u dmg_decode_mish: block %u too short for valid mish block dmg_decode_mish: block %u does not have mish magic dmg_decode_mish: startSector = %lu sectorCount = %lu dataOffset = %lu stripeCount = %u dmg_decode_mish: mish block %u too small dmg_decode_mish: mish block %u bigger than needed, continuing cli_scandmg: Key node no text cli_scandmg: no value from xmlTextReaderValue cli_scandmg: Bad blkx, not container cli_scandmg: wanted blkx, text value is %s mish %u stripe %u type %x start %lu count %lu source %lu length %lu dmg_handle_mish: invalid stripe offset and/or length dmg_handle_mish: stripes not in order, will have to sort dmg_track_sectors: unknown type on stripe %u, will skip dmg_track_sectors: unknown type on empty stripe %u dmg_track_sectors: *total would wrap uint64, suspicious dmg_track_sectors: unexpected zero sectorCount on stripe %u dmg_handle_mish: stripes in order! dmg_handle_mish: no data to output dmg_handle_mish: mish block %u too big to handle (for now)dmg_handle_mish: skipping block %u, limits exceeded dmg_handle_mish: extracting block %u to %s dmg_stripe_store: fmap need failed on stripe %u dmg_stripe_store: error writing bytes to file (out of disk space?) dmg_handle_mish: stripe %u, skipped cli_scandmg: Failed getting XML from map, len %lu cli_scandmg: Failed getting XML from map, len %d cli_scanxar: XML element value %zd cli_scanxar: No text for XML element cli_scaxar: xmlTextReaderGetAttribute no style attribute for checksum element cli_scanxar: checksum algorithm is %s. cli_scanxar: checksum algorithm %s is unsupported. cli_scanxar: checksum value is %s. cli_scanxar: checksum type is unknown or length is invalid. cli_scanxar: xmlTextReaderConstValue() returns NULL for checksum value. cli_scanxar: No text for XML checksum element. cli_scanxar: error unlinking tmpfile %s cli_scanxar: Invalid header, too short. cli_scanxar: fmap_need_off_once fails on TOC. cli_scanxar: cli_malloc fails on TOC decompress buffer. cli_scanxar:inflateInit error %i cli_scanxar:inflate error %i cli_scanxar:inflateEnd error %i TOC decompress length %lu does not match amount decompressed %lu cli_scanxar: scanning xar TOC xml in memory. cli_scanxar: Can't create temporary file for TOC. cli_scanxar: cli_writen error writing TOC. cli_scanxar: xmlReaderForMemory error for TOC cli_scanxar: xmlTextReaderConstLocalName() no name. cli_scanxar: no content in subdoc element. cli_scanxar: in-memory scan of xml subdocument, len %i. cli_scanxar: Can't create temporary file for subdocument. cli_scanxar: Writing subdoc to temp file %s. cli_scanxar: cli_writen error writing subdoc temporary file. xar_scan_subdocuments returns %i. cli_scanxar: Can't generate temporary file. cli_scanxar: decompress into temp file: %s, size %zu, from xar heap offset %zu length %zu cli_scanxar: InflateInit failed: %d cli_scanxar: Can't read %u bytes @ %lu. cli_scanxar: inflate error %i %s. cli_scanxar: cli_writen error file %s. cli_scanxar: memory request for lzma decompression buffer fails. cli_scanxar: Can't read %i bytes @ %zu, errno:%s. cli_scanxar: cli_LzmaInit() fails: %i. cli_scanxar: Can't read %zu bytes @ %zu, errno: %s. cli_scanxar: cli_LzmaDecode() fails: %i. cli_scanxar: cli_LzmaDecode() produces no output for avail_in %llu, avail_out %llu. cli_scanxar: cli_writen error writing lzma temp file for %llu bytes. cli_scanxar: Can't read %zu bytes @ %zu, errno:%s. cli_scanxar: cli_writen error %zu bytes @ %zu. cli_scanxar: archived-checksum missing. cli_scanxar: archived-checksum mismatch. cli_scanxar: archived-checksum matched. cli_scanxar: extracted-checksum(unarchived-checksum) missing. cli_scanxar: extracted-checksum mismatch. cli_scanxar: extracted-checksum matched. cli_scanxar: Infected with %s cli_scanxar: cli_magic_scandesc error %i cli_scanxar: : cli_scanxar: : cli_scaxar: xmlTextReaderGetAttribute no style attribute for encoding element cli_scanxar: encoding = application/x-gzip. cli_scanxar: encoding = application/octet-stream. cli_scanxar: encoding = application/x-bzip2. cli_scanxar: encoding = application/x-lzma. cli_scanxar: encoding = application/x-xz. cli_scaxar: unknown style value=%s for encoding element cli_scanxar: xmlTextReaderRead read cli_scanxar: xmlTextReaderRead read cli_scanxar: finished parsing xar TOC. cli_scanxar: %u checksum errors and %u extraction errors. stylecli_scanxar: Matched magic cli_scanxar: Invalid magic noname.xmltocsubdoccli_scanxarextracted-checksumunarchived-checksumencodingapplication/x-gzipapplication/octet-streamapplication/x-bzip2application/x-lzmaapplication/x-xzdump_xdp: Dumped payload to %s chunkcli_scanmbr: Invalid boot record status cli_scanmbr: Invalid partition entry cli_scanmbr: Invalid boot record signature cli_scanmbr: bootstrap code or file is too small to hold disk image cli_scanmbr: File sized %lu is not a multiple of sector size %lu cli_scanmbr: Invalid master boot record cli_scanmbr: detected intersection with partitions [%u, %u] heuristic.partitionintersectioncli_scanebr: Invalid extended boot record cli_scanebr: detected intersection with partitions [%u, %u] cli_scanebr: second entry for EBR is not an extended partition Blocks: [%u, +%u), ([%lu, +%lu)) cli_scanmbr: detected a master boot record with multiple extended partitions cli_scanebr: detected a logical boot record without a partition record cli_scanebr: detected a logical boot record with multiple extended partition records cli_scanebr: detected a logical boot record with multiple partition records cli_scanebr: detected a logical boot record with extended partition record first cli_scanebr: detected a logical boot record with empty partition record first cli_scanebr: Invalid extended partition entry cli_scanebr: detected a non-empty partition entry at index %u cli_scanmbr: examined %u logical partitions cli_scanmbr: maximum partitions reached cli_scanmbr: Invalid context MBR Signature: %x MBR Partition Entry %u: Status: %u Type: %x EBR Partition Entry %u: EBR Signature: %x Logical Partition Entry %u: cli_scangpt: Invalid GPT partition entry cli_scangpt: detected intersection with partitions [%u, %u] %s: %02x%02x%02x%02x-%02x%02x-%02x%02x-%02x%02x-%02x%02x%02x%02x%02x%02x cli_scangpt: GPT header checksum mismatch cli_scangpt: Invalid GPT header signature %llx cli_scangpt: GPT header size does not match stated size cli_scangpt: GPT header reserved is not expected value cli_scangpt: GPT secondary header is not last LBA cli_scangpt: GPT first usable sectors is after last usable sector cli_scangpt: GPT usable sectors intersects header sector cli_scangpt: GPT usable sectors intersects partition table cli_scangpt: GPT partition table intersects header sector cli_scangpt: cannot parse gpt with partition entry sized %u cli_scangpt: GPT partition table extends over fmap limit cli_scangpt: GPT partition table checksum mismatch cli_scangpt: GPT partition exists outside specified bounds Blocks: [%llu(%llu) -> %llu(%llu)] cli_scangpt: max partitions reached cli_scangpt: detected %lu sector size cli_scangpt: could not determine sector size cli_scangpt: File sized %lu is not a multiple of sector size %lu cli_scangpt: Invalid primary MBR header cli_scangpt: protective MBR first LBA is incorrect %u cli_scangpt: protective MBR has non-empty partition cli_scangpt: detected a hybrid MBR cli_scangpt: detected a non-protective MBR cli_scangpt: Using primary GPT header cli_scangpt: Invalid primary GPT header cli_scangpt: Primary GPT header is invalid cli_scangpt: Using secondary GPT header cli_scangpt: Invalid secondary GPT header cli_scangpt: Secondary GPT header is invalid cli_scangpt: Disk is unusable cli_scangpt: Checking secondary GPT header cli_scangpt: Primary and secondary GPT header table CRC32 differ cli_scangpt: Set to scan primary and secondary partition tables cli_scangpt: Secondary GPT header check OK cli_scangpt: Scanning primary GPT partitions only cli_scangpt: Scanning secondary GPT partitions only cli_scangpt: Scanning primary GPT partitions cli_scangpt: Scanning secondary GPT partitions GPT Header: Signature: 0x%llx Revision: %x DISK GUIDPartition Entry Count: %u Partition Entry Size: %u GPT Partition Entry %u: Type GUIDUnique GUIDAttributes: %llx EFI PARTcli_scangpt: Invalid context cli_scanapm: Invalid context Apple_Partition_MapApple_partition_mapApple_patition_mapApple_DriverApple_Driver43Apple_Driver43_CDApple_Driver_ATAApple_Driver_ATAPIApple_PatchesAPM Partition Table: Partition Count: %u APM Partition Entry %u: cli_scanapm: Invalid Apple driver description map cli_scanapm: Apple driver description map signature mismatch cli_scanapm: File described %u size does not match %lu actual size cli_scanapm: Invalid Apple partition entry cli_scanapm: Invalid Apple partition table cli_scanapm: Apple partition table signature mismatch cli_scanapm: Initial Apple Partition Map partition is not detected cli_scanapm: detected intersection with partitions [%u, %u] cli_scanapm: Apple partition entry signature mismatch cli_scanapm: Out of order Apple Partition Map partition cli_scanapm: Detected invalid Apple partition entry cli_scanapm: max partitions reached PRTN_INTXN: could not allocate new node for checklist! cli_json_timeout_cycle_check: timeout! json: null 'obj' specified to cli_jsonnull json: null string specified as key to cli_jsonnull json: null 'obj' specified to cli_jsonstr json: null string specified as 'key' to cli_jsonstr json: null string specified as 's' to cli_jsonstr json: no memory for json string object json: no parent object specified to cli_jsonint json: null string specified as key to cli_jsonint json: no memory for json int object json: no parent object specified to cli_jsonint64 json: null string specified as key to cli_jsonint64 json: no memory for json array object. json: no memory for json int object. json: no parent object specified to cli_jsonbool json: null string specified as key to cli_jsonbool json: no memory for json boolean object. json: no parent object specified to cli_jsondouble json: null string specified as key to cli_jsondouble json: no memory for json double object. json: no owner object specified to cli_json_addowner json: no child object specified to cli_json_addowner json: null string specified as key to cli_addowner json: cannot delete idx %d of owner array json: no owner object cannot hold ownership json: no owner object specified to cli_json_delowner json: null string specified as key to cli_delowner json: owner array does not have content with key %s json: owner array does not have content at idx %d ParseErrors%s logicalSize %lu clumpSize %u totalBlocks %u %s extent[%d] startBlock %u blockCount %u hfsplus_readheader: %s: invalid headerType %d hfsplus_header: %s: headerNode is out-of-range %s Desc: fLink %u bLink %u kind %d height %u numRecords %u hfsplus_header: %s: headerNode not header kind hfsplus_header: %s: Invalid headerNode %s Header: depth %hu root %u leafRecords %u firstLeaf %u lastLeaf %u nodeSize %hu %s Header: maxKeyLength %hu totalNodes %u freeNodes %u btreeType %hhu attributes %x hfsplus_header: %s: Invalid nodesize hfsplus_header: %s: Invalid cat maxKeyLength hfsplus_header: %s: Invalid cat maxKeyLength based on nodeSize hfsplus_header: %s: Invalid ext maxKeyLength hfsplus_dumpfile: Empty file. hfsplus_dumpfile: Cannot generate temporary file. hfsplus_dumpfile: Extracting to %s hfsplus_dumpfile: output complete hfsplus_dumpfile: output all blocks, remaining size %lu hfsplus_dumpfile: need next extent from ExtentOverflow hfsplus_dumpfile: next extent empty, done hfsplus_dumpfile: next extent illegal! hfsplus_dumpfile: bad extent! hfsplus_dumpfile: write error hfsplus_dumpfile: all data written cli_scanhfsplus: Invalid context cli_scanhfsplus: scanning partition content cli_scanhfsplus: too short for HFS+ cli_scanhfsplus: cannot read header from map cli_scanhfsplus: header malloc failed cli_scanhfsplus: HFS+ signature matched cli_scanhfsplus: HFSX v5 signature matched cli_scanhfsplus: no matching signature cli_scanhfsplus: Invalid blocksize cli_scandmg: cli_gentemp failed hfsplus_getnodelimit: catFork totalBlocks too large! hfsplus_getnodelimit: catFork logicalSize too large! hfsplus_getnodelimit: too many nodes for catFile cli_scandmg: validation successful cli_scandmg: validation returned %d : %s hfsplus_walk_catalog: failed to acquire node buffer, size %u hfsplus_walk_catalog: reached end of leaf nodes. hfsplus_walk_catalog: node scan limit reached. hfsplus_fetch_node: invalid node number %u hfsplus_fetch_node: need catalog block %u hfsplus_fetch_node: block number invalid! hfsplus_fetch_node: extent %u empty! hfsplus_fetch_node: extent %u illegal! hfsplus_fetch_node: found block in extent %u hfsplus_fetch_node: not in extent %u hfsplus_fetch_node: not in first 8 extents hfsplus_fetch_node: finding this node requires extent overflow support hfsplus_fetch_node: block past end of volume hfsplus_fetch_node: nodesize bigger than blocksize, is this allowed? hfsplus_fetch_node: not all bytes read hfsplus_walk_catalog: node fetch failed. hfsplus_walk_catalog: invalid leaf node! hfsplus_walk_catalog: too many leaf records for one node! hfsplus_walk_catalog: bad record location %x for %u! hfsplus_walk_catalog: key too long for location %x for %u! hfsplus_walk_catalog: record %u nextStart %x keylen %u type %d hfsplus_walk_catalog: not enough bytes for file record! hfsplus_walk_catalog: data fork alert, continuinghfsplus_walk_catalog: data fork retcode %d hfsplus_walk_catalog: resource fork alert, continuinghfsplus_walk_catalog: resource fork retcode %dhfsplus_walk_catalog: record mode %o is not File hfsplus_walk_catalog: simple cycle detected! cli_scandmg: walk catalog finished ,Llhfsplus_scanfilehfsplus_dumpfile: extent %u hfsplus_dumpfile: map error HFS+ Header: Attributes: %x File Count: %u Folder Count: %u Block Size: %u Total Blocks: %u allocationFileextentsFilecatalogFileattributesFilestartupFileleaf nodedata fork:resource fork:extentFilescancws: Can't generate temporary file scancws: Can't write to file %s scancws: inflateInit() failed scancws: Error decompressing SWF file. No data decompressed. scancws: Error decompressing SWF file. Scanning what was decompressed. SWF: Decompressed[zlib] to %s, size %d SWF: declared output length != inflated stream size, %u != %llu SWF: declared output length == inflated stream size, %u == %llu scancws: Error reading SWF file scanzws: Can't generate temporary file scanzws: Can't write to file %s SWF: declared input length != compressed stream size, %u != %llu SWF: declared input length == compressed stream size, %u == %llu scanzws: possibly truncated file scanzws: Error decompressing SWF file. No data decompressed. scanzws: Error decompressing SWF file. Scanning what was decompressed. SWF: Decompressed[LZMA] to %s, size %llu scanzws: Error reading SWF file SWF: FrameSize RECT size bits: %u SWF: FrameSize xMin %u xMax %u yMin %u yMax %u cli_scanswf: GETWORD: Can't read file or file truncated SWF: scriptLimits recursion %u timeout %u * Suppress cross domain cache * Use hardware acceleration cli_scanswf: INITBITS: Can't read file or file truncated cli_scanswf: GETBITS: Can't read file or file truncated scanzws: LzmaInit() failed UNKNOWN TAGin cli_scanswf() SWF: Can't read file header SWF: Version: %u SWF: File size: %u CWSSWF: zlib compressed file ZWSSWF: LZMA compressed file FWSSWF: Uncompressed file SWF: Not a SWF file SWF: Frames total: %d SWF: %s SWF: Tag length: %u SWF: Invalid tag length. SWF: Tag length too large. SWF: File attributes: * Use network * Relative URLs * ActionScript 3.0 * Has metadata * Use GPU TAG_ENDTAG_SHOWFRAMETAG_DEFINESHAPETAG_FREECHARACTERTAG_PLACEOBJECTTAG_REMOVEOBJECTTAG_DEFINEBITSTAG_DEFINEBUTTONTAG_JPEGTABLESTAG_SETBACKGROUNDCOLORTAG_DEFINEFONTTAG_DEFINETEXTTAG_DOACTIONTAG_DEFINEFONTINFOTAG_DEFINESOUNDTAG_STARTSOUNDTAG_STOPSOUNDTAG_DEFINEBUTTONSOUNDTAG_SOUNDSTREAMHEADTAG_SOUNDSTREAMBLOCKTAG_DEFINEBITSLOSSLESSTAG_DEFINEBITSJPEG2TAG_DEFINESHAPE2TAG_DEFINEBUTTONCXFORMTAG_PROTECTTAG_PATHSAREPOSTSCRIPTTAG_PLACEOBJECT2TAG_REMOVEOBJECT2TAG_SYNCFRAMETAG_FREEALLTAG_DEFINESHAPE3TAG_DEFINETEXT2TAG_DEFINEBUTTON2TAG_DEFINEBITSJPEG3TAG_DEFINEBITSLOSSLESS2TAG_DEFINEEDITTEXTTAG_DEFINEVIDEOTAG_DEFINEMOVIECLIPTAG_NAMECHARACTERTAG_SERIALNUMBERTAG_DEFINETEXTFORMATTAG_FRAMELABELTAG_SOUNDSTREAMHEAD2TAG_DEFINEMORPHSHAPETAG_GENFRAMETAG_DEFINEFONT2TAG_GENCOMMANDTAG_DEFINECOMMANDOBJTAG_CHARACTERSETTAG_FONTREFTAG_EXPORTASSETSTAG_IMPORTASSETSTAG_ENABLEDEBUGGERTAG_INITMOVIECLIPTAG_DEFINEVIDEOSTREAMTAG_VIDEOFRAMETAG_DEFINEFONTINFO2TAG_DEBUGIDTAG_ENABLEDEBUGGER2TAG_SCRIPTLIMITSTAG_SETTABINDEXTAG_DEFINESHAPE4TAG_FILEATTRIBUTESTAG_PLACEOBJECT3TAG_IMPORTASSETS2TAG_DEFINEFONTINFO3TAG_DEFINETEXTINFOTAG_DEFINEFONT3TAG_AVM2DECLTAG_METADATATAG_SLICE9TAG_AVM2ACTIONTAG_DEFINESHAPE5TAG_DEFINEMORPHSHAPE2TAG_DEFINESFLABELDATATAG_DEFINEBINARYDATATAG_DEFINEFONTNAMETAG_STARTSOUND2TAG_DEFINEBITSJPEG4TAG_DEFINEFONT4TAG_ENABLETELEMETRYTAG_DEFINEBITSPTRin cli_parsejpeg() JPEG: Marker %02x, length %u http://JPEG: XMP data in segment %u in cli_parsegif() GIF89aGIF87acli_parsejpeg: Spurious bytes before segment %u cli_parsejpeg: Error looking for marker cli_parsejpeg: Invalid segment size cli_parsejpeg: Segment data out of file cli_parsejpeg: Duplicate Application Marker cli_parsejpeg: JFIF marker at wrong position cli_parsejpeg: JFIF header too short cli_parsejpeg: Exif marker at wrong position cli_parsejpeg: Invalid Exif header cli_parsejpeg: Exif header too short cli_parsejpeg: SPIFF marker at wrong position cli_parsejpeg: SPIFF header too short cli_parsejpeg: Application Marker before JPG7 cli_parsejpeg: Invalid file structure cli_parsejpeg: No image in jpeg cli_parsejpeg: No DTI segment before DTT cli_parse(jpeg|gif): Can't read file (corrupted?) cli_parsejpeg: No JFIF marker cli_parsejpeg: Can't read Exif header cli_parsejpeg: No SPIFF marker GIF: Screen size %ux%u, gctsize: %u cli_parsegif: Multiple Graphic Control Extension blocks not allowed cli_parsegif: Invalid Graphic Control Extension block GIF: Image size %ux%u, left pos: %u, top pos: %u cli_parsegif: Can't read Logical Screen Descriptor block cli_parsegif: Can't read Graphic Control Extension block cli_parsegif: Can't read Image Descriptor block JFIFExifSPIFF6gCPNG: invalid sign character PNG: invalid decimal point PNG: invalid character PNG: invalid digits PNG: missing mantissa PNG: invalid zero value(s) PNG: zero length keyword PNG: EOF(?) while reading %s in cli_parsepng() chunk lengthPNG: invalid chunk name IHDRPNG: EOF while reading data PNG: invalid IHDR length PNG: invalid image type (%d) PLTEPNG: PLTE must precede IDAT PNG: PLTE must precede bKGD IDATpalettePNG: zlib: inflate error IENDPNG: invalid IEND length PNG: no IDAT chunks PNG: not enough IDAT data bKGDPNG: bKGD must precede IDAT PNG: invalid bKGD length cHRMPNG: cHRM must precede PLTE PNG: cHRM must precede IDAT PNG: invalid cHRM length PNG: invalid cHRM red point PNG: invalid cHRM blue point fRAcgAMAPNG: gAMA must precede IDAT PNG: gAMA must precede PLTE PNG: invalid gAMA length gIFgPNG: invalid gIFg length gIFtPNG: invalid gIFt length gIFxPNG: invalid gIFx length hISTPNG: hIST must follow PLTE PNG: hIST must precede IDAT iCCPPNG: iCCP must precede PLTE PNG: iCCP must precede IDAT PNG: invalid iCCP length iTXtoFFsPNG: oFFs must precede IDAT PNG: invalid oFFs length pCALPNG: pCAL must precede IDAT pHYsPNG: pHYS must precede DAT PNG: invalid pHYS length sBITPNG: sBIT must precede PLTE PNG: sBIT must precede IDAT PNG: invalid sBIT length PNG: invalid length sCALPNG: sCAL must precede IDAT PNG: invalid sCAL length sPLTPNG: sPLT must precede IDAT PNG: invalid sPLT length sRGBPNG: sRGB must precede PLTE PNG: sRGB must precede IDAT PNG: invalid sRGB length sTERPNG: sTER must precede IDAT PNG: invalid sTER length tEXtzTXttIMEPNG: invalid tIME length PNG: invalid year PNG: invalid month PNG: invalid day PNG: invalid hour PNG: invalid minute PNG: invalid second tRNSPNG: tRNS must follow PLTE PNG: tRNS must precede IDAT grayscaleCRC valuePNG  JanFebMarAprMayJunJulAugSepOctNovgrayscale+alphaRGB+alphaPNG: invalid exponent before mantissa PNG: keyword is longer than 79 characters PNG: keyword has leading space(s) PNG: keyword has trailing space(s) PNG: keyword has consecutive spaces PNG: keyword has control character(s) PNG: additional data after END chunk PNG: invalid chunk length (too large) PNG: EOF while reading chunk type PNG: first chunk must be IHDR PNG: multiple IHDR not allowed PNG: invalid image dimensions PNG: invalid sample depth (%d) PNG: private (invalid?) compression method (%d) PNG: invalid compression method (%d) PNG: private (invalid?) filter method (%d) PNG: invalid filter method (%d) PNG: private (invalid?) interlace method (%d) PNG: invalid interlace method (%d) PNG: multiple PLTE not allowed PNG: PLTE not allowed in %s image PNG: invalid number of PLTE entries (%g) PNG: invalid number of PLTE entries (%d) for %d-bit image PNG: IDAT chunks must be consecutive PNG: IDAT must follow PLTE in %s image PNG: compression header fails checksum PNG: non-deflate compression method (%d) PNG: zlib: can't initialize (error = %d) PNG: private (invalid?) row-filter type (%d) PNG: invalid row-filter type (%d) PNG: %u bytes remaining in buffer before inflateEnd()PNG: EOF while reading %s data PNG: multiple bKGD not allowed PNG: bKGD index falls outside PLTE PNG: multiple cHRM not allowed PNG: invalid cHRM white point PNG: invalid cHRM green point PNG: multiple gAMA not allowed PNG: invalid gAMA value (0.0000) PNG: multiple hIST not allowed PNG: invalid number of hIST entries (%g) PNG: multiple iCCP not allowed PNG: iCCP not allowed with sRGB PNG: missing NULL after iCCP profile name PNG: invalid iCCP compression method (%d) PNG: invalid iTXt compression flag (%d) PNG: private (invalid?) iTXt compression method (%d) PNG: invalid iTXt compression method (%d) PNG: multiple oFFs not allowed PNG: invalid oFFs unit specifier (%u) PNG: multiple pCAL not allowed PNG: multiple pHYs not allowed PNG: invalid pHYs unit specifier (%u) PNG: multiple sBIT not allowed PNG: sBIT grey bits invalid for sample image PNG: sBIT red bits invalid for sample image PNG: sBIT green bits invalid for sample image PNG: sBIT blue bits invalid for sample image PNG: grey bits invalid for sample image PNG: alpha bits invalid for sample image PNG: red bits invalid for sample image PNG: green bits invalid for sample image PNG: blue bits invalid for sample image PNG: multiple sCAL not allowed PNG: invalid sCAL unit specifier (%d) PNG: missing sCAL null separator PNG: missing sCAL pixel height PNG: extra sCAL null separator PNG: invalid negative sCAL value(s) PNG: missing NULL after sPLT palette name PNG: invalid sPLT sample depth PNG: invalid number of sPLT entries PNG: multiple sRGB not allowed PNG: sRGB not allowed with iCCP PNG: sRGB invalid rendering intent PNG: multiple sTER not allowed PNG: invalid sTER layout mode PNG: private (possibly invalid) compression method PNG: invalid compression method PNG: text contains NULL character(s) PNG: text has control character(s) PNG: multiple tIME not allowed PNG: Time: %2d %s %4d %02d:%02d:%02d UTC PNG: multiple tRNS not allowed PNG: invalid tRNS length for %s image PNG: tRNS not allowed in %s image PNG: illegal critical, safe-to-copy chunk PNG: illegal reserved-bit-set chunk PNG: illegal (unless recently approved) unknown, public PNG: private, critical chunk (warning) PNG: EOF while reading final data PNG: CRC error in chunk %s (computed %08lx, expected %08lx) PNG: file doesn't end with a IEND chunk . . .  p "h+)++0))(@j@?Directoryiso_scan_file: dumping to %s CD001in cli_scaniso cli_scaniso: Block size: %u cli_scaniso: System: %s cli_scaniso: Volume: %s cli_scaniso: Volume %u of %u cli_scaniso: Volume Set: %s cli_scaniso: Publisher: %s cli_scaniso: Application: %s cli_scaniso: Joliet level %u iso_parse_dir: Directory too small, skipping iso_parse_dir: Breaking out due to too many dir records iso_parse_dir: Directory entry overflow, breaking out %u %u iso_parse_dir: Too short directory entry, attempting to skip iso_parse_dir: Directory entry name overflow, clamping iso_parse_dir: %s '%s': off %x - size %x - flags %x - unit size %x - gap size %x - volume %u iso_parse_dir: Skipping interleaved file iso_parse_dir: Skipping overlimit file iso_scan_file: cannot dump block outside file, ISO may be truncated iso_scan_file: Can't write to file %s cli_scaniso: Raw sector size: %u cli_scaniso: Volume descriptor version: %u cli_scaniso: Volume space size: 0x%x blocks cli_scaniso: Data Preparer: %s cli_scaniso: Volume creation time: %c%c%c%c-%c%c-%c%c %c%c:%c%c:%c%c cli_scaniso: Volume modification time: %c%c%c%c-%c%c-%c%c %c%c:%c%c:%c%c cli_scaniso: Volume expiration time: %c%c%c%c-%c%c-%c%c %c%c:%c%c:%c%c cli_scaniso: Volume effective time: %c%c%c%c-%c%c-%c%c %c%c:%c%c:%c%c cli_scaniso: Path table size: 0x%x cli_scaniso: LSB Path Table: 0x%x cli_scaniso: Opt LSB Path Table: 0x%x cli_scaniso: MSB Path Table: 0x%x cli_scaniso: Opt MSB Path Table: 0x%x cli_scaniso: File Structure Version: %u cli_scaniso: Interleaved root directory is not supported  @6RRRR jjjj000066668888@@@@||||9999////4444CCCCDDDDTTTT{{{{2222####====LLLL BBBBNNNN....ffff(((($$$$vvvv[[[[IIIImmmm%%%%rrrrddddhhhh\\\\]]]]eeeellllppppHHHHPPPP^^^^FFFFWWWW XXXXEEEE,,,,????kkkk::::AAAAOOOOggggsssstttt""""55557777uuuunnnnGGGGqqqq))))oooobbbbVVVV>>>>KKKKyyyy xxxxZZZZ33331111YYYY''''____````QQQQJJJJ ----zzzz;;;;MMMM****<<<<SSSSaaaa++++~~~~wwww&&&&iiiiccccUUUU!!!! }}}}QP~SeAä:^';kEXK U0mvv%LO*&D5bIZ%gE]u/LFk_zmYR-X!tI)iDujxyk>X'qOf }:cJ1`3QbESwdk+pXhHElR{#srKWf*U(/µ{ӥ70(#j\+yNieվb4Ċ4S.U2u 9@`^qQn>!=ݮ>MFTq]o`P$֗C@gwB8[yG ||B 2H+plNrZV8=ծ6'9- dh!\T[$:.6 g WҖOa ZiKw *h8,4$_@r %(I<A 9q޳ ؜dV{ap2Ht\lBWQPA~Seä':^;kEXK0 Uvm̈v%LO*5&DbIZ%gE]/uLFk_mzRY-tX!I)iɎDujxyXk>'qᾶO f}:cJ1Q`3SbEdwk+HpXhEޔl{Rs#KrWUf*(/ņ{7ӥ(0#j\ϊ+yiNeվ4bĊ.4SU2u 9`@q^nQ!>ݖ=>ݮMFTq]oP`$֗@Cgw谽B8[y|G B| +2HpZlNrV8=-6'9 d\h![T6$:. gWҖOa wZiK *"$8,4_@r %<(I A9q ޳؜Vd{a2plHt\BWQPeA~S^':k;EXK0 Umvv̈L%O*D5&bZI%gE]u/LFk_zmYR-!tXiI)ɎDujyx>Xkq'Oᾶ f:}Jc13Q`SbEwdk+hHpXElޔ{Rs#KrWUf*(µ/{ņ7ӥ(0#j\ϊ+yiNeb4ĊS.4U2u 9`@q^nQ!>ݖ=>ݮMFT]qoP`$֗C@gwB谽[8y |GB| +2HprZlN8Vծ=9-6' d\h!T[.6$:g WO aKwZi *"4$8,@_r% I<( A9q ؜Vd{a2p\lHtWBPQSeA~ä^':k;EXKU0 mvv̈%LO*D5&bIZg%E]u/LFk_zmYR-!tX)iIDɎjuxyk>Xq'Of :}Jc1`3QESbwdk+XhHpElޔ{R#sKrW*Uf(µ/{ņ7(0#j\+ϊyiNeվb4S.4U2u9 `@q^Qn!>=ݖ>FMT]qoP`$C@wgB8[yG |B| H+2pNrZlV8ծ='9-6d !\hT[:.6$g WҖO aiKwZ *C"< Nj-ȩWLuݙ`&r\;fD4~[v)C#hc1cB@" Ƅ}$J=2m)K/0R wl+pH"dGČ?,}V3"NI8ʌ6 Ԙρ(z&?:, xP_jbF~Tؐ^9.Â]|i-o%;}nc{; x&YnOen~ϼ!ٛ6oJ |)11#?*0f57NtʂАا3JAP/MvMCTMўjL,QeF^]5st.A ZgRے3VGmaךz 7Y<'5ah,4$8_@r %I<(A q9޳ Vda{p2t\lHBWcccc||||wwww{{{{kkkkoooo0000gggg++++vvvv}}}}YYYYGGGGrrrr&&&&6666????4444qqqq1111####''''uuuu ,,,,nnnnZZZZRRRR;;;;))))////SSSS [[[[jjjj9999JJJJLLLLXXXXCCCCMMMM3333EEEEPPPP<<<<QQQQ@@@@8888!!!! ____DDDD~~~~====dddd]]]]ssss````OOOO""""****FFFF^^^^ 2222:::: IIII$$$$\\\\bbbbyyyy7777mmmmNNNNllllVVVVeeeezzzzxxxx%%%%....ttttKKKKpppp>>>>ffffHHHHaaaa5555WWWWiiiiUUUU(((( BBBBhhhhAAAA----TTTTƥcc||ww{{ ֽkkޱooT`P00ΩggV}++bM櫫vvE@}}YYGG A쭭g_E꯯#Srr[u·=Lj&&lZ66~A??Oh\44Q4qqsbS11*? RFe##^0(7 / $6=&Ni''Ͳuu Xt,,4.6-ܲnnZZ[RRvM;;a}γR{))>^q//SSh,@` yȱ[[ԾjjFgپrK99JJLLXXJk*O媪CCMMfU33EEPPxD<<%K㨨QQ]@@?!pH88c߼wuBc!! 0mL &5/__5DD.9WU~~zG==Ȭdd]]2+ss``OODf""T~**; FF)kӸ(<y^^ v;dV22tN:: II Hl$$\\]nCשּׁĦbb917yy2CnY77ڷmmdNNI੩شllVV%ʯeezzG鮮oպxxJo%%\r..8$WsǴQ#|tt>!KKaܽ pp|B>>qĵ̪ffHH£aaj_55WWiйX:''8+"3һiip3-<" IUUPx((zY  eڿ1BBиhhAA)Zw--{˰TTmֻ,:cƥc||ww{{ kֽkoޱoőT0`P0gΩg+V}+׵bMvvʏEɉ@}}YYGG AԳg_E#Srr[u·=&Lj&6lZ6?~A?̃O4h\4Q4qqثs1bS1*? ǕR#Fe#Ý^0(7 / $6=&'Ni'Ͳuu  ,Xt,4.6-nܲnZZ[RR;vM;ַa}γ)R{)>/^q/SSѹh, @` yȱ[[jԾjˍFgپ9rK9JJLLXXυJлk*OCCMM3fU3EEPP!KKaܽ pp>|B>qĵf̪fHHa£a5j_5WWiйX:''8+"3iһi٩p3-<" ·IUU(Px(ߥzY  eڿ1BBhиhAA)-Zw-{˰TTmֻ,:ccƥ||ww{{ kkֽooޱőT00`PggΩ++V}׵bMvvʏEɉ@}}YYGG AԳg_E#Srr[u=&&Lj66lZ??~ÃO44h\Q4qqثs11bS*? ǕR##FeÝ^0(7 / $6=&''Niuu ,,Xt4.6-nnܲZZ[RR;;vMַa}))R{>//^qSSѹh, @`y[[jjԾˍFg99rKJJLLXXυJлk*OCCMM33fUEEPP<!KKa pp>>|Bqff̪HHaa£55j_WWiX:''8+"3iiһ٩p3-<" ·IUU((PxߥzY e1BBhhиAA)--Zw{TTm,:cc||ww{{ kkooTőP00`gg}++Vb׵櫫MvvEʏ@ɉ}}YYGG 쭭AgԳ_꯯E#Srr[·u=j&&LZ66lA??~Õ\44hQ4qqsثS11b?* RǕe##F^Ý(07 / 6$=&i''NͲuu t,,X.4-6nnZZ[RRM;;vaַγ}{))R>q//^SShѹ,` @ȱy[[jjFˍپgK99rJJLLXXJυkл*媪OCCMMU33fEEPPD<KKܽa ppB>>|ĵqffHHaa_55jWWйiX':'8+3"iip٩3-"< I·UUx((PzߥY  ڿe1BBhhAA)w--Z˰{TTֻm:,crtmgr_rsa_verify: verification failed: mp_exptmod failed with %d crtmgr_rsa_verify: FIXME ACAB - CRYPTO MISSING? crtmgr_verify_pkcs7: unsupported sig len: %u +*H asn1_get_obj: insufficient data length asn1_get_obj: obj out of file asn1_get_obj: unsupported indefinite length object asn1_get_obj: len octets overflow (or just too many) asn1_get_obj: content overflow asn1_getnum: expecting digits, found '%c%c' asn1_get_time: expected UTCTime or GeneralizedTime, got %02x asn1_get_time: failed to read content asn1_get_time: invalid month %u asn1_get_time: invalid day %u asn1_get_time: invalid hour %u asn1_get_time: invalid minute %u asn1_get_time: invalid second %u asn1_get_time: expected UTC time 'Z', got '%c' asn1_expect_objtype: expected type %02x, got %02x asn1_expect_obj: expected size %u, got %u asn1_expect_obj: failed to read content asn1_expect_obj: content mismatch asn1_expect_rsa: expecting OID with size 5 or 9, got %02x with size %u asn1_expect_rsa: failed to read OID asn1_expect_rsa: MD2 with RSA (not yet supported) asn1_expect_rsa: SHA256 with RSA (not yet supported) asn1_expect_rsa: SHA512 with RSA (not yet supported) asn1_expect_rsa: OID mismatch (size %u) asn1_expect_rsa: extra data found in SEQUENCE asn1_expect_algo: extra data found in SEQUENCE map_raw: failed to read map data map_sha1: failed to read hash data map_md5: failed to read hash data asn1_parse_mscat: failed to read pkcs#7 entry asn1_parse_mscat: found extra data in pkcs#7 asn1_parse_mscat: found extra data in signedData asn1_parse_mscat: only one digestAlgorithmIdentifier is allowed asn1_parse_mscat: found extra data in contentInfo asn1_parse_mscat: found extra data in content asn1_get_x509: found unexpected extra data in version asn1_get_x509: found unexpected extra data in validity asn1_get_rsa_pubkey: found unexpected extra data in subjectPublicKeyInfo asn1_get_rsa_pubkey: cannot read public key content asn1_get_rsa_pubkey: unexpected byte frags in public key asn1_get_rsa_pubkey: found unexpected extra data in public key content asn1_get_rsa_pubkey: modulus has got an unsupported length (%u) asn1_get_rsa_pubkey: cannot read n asn1_get_rsa_pubkey: found unexpected extra data after exp asn1_get_rsa_pubkey: exponent has got an unsupported length (%u) asn1_get_rsa_pubkey: cannot read e asn1_get_x509: found type %02x in extensions, expecting a1, a2 or a3 asn1_get_x509: found unexpected extra data in extensions asn1_get_x509: found boolean with wrong length asn1_get_x509: bad extension value type %u asn1_get_x509: extra data in extension asn1_get_x509: extra data in ExtKeyUsage asn1_get_x509: wrong bool size in basic constraint %u asn1_get_x509: certificate already exists asn1_get_x509: found conflicting rsa hash types asn1_get_x509: signature too long asn1_get_x509: cannot read signature asn1_get_x509: found unexpected extra data in signature asn1_parse_mscat: %u new certificates collected ==============RAW============== asn1_parse_mscat: Authenticode certificate %s is revoked. Flagging sample as virus. asn1_parse_mscat: %u certificates did not verify asn1_parse_mscat: unexpected type %02x for signerInfos asn1_parse_mscat: unexpected extra data after signerInfos asn1_parse_mscat: only one signerInfo shall be present asn1_parse_mscat: extra data inside issuerAndSerialNumber asn1_parse_mscat: authenticatedAttributes size is too small asn1_parse_mscat: failed to read authenticated attribute asn1_parse_mscat: extra data in authenticated attributes asn1_parse_mscat: contentType or messageDigest appear twice asn1_parse_mscat: messageDigest attribute has got the wrong size (%u) asn1_parse_mscat: extra data in authenticated attribute asn1_parse_mscat: contentType or messageDigest are missing asn1_parse_mscat: encryptedDigest too long asn1_parse_mscat: messageDigest mismatch asn1_parse_mscat: failed to read authenticatedAttributes asn1_parse_mscat: failed to read encryptedDigest asn1_parse_mscat: pkcs7 signature verification failed asn1_parse_mscat: countersignature is missing asn1_parse_mscat: extra data inside signerInfo asn1_parse_mscat: extra data inside unauthenticatedAttributes asn1_parse_mscat: extra data inside counterSignature asn1_parse_mscat: extra data inside countersignature issuer asn1_parse_mscat: wrong digestAlgorithm size asn1_parse_mscat: failed to read digestAlgorithm OID asn1_parse_mscat: unknown digest oid in countersignature asn1_parse_mscat: extra data in countersignature oid asn1_parse_mscat: countersignature authenticatedAttributes are too small asn1_parse_mscat: duplicate field in countersignature asn1_parse_mscat: extra data in countersignature value asn1_parse_mscat: extra data in countersignature content-type asn1_parse_mscat: countersignature hash mismatch asn1_parse_mscat: extra data in countersignature message-digest asn1_parse_mscat: extra data in countersignature signing-time asn1_parse_mscat: countersignature timestamp outside cert validity asn1_parse_mscat: some important attributes are missing in countersignature asn1_parse_mscat: wrong digestEncryptionAlgorithm size in countersignature asn1_parse_mscat: cannot read digestEncryptionAlgorithm in countersignature asn1_parse_mscat: digestEncryptionAlgorithm in countersignature is not sha1 asn1_parse_mscat: extra data in digestEncryptionAlgorithm in countersignature asn1_parse_mscat: countersignature encryptedDigest too long asn1_parse_mscat: extra data inside countersignature asn1_parse_mscat: failed to read countersignature encryptedDigest asn1_parse_mscat: pkcs7 countersignature verification failed asn1_parse_mscat: catalog successfully parsed asn1_parse_mscat: failed to parse catalog asn1_load_mscat: found extra data in szOID_CATALOG_LIST content asn1_load_mscat: found extra data in tag asn1_load_mscat: cannot read SPC_INDIRECT_DATA asn1_load_mscat: found extra data in tag value asn1_load_mscat: found extra data in SPC_INDIRECT_DATA_OBJID tag asn1_load_mscat: bad hash type size asn1_load_mscat: cannot read hash type asn1_load_mscat: unexpected hash type asn1_load_mscat: found extra data after hash asn1_load_mscat: found extra data in hash asn1_load_mscat: bad hash size %u asn1_load_mscat: cannot read hash asn1_load_mscat: got hash %s (%s) asn1_load_mscat: failed to add hash in asn1_check_mscat (offset: %llu) asn1_check_mscat: extra data in content asn1_check_mscat: file with valid authenticode signature, whitelisted +*H *H *H *H  *H  cert time code (no name)in asn1_parse_mscat *H ++7 asn1_get_x509: bad validity *H Uasn1_get_x509: bad KeyUsage U%++U%02x%ccert: subject: %s serial: %s pubkey: %s i: %s %lu->%lu %s%s%s raw_subject: %s raw_serial: %s raw_issuer: %s *H  *H  *H  *H *H  *H +7+7 +7 +7+7elleemmeemmeellefpu: Floating point little endian detected. fpu: Floating point big endian detected. fpu: Floating point endian detection failed. Bytes: %.2x %.2x %.2x %.2x %.2x %.2x %.2x %.2x elleemmeclamav_stats_flush: locking mutex failed (err: %d): %s clamav_stats_flush: unlocking mutex failed (err: %d): %s clamav_stats_submit: locking mutex failed (err: %d): %s clamav_stats_submit: unlocking mutex failed (err: %d): %s clamav_stats_remove_sample: locking mutex failed (err: %d): %s clamav_stats_remove_sample: unlocking mutex failed (err: %d): %s clamav_stats_decrement_count: locking mutex failed (err: %d): %s clamav_stats_decrement_count: unlocking mutex failed (err: %d): %s clamav_stats_get_size: locking mutex failed (err: %d): %s clamav_stats_get_size: unlocking mutex failed (err: %d): %s clamav_stats_add_sample: locking mutex failed (err: %d): %s clamav_stats_add_sample: unlocking mutex failed (err: %d): %s stats - start /clamav/1/submit/statsPUTintel.clamav.netstats - end [unknown]%%%02xGETPOST%zu%s %s HTTP/1.1 Host: %s Connection: Close Content-Length: %s stats - Connected to %s:%s stats - Sending %s stats - received: %s STATOKstats - Data received okay Content-Type: application/x-www-form-urlencoded { "hostid": "%s", "host_info": "%s", { "hits": %s, "size": %s, "sections": [ %s{ "hash": "%s", "size": %llu } ], "virus_names": [ %s"%s" ] }%s ] } ensure_bufsize: Could not allocate more memory: %s (errno: %d) 5b585e8f-3be5-11e3-bf0b-18037319526c end tagIndicatorIndicatorItemContextsearchFileItemFileItem/Md5sumFileItem/Sha1sumFileItem/Sha256sumopenioc_parse: xmlTextReaderRead read %s%s openioc_parse: openioc_parse_indicator recursion error. openioc_parse: xmlTextReaderGetAttribute no type attribute for element openioc_parse: calloc fails for openioc_hash. openioc_parse: xmlTextReaderConstValue() returns NULL for Content md5 value. openioc_parse: No text for XML Content element. openioc_parse: XML parsing file %s openioc_parse: xmlReaderForFd error openioc_parse: xmlTextReaderRead read %s openioc_parse: mpool_malloc for virname memory failed. openioc_parse: hm_addhash_str failed with %i hash len %i for %s. openioc_parse: No hash signatures extracted from %s. openioc_parse: %i hash signature%s extracted from %s. ___________________________________________________________________________________________ole2_convert_utf: cleaning out %d bytes from incomplete utf-8 character length %d ole2_convert_utf: could not locate codepage encoding for %d ole2_convert_utf: could not initialize iconv for encoding %s: %s ole2_convert_utf: input buffer contains invalid character for its encoding ole2_convert_utf: input buffer contains incomplete multibyte character ole2_convert_utf: outbuf is too small, resizing %llu -> %llu ole2_convert_utf: buffer could not be fully translated in cli_ole2_summary_json_cleanup: %d[%x] OLE2_SUMMARY_ERROR_INVALID_ENTRYOLE2_SUMMARY_FLAG_UNKNOWN_PROPIDOLE2_SUMMARY_FLAG_UNHANDLED_PROPTYPEOLE2_CODEPAGE_ERROR_INCOMPLETEOLE2_CODEPAGE_ERROR_OUTBUFTOOSMALLole2_summary_json: invalid file descriptor ole2_summary_json: cannot stat file descriptor ole2_summary_json: failed to get fmap ole2_summary_json: streamsize: %zu ole2_summary_json: no memory for json object. ole2_summary_json: byteorder 0x%x is invalid ole2_summary_json: invalid number of property sets ole2_summary_json: byteorder 0x%x ole2_summary_json: %u property set(s) detected ole2_summary_propset_json: pssize: %u, numprops: %u ole2_summary_propset_json: processing %u of %u (%u max) properties ole2_summary_propset_json: propid: 0x%08x, propoff: %u ole2_docsum_propset_json: unrecognized propid! ole2_translate_summary_propid: unrecognized propid! ole2_process_property: invalid padding value, non-zero ole2_propset_json: current codepage is unknown, cannot parse char stream ole2_process_property: property string sized %lu truncated to size %lu ole2_process_property: failed to convert to base64 string ole2_process_property: UNIX timestamp is larger than 32-bit number ole2_process_property: unhandled property type 0x%04x for %s property OLE2_SUMMARY_ERROR_TOOSMALLOLE2_SUMMARY_ERROR_OOBOLE2_SUMMARY_ERROR_DATABUFOLE2_SUMMARY_LIMIT_PROPSOLE2_SUMMARY_FLAG_TIMEOUTOLE2_SUMMARY_FLAG_CODEPAGEOLE2_SUMMARY_FLAG_TRUNC_STROLE2_CODEPAGE_ERROR_NOTFOUNDOLE2_CODEPAGE_ERROR_UNINITEDOLE2_CODEPAGE_ERROR_INVALIDin cli_ole2_summary_json DocSummaryInfoHwp5SummaryInfoin ole2_summary_propset_json CodePagePresentationTargetBytesMMClipsScaleHeadingPairsDocPartTitlesLinksDirtyChar&WSCountSharedDocLinkBaseHyperLinksHyperLinksChangedDigitalSigDocVersionRevNumberEditTimeLastPrintedCreatedTimeModifiedTimeWordCountCharCountThumbnailAppName%s_base64HasUserDefinedPropertiesIBM037IBM437IBM500ASMO-708IBM775IBM850IBM852IBM855IBM857IBM860IBM861IBM863IBM864IBM865CP866IBM869IBM870WINDOWS-874CP875SHIFT_JISGB2312BIG5IBM1026WINDOWS-1250WINDOWS-1251WINDOWS-1252WINDOWS-1253WINDOWS-1254WINDOWS-1255WINDOWS-1256WINDOWS-1257WINDOWS-1258JOHABMACINTOSHUS-ASCIIIBM273IBM277IBM278IBM280IBM284IBM285IBM290IBM297IBM420IBM423IBM424KOI8-RIBM871IBM880IBM905EUC-JPCP1025KOI8-UISO-8859-1ISO-8859-2ISO-8859-3ISO-8859-4ISO-8859-5ISO-8859-6ISO-8859-7ISO-8859-8ISO-8859-9ISO-8859-13ISO-8859-15ISO-2022-JPISO-2022-JP-2ISO-2022-JP-3ISO-2022-KREUC-CNEUC-KRGB18030UTF-7WdFd5d$dddcc(aaa``````b`~`m`Ja9a[ab[dwbbc.cc cbbbbbbbbsbbbQbWdFd5d?cCPCRE Expression===============%-*s %*lu %*lu %*llu %*.2f (null)%s/%s/cli_pcre_perf_print: statistics requested but no PCREs were loaded! cli_pcre_build: metadata for pcre %d is missing cli_pcre_build: Skip compiling regex: %s (disabled) cli_pcre_build: disabling global option for regex /%s/ cli_pcre_build: failed to build pcre regex cli_pcre_initoff: cannot allocate memory for data->shift cli_pcre_initoff: cannot allocate memory for data->offset cli_pcre_recaloff: cannot recalculate relative offset for signature cli_pcre_scanbuf: skipping disabled regex /%s/ cli_pcre_scanbuf: skipping %s check due to uninitialized lsigid cli_pcre_scanbuf: located regex match @ %d cli_pcre_scanbuf: match found outside of maxshift @%u cli_pcre_scanbuff: Can't allocate memory for new result cli_pcre_addpatt: NULL root or NULL trigger or NULL pattern or NULL offset cli_pcre_addpatt: trigger or pattern cannot be an empty string cli_pcre_addpatt: regex subsig /%s/ is missing a valid logical trigger cli_pcre_addpatt: regex subsig %d logical trigger refers to subsequent subsig %d cli_pcre_addpatt: regex subsig %d logical trigger is self-referential cli_pcre_addpatt: regex subsig is missing lsigid data cli_pcre_addpatt: Unable to allocate memory for new pcre meta cli_pcre_addpatt: Unable to allocate memory for trigger string cli_pcre_addpatt: Unable to allocate memory for virname or NULL virname cli_pcre_addpatt: Unable to allocate memory for expression cli_pcre_addpatt: cannot calculate offset data: %s for pattern: %s cli_pcre_addpatt: unknown/extra pcre option encountered %c pcre_perf: no memory for events table pcre_perf: events table full. Increase MAX_TRACKED_PCRE pcre_perf: cli_event_define() error for time event id %d pcre_perf: cli_event_define() error for matches event id %d cli_pcre_addpatt: Unable to allocate memory for new pcre meta table cli_pcre_addoptions: unknown/extra pcre option encountered %c cli_pcre_compile: NULL pd or NULL pd->expression cli_pcre_compile: PCRE compilation failed at offset %d: %s cli_pcre_compile: Unable to allocate memory for extra data cli_pcre_match: pcre_exec: out of memory cli_pcre_match: pcre_exec: match limit exceeded cli_pcre_match: pcre_exec: recursive limit exceeded cli_pcre_match: pcre_exec: returned error %d cli_pcre_report: PCRE Execution Report: cli_pcre_report: running regex /%s/ returns %d cli_pcre_report: reported match goes outside buffer cli_pcre_report: no named substrings cli_pcre_report: named substrings cli_pcre_report: (%d) %*s: %s%s cli_pcre_report: no match found cli_pcre_report: error occurred in pcre_match: %d cli_pcre_report: PCRE Execution Report End %llu] Heuristic.TIFF.OutOfBoundsAccesscli_parsetiff: examined %u IFD(s) HWP3.x%s: Can't write to file %s %s: Error reading stream CompressBase64HWPMLFontCountsStyleCountParagraphCountInfoBlk_1Booking InformationTerminating EntryOLE2 DataPresentation InformationBackground Image DataImageSizeTable ExtensionHwp5HeaderRawVersionRawFlagsHWP5_COMPRESSEDHWP5_PASSWORDHWP5_DISTRIBUTABLEHWP5_SCRIPTHWP5_DRMHWP5_XMLTEMPLATEHWP5_HISTORYHWP5_CERT_SIGNEDHWP5_CERT_ENCRYPTEDHWP5_CERT_EXTRAHWP5_CERT_DRMHWP5_CCLbinjscriptversiondefaultjscriptviewtextdocinfoHWP5.x_5_hwpsummaryinformationHwp3HeaderHWP3_WRITEPROTECTEDHWP3_EXTERNALAPPLICATIONHWP3_PASSWORDHWP3_COMPRESSEDPrintName_base64PrintNameAnnotation_base64AnnotationHwp3SummaryInfoin cli_scanhwpml() hwpml.xmlHWPML_ERROR_XML_READER_IOhwpmldocsummarydocsettingbeginnumberBeginNumbercaretposCaretPosfacenamelistFaceNameListborderfilllistBorderFillListcharshapelistCharShapeListtabdeflistTableDefListnumberinglistNumberingListparashapelistParagraphShapeListstylelistStyleListcompatibledocumentWordCompatibilitybindatastorageBinaryDataStoragescriptcodeScriptCodeStoragescriptheaderScriptHeaderscriptsourceScriptSourceKeyword1Keyword2Etc0Etc1Etc2%s: Failed to allocate memory for temporary buffer %s: Can't generate temporary file %s: Can't initialize zlib inflation stream %s: Decompressed %llu bytes to %s %s: Error decompressing stream. No data decompressed. %s: Error decompressing stream. Scanning what was decompressed. %s: Error closing zlib inflation stream HWPML: Unrecognized encoding method HWPML: Can't stat file descriptor HWPML: Failed to get fmap for binary data HWPML: Failed to get input stream from binary data HWPML: Failed to get base64 decode binary data HWPML: Failed to create temporary file for decoded stream scanning HWPML: Decoded binary data to %s HWP3.x: Paragraph[%d, %d]: length value is too high, invalid. %u HWP3.x: Paragraph[%d, %d]: unknown CFS type 0x%x @ offset %llu HWP3.x: Paragraph parsing detected %d of %u characters HWP3.x: Paragraph[%d, %d]: number of box cells is too high, invalid. %u HWP3.x: Paragraph[%d, %d]: image size value is too high, invalid. %u HWP3.x: Invalid file descriptor argument HWP3.x: Can't stat file descriptor HWP3.x: Failed to get fmap for uncompressed stream HWP3.x: Font Entry: number of fonts is too high, invalid. %u HWP3.x: Font Entry: number of font styles is too high, invalid. %u HWP5.x: No memory for information block object HWP5.x: No memory for information block contents array HWP3.x: Failed to read information block id @ %llu HWP5.x: No memory for information block entry object HWP3.x: Failed to read information block len @ %llu HWP3.x: Information blocks length exceeds remaining map length, %llu > %llu HWP3.x: Information Block[%llu]: TYPE: Invalid Terminating Entry HWP3.x: Information Block[%llu]: Invalid multiple of 617 => %u Hypertext/Hyperlink InformationPress Frame Information Field NameHWP3.x: Information Block[%llu]: TYPE: UNKNOWN(%u) HWPOLE2: Mismatched uncompressed prefix and size: %u != %u HWPOLE2: Matched uncompressed prefix and size: %u == %u HWPOLE2: Failed to read uncompressed ole2 filesize HWP5.x: No memory for Hwp5Header object HWP5.x: No memory for Hwp5Header/Flags array HWP5.x: Invalid file descriptor argument HWP5.x: Password encrypted stream, scanning as-is HWP5.x: Can't stat file descriptor HWP5.x: Failed to get fmap for input stream HWP5.x: Detected a '_5_hwpsummaryinformation' stream HWP3.x: Failed to read fmap for hwp docinfo HWP3.x: No memory for Hwp3Header object HWP3.x: No memory for json object HWP3.x: Failed to allocate memory for b64 boolean HWP3.x: password-protected file, skip parsing HWP3.x: Doc info block size is too high, invalid. %u cli_scanhwpml: cannot initialize xmlReader tۈˈw3͇͊݇ڊڊfailed to allocate statefailed to allocate code table%p <= %p, %p < %p(%ld) no data was processedcannot reference unpopulated dictionary entriesfull dictionary, cannot add new entryyara_arena.cpage != NULLbase_offset + offset <= page->used - sizeof(int64_t)yr_arena_coalesceyr_arena_next_address_yr_arena_make_relocatablenot enough memoryduplicate identifier "%s"duplicate tag identifier "%s"undefined string "%s"undefined identifier "%s"unreferenced string "%s""%s" is not a structure"%s" is not a arrayinvalid field name "%s"wrong use of anonymous stringinclude circular referenceloop nesting limit exceededunknown module "%s"internal fatal errorduplicate string identifier "%s"duplicate metadata identifier "%s"duplicate loop identifier "%s"too many levels of included rules'for of ' loops can't be nestedwwwwwwww|\<ܵ|\<wwwwwwܴ\|wwwyara_exec: beginning execution for lsig %i yara_exec: executing %i yara_exec.csp == 0object != NULLFALSE\@80@p(` 8\\@@xPȼpHP ȺphH\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\ yr_execute_code@@@@@P@@@]ImUQF;-  gQ_T0Jj-(L\;fE0~N\NaF;jj~-%d(CdRmayara_yyparse  JKKKKKLMNNOOPQQRRSSTTUUVVVVWWXYXXZZ[[[[\\\\]]]^_```````ab`c``````````````ddeffhggiijjkkklllllllllllllllllllllllllllK'LMQ?MR BS T@ NBO UVBPCV WXBA()CX  !"#$()=>G\^_`klYEGklGGGGGG_l_`lDEG*+%&,-./0123456789:;CG !"#$GGEG6789:;<GGGG H> + GGBDBGG$ey !"#$%&9,-./0123456789:;<>GH%&,-./0123456789:;<,-.,-.6789:;<6789:;<H,-.H,-.6789:;<6789:;<H,-.H,-.6789:;<6789:;<H,-.H,-.6789:;<6789:;<H,-.H,-.6789:;<6789:;<F,-.F,-.6789:;<6789:;<DG]()N bcOSbc_`Za[^stuvw*+z}~ uvw./01234KLbc56789:;<=>?@A!.01#23&4'5678BC,T:;<=>?DUPdyVqrstuvwWXY{4C.c0123Q4 56"-:;<=>?efRghijklmnopqrstuvwCQefghijklmnopqrstuvwghighiqrstuvwqrstuvwghighiqrstuvwqrstuvwghighiqrstuvwqrstuvwghighiqrstuvwqrstuvwghighiqrstuvwqrstuvwghighiqrstuvwqrstuvw $%MxEF\H|IJM_g    (5dfbc/Z[WX12gs 0H"!V>p0H,"67IY)-@?QO=34nomACBDEGFqrhijkl%$&'# e8\]^_`a*+;.TURKPM9SLJN<:; 1QX\+s6\t?BKtORSqHPT^`aOO9}bt9dOOO$tR5Y"Jthhhttttttt$mxOwnJ<zv<>mO{tO<,GH:8I9DBCE;F.?@-A>  !"#$%&'()*+/01234567=syntax errorsyntax error, unexpected %s$*yara_grammar.ymemory exhausted$end$undefined_RULE__PRIVATE__GLOBAL__META__STRINGS__CONDITION__STRING_IDENTIFIER__STRING_COUNT__STRING_OFFSET__NUMBER__TEXT_STRING__HEX_STRING__REGEXP__ASCII__WIDE__NOCASE__FULLWORD__AT__FILESIZE__ENTRYPOINT__ALL__ANY__IN__OF__FOR__THEM__INT8__INT16__INT32__UINT8__UINT16__UINT32__MATCHES__CONTAINS__IMPORT__TRUE__FALSE__OR__AND_'&''|''^'_LT__LE__GT__GE__EQ__NEQ__IS__SHIFT_LEFT__SHIFT_RIGHT_'+''-''*''\\''%'_NOT_'~''i''{''}'':''=''.''['']''('')'','$acceptrulesrulestringsconditionrule_modifiersrule_modifiertagstag_listmeta_declarationsmeta_declarationstring_declarationsstring_declaration$@1string_modifiersstring_modifieridentifierarguments_listregexpboolean_expression$@2$@3$@4integer_setinteger_enumerationstring_set$@5string_enumerationstring_enumeration_itemfor_expressionprimary_expressionsyntax error, unexpected %s, expecting %ssyntax error, unexpected %s, expecting %s or %ssyntax error, unexpected %s, expecting %s or %s or %ssyntax error, unexpected %s, expecting %s or %s or %s or %swrong type "integer" for matches operatorwrong type "string" for "matches" operatorwrong type "integer" for contains operatorwrong type "string" for "at" operatorwrong type "integer" for or operatorwrong type "string" for "or" operatorwrong type "string" for "<" operatorwrong type "string" for ">" operatorwrong type "string" for "<=" operatorwrong type "string" for ">=" operatormismatching types for == operatormismatching types for != operatorwrong type for range's lower boundwrong type for range's upper boundwrong type for enumeration itemwrong type "string" for "int8" operatorwrong type "string" for "int16" operatorwrong type "string" for "int32" operatorwrong type "string" for "uint8" operatorwrong type "string" for "uint16" operatorwrong type "string" for "uint32" operatorwrong type "string" for "+" operatorwrong type "string" for "-" operatorwrong type "string" for "*" operatorwrong type "string" for "\" operatorwrong type "string" for "%" operatorwrong type "string" for "^" operatorwrong type "string" for "|" operatorwrong type "string" for "~" operatorwrong type "string" for "<<" operatorwrong type "string" for ">>" operator_STRING_IDENTIFIER_WITH_WILDCARD_(file name missing)yywarning(): %s line %d %s NULL filenameyyerror(): %s line %d %s bad buffer in yy_scan_bytes()out of space in lex_bufincludes circular referenceincludes depth exceededcan't open include file: %sincludes are disabledindentifier too longKBempty stringunterminated stringillegal escape sequenceempty regular expressionnon-ascii characterinput in flex scanner failedout of dynamic memory in yyensure_buffer_stack()out of dynamic memory in yy_create_buffer()out of dynamic memory in yy_scan_buffer()out of dynamic memory in yy_scan_bytes()yyset_lineno called with no bufferyyset_column called with no bufferunterminated regular expressionfatal flex scanner internal error--end of buffer missedfatal error - scanner input buffer overflowout of dynamic memory in yy_get_next_buffer()fatal flex scanner internal error--no action foundyara_lexer:yr_lex_parse_rules_string() disabled )xndZPJ@6 }s`` "0FE@(w_v@`0Q .!'#!I1'.T#w1W.ITw.W.~}|zyxvja`_^]\[ZVUSRQPONMLJH?>:62)(&%$"      !"#$%&'()* ,,0--0;<>?1>?1ABDESTdHI..2JK2N@U]XVtOj^ePYkQfugh+++++++++++///////////33333333333555555555558888:::::==FFFFGGGGaaaabbbbbbbbccccccccccciiiiiiiillllllllllnnnnnnnnnnpppppppppprrk~}|{zyxwvsqq9om`_\[ZWRMLC976644 4569^]XW`eeeKeT3%(2I3&2283!:/8,((4/.eeEe9HeeGeeGe87eeeee'<-##" CHeeeee eeeeeD    ^ e keOURKh@%see}         !"#$%&'()*+,-./012345 6LJIIJF32G66J45555555555555555J>?8KDEAK/0,,312*-645555555555555555555555>@;<:9@DAACB/+-6755555555555555555555H555555555555$5 55 55=55555555%&555555!55555 )5555"#555555' 5(5 5.wrong number of arguments for "%s"wrong type for argument %i of "%s"yara_parser: no mem for struct _yc_string. YARA fatal error: terminating rule parse yara_parser: no mem for struct _yc_rule. 0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz+/Oct 28 2018TomsFastMath (%s) Sizeofs fp_digit = %llu fp_word = %llu FP_MAX_SIZE = %u Defines: __x86_64__ TFM_X86_64 FP_64BIT p./025 9=DKT_l{@4,4BCDTFHtK4OS4Y_4goy44libclamavCannot prepare for JIT, because it has already been converted to interpreter Cannot prepare for JIT, LLVM is not compiled or not linked LLVM is not compiled or not linkedcli_hex2ui(): Malformed hexstring: %s (length: %u) cli_hex2str(): Malformed hexstring: %s (length: %u) cli_hex2num(): Malformed hexstring: %s (length: %d) cli_xtoi(): cli_malloc fails. cli_strtok: Unable to allocate memory for buffer cli_unescape: Unable to allocate memory for string utf16 length is not multiple of two: %lu UTF16 surrogate encountered at wrong pos cli_utf16toascii: length < 2 cli_strrcpy: NULL argument 0123456789` p P   %y%m%d%H%M%S%Y%m%d%H%M%S.crtcli_malloc(): Attempt to allocate %lu bytes. Please report to https://bugzilla.clamav.net cli_malloc(): Can't allocate memory (%lu bytes). cli_calloc(): Attempt to allocate %lu bytes. Please report to https://bugzilla.clamav.net cli_calloc(): Can't allocate memory (%lu bytes). cli_realloc(): Attempt to allocate %lu bytes. Please report to https://bugzilla.clamav.net cli_realloc(): Can't re-allocate memory to %lu bytes. cli_realloc2(): Attempt to allocate %lu bytes. Please report to https://bugzilla.clamav.net cli_realloc2(): Can't re-allocate memory to %lu bytes. cli_strdup(): s == NULL. Please report to https://bugzilla.clamav.net cli_strdup(): Can't allocate memory (%u bytes). Unable to readdir() directory %s: %s cli_gentemp('%s'): out of memory cli_gentempfd: Can't create temporary file %s: %s malloc_problemcalloc_problemrealloc_problemstrdup_problembuffer too small for ctime invalid timestamp/tmpTMPDIRcli_readn: read error: %s cli_writen: write error: %s %s/clamav-%s.tmp(?i)>0xHx(((`P[:<:]][:>:]]NULSOHSTXETXEOTENQalertBSbackspaceHTnewlineVTvertical-tabform-feedCRcarriage-returnDLEDC1DC2DC3DC4NAKSYNETBCANESCIS4FSIS3GSIS2RSIS1exclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signhyphen-minusfull-stopzerotwofourfivesixseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketbackslashreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-bracketDELalnumcntrllowerabcdefghijklmnopqrstuvwxyzprintpunct upperABCDEFGHIJKLMNOPQRSTUVWXYZxdigit0123456789ABCDEFabcdefABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ !"#$%&'()*+,-./:;<=>?@[\]^_`{|}~REG_0x%xREG_NOMATCHcli_regexec() failed to matchREG_BADPATinvalid regular expressionREG_ECOLLATEinvalid collating elementREG_ECTYPEinvalid character classREG_EESCAPEtrailing backslash (\)REG_ESUBREGinvalid backreference numberREG_EBRACKbrackets ([ ]) not balancedREG_EPARENparentheses not balancedREG_EBRACEbraces not balancedREG_BADBRinvalid repetition count(s)REG_ERANGEinvalid character rangeREG_ESPACEout of memoryREG_BADRPTREG_EMPTYempty (sub)expressionREG_ASSERTREG_INVARGrepetition-operator operand invalid"can't happen" -- you found a buginvalid argument to regex routine*** unknown regexp error code ***;18(1HPR5pRSR?S\8H]x]k](__p```aya (bxbb ~ H6RRS؍S_9b/diVkl@q(q@qXrpJrrBss8ρHz@HH HaIIJ JPJ LHWWS^^O_P```yPjP}px2(2@22(2H83h3h45X55X 6xX667(p77( 8p8h8P9x99@:H`:8:8;(x;x ;"H<$<$P=(%h=X%=%=&=X&='@>(>(1?H7?8@@H>@X>@@@HEpAx_xB(`B8dXCHdpCXdChdCfCiDmHDrEXuEuEv FxPF{F{F8|F}(G~XGx~xG~G(G0HHhHH؂HIh I؃8IPIxhI8IIJ@JȈXJ؈pJJJJ(J8JHKXKȉXKhK0LHLؘL(M`M8MMh NxOظxPغPxPQXQ SSXHTxTTU+ V+8V1Vh1V1W87`W?WhCHXChXHXHYLPYXMYVYhW8ZXZZh[Z[Z]0[b[xc[c\gP\8i\l^(m@^xmX^n^hqx_xq_s8ccX@dhXdxpdxd@e؝peئeee8fȧPfXfhfgx8gPgXgghhhhX iȷXihiȿijXhjhjjj k8kPkkk8k8lPllxlllmXmmm8mm@nxnnXoXHoo8pXpxpxpHp(qXqqq8rxrrhs`s!s*(tX7xt7t7t7t;u<`uh=u=uXBvCPvhEvEvFwG0wG`wGwJwJwKx8K0xKhxKxXSyVyxXyXzX(z[xz[zh\z^{h_P{`{`{Ha{Xa{ha|xa(|a@|aX|ap|8b|Hf}mX}n}8o}o0~Ht~xt~t~t~(u 8vvwXwHwpw8xȀHyH{X|}~hЂH `؆x08ȏHPȝЅx؞PpإhpرXȴPxظȉ8HHHxȋ(x(XxȎ(p{PX(`ؕXh8ؖ(@XX8 8xHhؙh` P PDȜE8EHH@hHXxHpHIJ؝XJK((L@MhNPSXW\ \@hkH8x؅8Ȇ08ȇHhxȣx0p(ФȮx`xXȴHH@Hx8XȪX((H(H ȬXXحh x88H X$%%H(&('а(*`/08BHCDHHHKO8Q[д\8]8(eehgȵ(hhi(uxȶhxX(p(hPتع 888 x@hػ@8ȼhxн0H`x(8ؾHXh x8Phп8X(H@ h @ `80H!!h"("h#$$(8%h%(&0+h-8.1P1h?J(XLpTa08cxei`p(qq x}8}p(~(@H @8x@h`xhh@Hx0h  H P!"#8#(#x8)).H0@1h6EHEhxFFFhGG0HHXHhHHKHT`UUVVhXh(`h`a aHbHfh`hjk0lpllhmnnp Hw8y{@|p(}}PhHp(X(Hȅ`8H(hh؊X h(؎( ph8(xPhX8hPHxXXح0H`x(8Ȯ(xȯȱXؽ`x(h((@xx(HX8hPpX(xpHH(8 8PxH(h@xXh 8PhH8P8 8PXH`x x( H  @H H H`h(xp8 8 XX x   8!h!!0"`H"x&&'8'h'0'P(x(()()8))*(,-(-X-x- -8x.h.(//x03xx385X6P6p6>>h?8?8@@XExE EPFhFHH( hH@ Ip J L NP Nh Y (Y XY hY Z Z` ] ^ ^ ^0 h` 8a ha a a8 bh 8b Xb c xd eeHgXggHhHhj8n`X~8ؗ( @hpȧ(8@hXتȬH`88x088XرH X8 xpX(p8Xh@Hh(HHX`xxhXP(@xX 3 4 84 x4!4 !(6!(7!H7!X:"h:"w#~X#~p##$(x$$ȏ$$X%p%8%%X0&h&(&@'''X(8(((XX))()*`**`+X+++8+X,X,,X,,-@---H-x-.x0.`.(..H/8/h//X/0P00h00181(X11h1282H22h23h@3`33384P4H4(405HP5x5(555(6@6Xp6666x@7X7p787x777(8@8X8p88889x09Hx9 : 0: H: `:8 x: : :h : ; 0;8H;;;;;8;X;x<hx<<(<H=H=x=>xP>hx>> ??H"0@H#@%0A+A,Ax,A,B,0Bx-B-B.B.B/CH0C(1D10Dh2D2D3 E(4XE84pEx4Ex8`F8F@FxAHGA`GBGxFGFGF0I\hJ8yJ| K}@K}XK}KxKȎpL8LLH@MHxMNXhNxNNN OȱpOOXPXXP(P(P88QpQXQhQ8QHRRȾRRHRXS88SSSSThTXT(@UpU8UV`V8V8WX86xXX7X?XYF`ZGxZxGZK([MX[xZ[g[i8\jP\jh\8l\s8]sP]s]s]Hu]xvH^v^8y0_y`_z`{`ةpaرaس0bشhb8bchHcc ddػdؼeexeef f8fPfhffff(fgHgggX(h`h(hi0iXxiijjjX0kxHkklllm mx8m(mm n8 Pnx hnx n n @ooo(oxo`ppph&8qh)q-r8.Hrh.`rx.xr/r3s6hsH=sxG t8HhtJtMtR(uSpuTu(_vX_0v_`v8`xvavbwb@wbXwcwXewf8xHfhxgxgx8hyhh0yhHyh`yixyiyjy8jzl zm@zXm`zmzmz8nzxnzh0{H{({{X|X`|x|(|}Xh}ث}X}h}}Ȭ~ج ~8~P~h~~(~8~H~X~h~x(hP(HhHЀxH88pضh0pHЂX8ph (px؄( pxȆ@XpHЇHHxX8؉@X8ph؊8Hxȋ(8`hxh(8؍@xȎH`xȏ +hh_ȥhXh(8xx0Гx H||}ؔ(}8}H} X}8h}Px}h}}}~ȕ(Px8Ȗ0Ȃ`8xxH،h Ȓؕxx8PHhX888Ȝȝ80(О(`(HX8XСH0h8p8خ@8XHphx @ȱXرp(hХx(PXx8ئ(PXhXHh`(8XPxXH`ȫh0hH((XHح(X(Hx ȯ h@X ($8(`,/@3GHشHIzRx $8}FJ w?;*3$"D`n \XnDt`nfBAD r ABD J ABC MFBDn BBB B(D0A8JP8D0A(B BBBdPo BBE B(D0A8Dh 8M0A(B BBBN N 8A0A(B BBBH lx BBE B(A0A8G\ 8C0A(B BBBD Y 8A0A(B BBBE b 8F0A(B BBBA GG`A1GZBK_At$p@ BBB B(D0A8D 8D0A(B BBBI oGKEZGHE_8 BBE B(D0A8F 8A0A(B BBBF  8A0A(B BBBO  8C0A(B BBBB XDKEVDKE[<LBAA U ABD f HBE \h+BBB A(A0I@5 0C(A BBBA P 0E(A BBBA d8`BBE A(D0 (C BBBA C (A BBBF O (F BBBE 4T0BAD  ABN AABLBEB B(D0A8J6 8A0A(B BBBA dبBBB B(A0A8DP 8A0A(B BBBG   8F0A(B BBBG \DBBE B(D0A8G@ 8C0A(B BBBF V8D0A(B BBB\KBB B(D0A8D@s8A0A(B BBBB@LBBBE B(D0A8L` 8A0A(B BBBH LTkBBD A(A0M (A BBBB A(C BBBd BBB B(A0A8GDKAS@ 8A0A(B BBBA t &BBB B(A0A8Dq 8A0A(B BBBG  8F0A(B BBBA # BwAL@BBA A(G0b (A ABBK x (C ABBH ,AAV S CAA l0rBE B(D0A8G@2 8A0A(B BBBE P 8F0A(B BBBI t&AdLBBA A(G0 (A ABBE D(A ABBdBBB B(A0A8D 8A0A(B BBBA q 8A0A(B BBBD \L QBD B(E0A8G`p8A0A(B BBBH`L JBBB B(D0A8K 8A0A(B BBBF | 9BBD B(D0A8J` 8A0A(B BBBB b 8F0A(B BBBG p 8F0A(B BBBI | hCBBB B(A0A8D`O 8F0A(B BBBD R 8F0A(B BBBG T 8F0A(B BBBE j 8F0A(B BBBG x8A0A(B BBB\$ KBB B(H0A8H@k8A0A(B BBBI@ KlQ # 4< qrAD ] CBG IAB 83L$ `&GBI E(A0y(A BBBH0Dt @2eBI A(D0Mp0A(A BBB 8`BBB B(A0A8G5GBB\l 8C0A(B BBBK GBEWaBEBDDXD[AsBEBCD[B_BOHBDSOGBEXd BBB B(A0A8G 8A0A(B BBBH { 8C0A(B BBBA L$PBFA A(N0H (A ABBJ a (A ABBI Lt8BBE B(D0A8M 8D0A(B BBBI DABBE A(A0Gj 0C(A BBBJ |$RBE B(D0A8S  8A0A(B BBBJ DZFKC+BBB B(A0A8GA 8D0A(B BBBA BGI[YDGJ`WPDHEGU@BBJZPDHEQSEBI^OVDL[BTBBE B(D0A8L`khIpuhA`Y8A0A(B BBBP BBB B(D0A8J`ZhGpVhB` 8A0A(B BBBC 4 8C0A(B BBBA KhWpExAS`    (L"$BBB B(A0A8Gc 8A0A(B BBBB <<%AAN n DAE v DAE \|)NsGQ G S E I G V B Q G F B J F I G J F J F I G I G Q O S M _ I S E S M S M F J w I I G S M F J F J F J F J G I G I O I T L F J T E H G H H H H X H T L T E H E ] E T E a E a E a E a E a,D z B ,/vNcGa G T$,/D b J d D K E ,Tp0EAAL  AAA 42AAJ X CAH D FAE 46F`,5iQI zAK DCL X5xBBE B(D0A8G@< 8A0A(B BBBC ,\6UBDH l ABC 6TGU D q46EBAA r ABG AABD7VKAJ0o AAI  FAH HH04,(8nYAP _ AAE KKAdd`8vKBD A(J0w (A ABBG P (C ABBH xH0$x9KAAW oAA9K 9$9DW<9lT@:bl:,:fL;BBG B(D0A8G 8C0A(B BBBA $x=tAu J V A \="FT<4=BBD A(N0b (A ABBA tP>'h>`>X>P>H>P>H>4@><L8>nGAD Q ABH AABLh>BBD A(QI (C ABBE X(F ABB>zBBB B(A0A8D`hEpBxDR`O 8A0A(B BBBJ hEpBxEM`Q 8C0A(B BBBE Ld@S BBI B(F0A8J 8D0A(B BBBD LJBBG B(D0A8Qpj 8C0A(B BBBG <LHBAD ` ABF _ FBI LDQBBD A(Q0U (C ABBI  (G ABBE 4PU|BAA D0a  CABA <VkBAD  ABG ^ ABG D WJAP J AAI D AAJ XH TT@X BBE B(D0A8MGdAD 8C0A(B BBBC GGBBEEDf0GGBAHEE\"GGBBEEDfrGGBBEEDfGGBEBEA^3GFGTGGBBBFBNcBBB B(A0A8Dp 8D0A(B BBBA xGFG\p xGAGO xGAGdpt4@{HBBE B(G0A8R_DBALUDBAL~8A0A(B BBBLXhBBE B(A0A8M@' 8A0A(B BBBE jBBE B(C0A8M` 8C0A(B BBBH  NBAI5BBBIAZBd BBE B(D0A8D@I 8D0A(B BBBF y 8D0A(B BBBA LBBB B(D0A8JA 8A0A(B BBBD d< BBE B(A0A8LBEBWm8A0A(B BBB\ BBE B(A0A8MA+ADAAADAQA8A0A(B BBBL!{BBE B(A0A8LA8A0A(B BBBdT!BBE B(C0A8MA) 8C0A(B BBBG FAFABAFA\AL!MBBB B(D0A8IA,8A0A(B BBBl "i JBD B(D0A8PB 8A0A(B BBBB @HB,|"A` G a G R F "Q4"8+BBB B(D0A8J_ 8D0A(B BBBB _E_]_A_h_I_B_A_N_J _H_N h _H_J _G_W_D_3 _B_S / _G_J J_B_R_j _G_J _ _B_N h_B_[_D_d _B_P 5 _G_J J_N_J_A_U__A_T_A_ _A_O L$BBB B(A0A8Gm 8D0A(B BBBE T$`ll$XsBBB A(A0G^ 0F(A BBBF Z 0A(A BBBF  0C(A BBBA ,$hPGAD AB4 %lAAD  CAG WCALD%QEBB A(A0` (A BBBF w (F BBBE d%EBB A(A0Z (C BBBB \ (F BBBA M (C BBBA |%HPPBB B(A0A8G@8A0A(B BBBH@cHHPGXG`GhDpDxDY@|&EDc I T\&HLBB B(D0A8U B8A0A(B BBBH 4&`IDA n ABI A ABD L4'BBB B(A0A8Lx 8C0A(B BBBF ,'pAAI O AAD L's BBE B(F0A8Rf 8C0A(B BBBJ d(BBE B(D0A8O@c 8F0A(B BBBG D 8R0A(B BBBI Dl((BAD  ABF W ABF O CBD <(BBH A(J (A ABBH (0AjL)/BBD A(QA (A ABBG  (F ABBK Ld)BBE B(D0A8S$ 8D0A(B BBBD L)BHA I(G0c(C A ABK R FBF wFB,*fAAK x AAI L4*BBE B(D0A8GH 8A0A(B BBBG L*0 BBB A(D0Je 0C(A BBBD kR"jT* uBBE B(D0A8UMR(eb 8A0A(B BBBK L,+BBH B(A0A8J8A0A(B BBB,|+IDA AB,+XBAD AB\+/BBB B(A0A8LUBhA8C0A(B BBB4<,fAAJ@a AAA sAAt,JL,PBBE B(A0A8DP 8D0A(B BBBH |,BBE B(D0A8J` 8A0A(B BBBK w 8A0A(H EBBF  8A0D(B BBBH L\-jPBB B(A0A8G@8A0A(B BBB-L-zBBB B(D0A8G 8C0A(B BBBF .ǏDBBB B(A0A8JBeAB\BcBaBRB\F8D0A(B BBB4.{BBD A(A0(A ABBL.B BBB B(A0A8J o 8C0A(B BBB,/rBBB B(D0A8M a B \ B  J R A s B ^ A  E I B 8C0A(B BBBL/dBBB B(A0A8JAf8A0A(B BBBL 0BBD B(F0A8NA8C0A(B BBBL\0[BBB B(A0A8O 8A0A(B BBB\0 /BBB B(D0A8GBWA8D0A(B BBB\ 1ۮSBBB B(D0A8LvAdA 8C0A(B BBBl1"BBB B(A0A8G 8C0A(B BBBG UFIIIIIIIIIIIeDYAB[DB[ED,22BBE A(D0JH 0C(A BBBF t24 24d24BBE B(D0A8M`Y 8A0A(B BBBA  8A0A(B BBBB d 35BBE B(D0A8Jp| 8A0A(B BBBA D 8A0A(B BBBA ,t3P8@BAD uABL3`8BBE B(D0A8PL 8A0A(B BBBJ 3ADB W4A,4A$DB ]4L4AAAG q CAB w FAB t4pALBD B(D0A8O@Z8A0A(B BBBD@e8C0A(B BBB4A5ACQ D 445DZBDH z EBA AFBl58D<,5`DBAA AB<5DBAA Z ABG Q ABA <5@EBAD D FBM O ABA 46EABBB B(A0A8G 8D0A(B BBBE EBDNDPDBGBGXEBDBCO468M~BAD W ABG MFB<7MBBD A(G0f (C ABBB 4T70NgBAA P ABI ACBL7hNBBB B(A0A8G@ 8A0A(B BBBE 47TSNAJ AA 48UGDD IABE LL8V BBB B(D0A8G 8C0A(B BBBD 8b8bHHg I $8c_AAN LAAT8HcbKBD A(J0W (A ABBG XH0T9`dl9hd49`dHAG \ AAB pP ,9d?AAG d DAF <9eeGAD ^ CBA [JB<,:8eFAJ mCAN k FAF l:e,:eAAG P DAJ :PfAi F ,:ftQAR XAAZ ; g;gT4;gdAALbEPAk CAK Z CAB f CAF 4;(hVAG [ CJ L CA TA;Ph ;Hh74;phcAAJ m DAJ D AAB D,<h1QAJ  AAC D KAP ZAA4t<iRAD K0  AABA <<XjBBA A(D0 (D ABBG D<lLBD A(L0X(A ABBB0D4=PlBBB A(A0GI 0C(A BBBF \|=nLBE B(D0A8Lq8A0A(B BBBG\=Xo.BBD A(G0 (C ABBB } (H ABBF D (D ABBA L<>(pjBBB B(A0A8JJ 8A0A(B BBBA >HwcH} K $>w_ADI LCA4>w]AG  CAG DFAL ?hxBBB B(D0A8Jo 8A0A(B BBBH ,\?zBAD G ABG <?H{BBA A(F0 (C ABBD <?|@EAA  ABC  ABA \ @} jBB B(A0A8Lp8A0A(B BBBOp<l@~xBAD B ABL A FBG ,@vBGA hABd@XW BBB B(A0A8D 8C0A(B BBBH X 8F0A(B BBBA LDAPBBB B(A0A8G8 8D0A(B BBBJ tA!BBB B(D0A8G 8C0A(B BBBH BbAGlBL B8u BBE B(E0A8Jp 8A0A(B BBBG L\Bh BBB B(A0A8G!; 8D0A(B BBBG BDsPBBLBBBB B(D0A8MP 8D0A(B BBBF LDCBBE B(A0A8JP` 8D0A(B BBBD <CbBBD A(Q0r (C ABBD $CHAAI zAALCBBB B(A0A8Mc 8A0A(B BBBA 4LD8=BAA s ABF \ ABA dD@BBB B(A0A8DP& 8A0A(B BBBB i 8H0A(B BBBE 4DtAAJ x CAH G CAE $$EAAX CALE$D_,dEBAA ABEpALLEpBBB B(A0A8D@ 8D0A(B BBBD F,F[AAJ c AAG LF4dFvBDA P ABN JABFH|FPqBBB B(A0A8D` 8A0A(B BBBA   8H0A(B BBBG L 8J0A(B BBBI |4GPBBB B(D0A8GP 8A0A(B BBBK  8C0A(B BBBH  8D0A(B BBBE dGpsBBE B(A0A8JP` 8A0A(B BBBG y 8D0A(B BBBE H0AU J K+J+H+H,]++L+b+B+t+H+j+A+c +S+Y+D+X+E+] E+L+b+B+t+H+j+A+B+L+b+B++H+h+B+h +F+F+F,F,F,F,F,F,F,F,F,X+d__ BBE B(A0A8J 8A0A(B BBBG YHLEQL4` BBE B(D0A8Od 8A0A(B BBBC l`RBB B(A0A8G 8A0A(B BBBB KEE\D`BBB A(A0DP0A(A BBBL BBA A(D0y (A ABBG f (A ABBD L (?IBBD A(D@T (C ABBA  (A ABBA |\(@BBE B(D0A8JP 8A0A(B BBBH M 8C0A(B BBBG  8D0A(B BBBA D܏C8AAG  ACF S AAC H ACD L$D4BBI B(D0A8G 8C0A(B BBBA LtF.bBG B(D0A8GP8A0A(B BBB,Đ`Gl\AT wAA,Gl\AT wAAL$GBBB B(A0A8DpZ 8A0A(B BBBF t`IYD0B J HDI+KBA A(G0(A ABBE0LܑYTBBG B(D0A8T` 8A0A(B BBBJ 4,[UBBD A(T0n(D ABBtd[LBBE A(D0~8N@A8C0A (A BBBJ c8U@z8C0A (A BBBC O(F BBB<ܒ\bAD D(H0S(A AAB<\bAD D(H0S(A AAB<\8]bAD D(H0S(A AAB<]bAD D(H0S(A AAB<ܓ]bAD D(H0S(A AAB<(^bAD D(H0S(A AAB<\x^bAD D(H0S(A AAB<^bAD D(H0S(A AAB4ܔ_RAAL X DAE XDALGBBE B(D0A8P U8A0A(B BBB|d^zBBB B(D0A8D 8C0A(B BBBD  8A0A(B BBBH s 8F0A(B BBBA celPfS^BE B(D0A8Mu 8A0A(B BBBH H@ilHiBBE B(D0A8Im 8A0A(B BBBH  BYBvBSAL v0 BBG B(D0A8JM 8A0A(B BBBE D\ȁYAAF0w AAG  CAI D CAH lJNBB B(A0A8GmBZA}8A0A(B BBBBL BBE B(D0A8O 8A0A(B BBBG LdPBBI B(D0E8O 8A0A(B BBBG L2BBB B(D0A8JP 8A0A(B BBBA !KBE B(D0A8Kv 8A0A(B BBBD  8D0A(B BBBA C\@BBB B(A0A8J} 8A0A(B BBBE MVA,rGAD UDB,$0BAD rDBTaBB B(A0A8D 8C0A(B BBBI  8A0A(B BBBA (HiAtCtBBB B(A0A8D 8A0A(B BBBH = 8D0A(B BBBF DHhA4lدmBBA A(D0\(A ABB,BAA Q ABH LԛBBE B(D0A8J` 8C0A(B BBBJ L$0BBE B(H0A8U z 8A0A(B BBBC LtBBB B(A0A8G 8A0A(B BBBK ,ĜAAE AA\dBBE B(D0A8G 8A0A(B BBBA  BNAT@H] K dt2BBB B(A0A8D 8A0A(B BBBH  8A0A(B BBBD dܝ7BBE B(D0A8QpGxMgxBpxAbxAp^ 8C0A(B BBBD ,D`AD  AD  JJ LtBBB B(A0A8DPP 8C0A(B BBBF dĞ`BBE B(D0A8Gpw 8A0A(B BBBH O 8C0A(B BBBE d,_BBE B(D0A8Gp{ 8A0A(B BBBD W 8C0A(B BBBE LBBE B(D0A8G`p 8A0A(B BBBG LBBE B(D0A8Gpp 8A0A(B BBBG <4`BBA A(G (A ABBD 4t BAD Gp  AABD d JBD A(L0 (A ABBA ^ (A ABBD `C0L BBE F(A0A8X` 8F0A(B BBBG Ld BBE A(A0m (A BBBA (F BBBLp BBB B(A0A8GJ 8D0A(B BBBA L +iBBB B(A0A8GJb 8D0A(B BBBH \T@GCBBB A(D0D@b 0D(A BBBD k 0D(A BBBJ L0ILBBE B(D0A8Y 8A0A(B BBBB L0JBBG B(D0A8MG 8C0A(B BBBF ,TJ>FAJ iAALJjBBB B(A0A8DPT 8A0A(B BBBD LԣL&BBB B(A0A8DP 8A0A(B BBBC $L.<MAVL\MBBD A(Q0D (A ABBD R(F ABBLHMgBBB B(D0A8Gp. 8A0A(B BBBD 4hRADD r DAH VDA<4NBBB A(D0(A BBB\t#BBE B(D0A8D}PRAd8A0A(B BBBLԥ@RBBB B(A0A8D@ 8C0A(B BBBA L$VBBB A(D0Y (A BBBE o (A BBBJ <tXBHA O ABC h ABU LXHBBE B(E0A8Q 8A0A(B BBBB t]OBBB B(A0A8G  8C0A(B BBBD  I ^ A  G B G V |hl3P(J0O(A D$lsFvdRħl&ܧl2UP<mqBAD M@^HGPNHA@D  AABH $<XmsF}]Rdm&|m>Ugm<AzdnBBE B(D0A8O@l 8A0A(B BBBK R 8F0A(B BBBG l$PpBBB B(A0A8L 8C0A(B BBBA BBBDBa4xBAF K0Y  AABG $̩hyFG [AO <yRBD A(H0(I ABB4zLLzsBBK A(T` (C ABBD l (A AFBB d{BBB B(A0A8GA 8A0A(B BBBB AGABAGA]AP7Ae A O,$pEAD } ABF $TbFm M VT|8 KAD h ABE y ABD KABJ TԫBBE A(D0C (D BBBE y (A BBBH d,HBBB B(A0A8D`} 8F0A(B BBBF x 8C0A(B BBBD |eKBE B(D0A8M@P 8A0A(B BBBH j 8F0A(B BBBG LpBBD A(Rw (A ABBH  (C ABBG <dBBD A(D0 (D ABBE  (8DoԭPpAI F , 8AAM  AAI <K|T_BB B(D0A8M8C0A(B BBB[ 8A0A(B BBBA LԮBBG B(D0A8G@ 8C0A(B BBBA L$@BBG A(D0 (D BBBG ] (D BBBI ,tHDA AB,AAI  CAD 4ԯJAV o CAD Ht &KBB B(A0A8D` 8D0A(B BBBE D 8C0A(B BBBA Jz~KBB B(D0A8Gp 8D0A(B BBBH  8A0A(B BBBI gCp\DPBB B(D0A8J@ 8A0A(B BBBD@$Р1AAD hAA̱DT4zBBD A(D0f(A ABB8%Ac<H"A`\X A^|X<`hIBD A(P0|(C ABB<Բ BEI A(A0 (C BBBG D`BBE A(D0G0A(A BBB<\آQEED  ABH M FBK LlBEA A(Q0 (A ABBH P (F ABBE ~H} K D xIBBE A(D0D` 0A(A BBBE DTHEA C(  ABBF Z ABB(J4KAJ qAAG ( (,$0vTAC SABLTNBB A(D0](A BBBE0L BBA A(D0i (A ABBG l (F ABBI dBBB A(A0g (D BBBG G (D BBBG Y (D BBBA $\5M]FC '83$`oAAG cAA4ܶBHA  FBF ICB0D J L40!BBE B(A0A8Dp 8A0A(B BBBB LBBE B(D0A8L@p8A0A(B BBBԷ`X#$p'AG F AA ,xDD AG0J8W@|8A0^ AK X FB K AD <HRBD A(J0P (A ABBG ̸Q|BBI B(D0A8IЇr 8C0A(B BBBE >؇HDIfЇa؇JY؇BЇd|Ĺ,ܹTaAM W AAH  !A_,D L\BBB B(D0A8J@p 8A0A(B BBBG )Ag̺(0@DT$HaG T AC $KBB B(D0A8JPj 8A0A(B BBBD D 8F0A(B BBBE D8C0A(B BBB;L̻(BBI B(A0A8GP 8A0A(B BBBF thr BBE B(A0A8L 8C0A(B BBBG OXAGBAkph1A` G F̼1A` G F$NT4 IBAA I CBF eEBDDW\DW4tIBAA I CBF eEB!D \4Ľ_EAA r ABD A FBG 8 0 ,(D0 \tS2Dmm6DqGAJ zA,ľPDD dAB4xuAD lG ACA<,BBBE A(D0(A BBBl APJ,HuBDA cDB0EE44 YAAG | AAI DCALl BBE B(D0A8G 8A0A(B BBB=,(BDA {DBBBE B(D0A8U] 8A0A(B BBBD EADI^AnAABP^;Au$cAAJ MDAjXC$4/AAJ0`AA\\ZBE B(D0A8Jp 8A0A(B BBBD yxT]xCp<BBD A(J@l (A ABBK <hBBD A(J0l (A ABBK <Tl ,QRAD hABtGBE A(D0J@w 0A(A BBBD D 0D(A BBBA D0C(A BBB, D+D f\D S4t NRAD J0h AAB8 t0GBE A(D0J@x 0A(A BBBC D 0D(A BBBA D0C(A BBB<H T@9lhp h L`\BBB B(A0A8G 8A0A(B BBBA pLNFE A(A0(A BBBH0l4pNEG ABF dXLEB B(C0A8 0A(B BBBA 0A(B BBB$U<(GT rT`GT rl-LBBE B(H0A8P 8A0A(B BBBA d1BBE B(D0A8M 8D0A(B BBBG D8C0A(B BBBL<BBB B(A0A8GG 8A0A(B BBBF ,UGmAFd'BBB B(A0A8D  8A0A(B BBBK  8F0A(B BBBC T$BBF A(K  ABBE   CBBH A  CBBH |8 ;` h BBE B(D0A8M` 8A0A(B BBBC x 8A0A(B BBBF W 8C0A(B BBBE  8C0A(B BBBA dD 1BBE B(D0A8M 8D0A(B BBBG D8C0A(B BBB AY, TBGA DCB$ *AAJ [AA$ 4<8MAAJ0P AAB jAADtPBAD G0P  AABF b  ACBH LBBG B(A0A8Ga 8A0A(B BBBG  huT$BBE A(A0H (A IBBE m (A BBBA |x<@DAS AA D DA   AA LBBD B(A0A8G 8A0A(B BBBA |$0GBBB B(A0A8G`M 8A0A(B BBBA  8D0A(B BBBJ  8A0A(B BBBA (``"A`<pdBAA H ABA A FBG 4%AcTlHqAY F LHAB$2Al , NBAA FAB,8 "DP CDd H ,d VBAD ICB !L cBBB B(D0A8J 8A0A(B BBBA $+%,%+AiL%'d0%IaT,`%OAU J L D J F N%eoI%J&28&DV@&,8&D&9|\&BBE B(A0A8DR 8A0A(B BBBC + 8A0A(B BBBA K 8C0A(B BBBC 8)*D(F0_H)$@)#AAJ MGA<H)TP)z,l)vQAO RAA*<$0*jAAI \AA$x*aAAI SAAD*AAG \ AAI k CAA O DAT \LX+BBE B(D0A8Gb 8C0A(B BBBK PYH4-UAAJ l CAD KHAL-BBB B(D0A8J`b 8A0A(B BBBE L40/BBB B(D0A8GP 8A0A(B BBBD 06At 0 \0'BBE B(D0A8PRIA 8A0A(B BBBG 7447bAAT0t AAD OAADl(8}BBE A(D0PB 0A(A BBBH `8K8[T8ZBB B(D0A8S c 8C0A(B BBBI <H=,TP=_BAD TAB=2T=yHBD A(L0x (H ABBH D(D ABBd=BBE B(D0A8R 8A0A(B BBBD t 8C0A(B BBBA \?,t ?AAG AAA $@AG AA TAnLBI F(D0A8 0E(B BBBG \$ BBBI A(A0G 0C(A BBBA G 0F(A BBBA CL8Da OAH ) CBJ Q FBG XNPN$hN4`NDLNBBE B(D0A8IP8D0A(B BBBL`OBBB B(A0A8D 8C0A(B BBBF LRBEB B(D0A8DP 8A0A(B BBBA 4RLRTdRKBA A(DP (A ABBD XHPLSEBB F(A0A8DP 8A0A(B BBBA  XT#$pT#,<T#BAC VDB,lT>RAC aDBT#TT$@VtYO H C< VZAA ] FBG ACB,LVSG DL DC\|W)BBE B(A0A8D` 8A0A(B BBBD q8A0F(B BBB,hX;BAD nCB, xXbAAJ q AAA <<X|BBD A(L0H (A ABBE D|XMBD A(O0Y(A ABBF0dPYBBE B(D0A8GP 8A0C(B BBBI Y 8A0A(B BBBE d,ZBBB B(A0A8D`G 8A0A(B BBBA  8A0A(B BBBB L]BBI B(D0A8Ll 8A0A(B BBBJ DmKAD ABB AAB,8nBBB B(A0A8D 8A0A(B BBBG  8A0A(B BBBF  8A0A(B BBBG % 8A0A(B BBBA L8B BBB B(A0A8JL 8A0A(B BBBF 48AAN R AAD i CAK TAO,t\EAP hAAK LBBE B(H0A8Lp 8A0A(B BBBJ LPBBD A(S@o (A ABBG |(A ABBD\i$tAN AD $HAAG nDAL0BBE A(D0 (A BBBF I (A BBBE EL,ؖBEA A(M0 (A ABBA  (A ABBE |x(,;BAD pABlNBE A(D0 (A BBBF R (C BBBE HP0,404AAJ0N AAA dd@BBE B(D0A8G@H 8A0A(B BBBG X 8C0A(B BBBD ,jEAA s ABC <ؙBBA A(D0J (A ABBF L<(KAD k ABB G ABF XH LBBD A(J0C (D ABBA X (C DBBE -Dd\jBBI B(A0A8 0D(B BBBA F 0A(B BBBA LT BBG B(D0A8G,~ 8A0A(B BBBA 0vHuCجf40x^LTBBE A(D0 (A DBBJ D(C ABBLpBBE B(D0A8M 8A0A(B BBBA  4 `BAD j DBI UDB\D@_DB I(A0A8G@8A0A(B BBBI@|BBF B(A0A8D`& 8C0A(B BBBD A 8A0A(B BBBE x 8A0A(B BBBA d$@BBE B(A0A8D`? 8C0A(B BBBD M 8A0A(B EBBA daBA A(G0t (G ABBD PH0D(C ABB,0DAC {ABL$BBE B(D0A8G`O 8D0A(B BBBE Lt 2BBD A(T (A ABBB } (C ABBA ,BAD  ABA D NL BBE B(D0A8JP| 8C0A(B BBBF \&HQ|LMBE A(E0t(A BBBK04A H V J T A F E FL4PSBBE A(E0X (A BBBB A (F BBBC \`BBA A(J (A ABBH `G\AHKTE< BBC A(F0a (A ABBK $;dV<BBB B(D0A8D 8A0A(B BBBE  8F0A(B BBBC  8F0A(B BBBA ,0ZBCH IAB|`BAD D0P  CABO g  FABH n  FABI W  FABH S  FABL D JAB4tGAI d AAI pH <8BAD  ABD ~ ABG 4#AAG  FAF XAAd$BBE B(D0A8M`& 8A0A(B BBBC Z 8A0A(B BBBD L:DBF B(A0A8NS 8A0A(B BBBE BAj E QH P6At4pAL|TpBBB B(A0A8DP_ 8A0A(B BBBI  8F0A(B BBBE R 8F0A(B BBBG $Ds I W I XKP`BBB B(A0A8GiIDIABRXIJIABPsIADCH\8A0A(B BBBl>=BBD B(D0A8SAk 8D0A(B BBBF  AYA]AAAAYAUABAL<TBBB B(G0A8G 8D0A(B BBBF H[L@[BBB B(A0A8GP8A0A(B BBBL]|BBD A(W (C ABBE X (C ABBH dDc BBB B(A0A8D_ 8A0A(B BBBI  8F0A(B BBBG ,jAAP L CAF kk| k PHB B(D0A8M8A0A(B BBBGF 8A0A(B BBBH ooToUBB B(F0E8P  8A0A(B BBBF L rLBBB B(A0A8G 8A0A(B BBBE 4d vBBD A(F0(H ABBDv MBD A(M0(H ABBW0pxBAA J_ZaBT  AABF D[BQDZBXDDD]D[BLtBBA A(D@ (A ABBB R(A ABB4`ZAA vAB[ L؁BBE B(A0A8J} 8A0A(B BBBA L8i8Im\lXiBBE B(D0A8Iz 8A0A(B BBBC BbA\m BBE B(A0A8I 8A0A(B BBBK aBWA\,rBBE B(C0A8N 8A0A(B BBBK B\ALwBBB B(A0A8J 8A0A(B BBBK H(G`L`SBBB B(A0A8D 8A0A(B BBBK LDpBBB B(A0A8DP[ 8C0A(B BBBK | BBB B(D0A8J. 8A0A(B BBBA HHȄHЄH؄HHHq|hBBB B(D0A8GE^B  8A0A(B BBBF  TDDIGcJD_ M YЭ+]M<qBBA A(G0H (A ABBA  (&$@L<HlBBB A(A0 (D BBBH n (D BBBH 4h'AAG  AAF l CAH 4`ZAAM k CAB UCAKAe J Q<4BBA A(G0z (A ABBC \t@-BBB A(A0G 0C(A BBBH C 0C(A BBBC #(^p(J,4TDC u CBK ,d@WTDD uCB,pPQAJ oCA,rAAF0P CAD LBBB B(A0A8J! 8A0A(B BBBJ $D0YAN Q h A DlhBAA D0I  AABK P  FABG 4AAI0\ AAG T AAA HM<6BAD 7 ABG P FBH <DJBBE A(F0 (C BBBH T[BA A(N@ (A ABBE QF@,HoBAD O ABA  'AR M F,'AR M FL'AR M Fl*DV F I4ȽAAI e AAF n CAF <0BBD A(D0k (A BBBA <BBA A(D0h (A ABBH $DCE H S E hLlXBAD G0V  AABH T  CABF W AAB,A` G O I V J F8gDG E V< BAD G0V  AABH T CAB$LgAA F V B Ft WA~ A VL`=BBE B(D0A8I@( 8C0A(B BBBC 4PRAD KAAL LBBB B(A0A8D@\ 8D0A(B BBBI lh KTLpuBBB A(D0 (A BBBD ] (F BBBG LDBB A(A0 (C BBBF A(F BBB<$0UAD pCAR DFAdj`} C $jCR K z F 8bU{ H ZUz A ZUz A L EEB A(A0l (A BBBG T (F BBBA \h5D p,tzAAM d AAA ,`EAA N ABH Bd]4HRAC L AABL$~DBB A(A0U (C BBBH A(F BBBt06X6666<YMAD jDAR ACA,,mAI XAAG \tx ph<pON C hHQ G ^ A Y$ GV C d D $<A^ A j F Dd@AAD a CAE o CAE J CAJ BBE B(D0A8M` 8F0A(B BBBC @ 8F0A(B BBBA O 8A0D(B BBBA D8C0A(B BBBDAf I d.|4^KAI Y CAF `U(k4 GBAC ] RBI ACBL 6d 64| n^EA ] ABD `  6 H @ H P, XdD `BBE B(D0A8J`@ 8A0A(B BBBD  8D0A(B BBBI , AAJ t AAF 4 AAJ t AAF _ AAG d @kBBB B(D0A8J@| 8A0A(B BBBC  8C0A(B BBBH 4| HAAJ t AAF x AAF \ #BBD A(M0| (A ABBH Z (D ABBE x (D ABBG 4 AAJ o FAF O AAG 4L AAJ o FAF O AAG $  A{ D mL 'BBB B(A0A8DPi 8D0A(B BBBA T ~GBA A(D0U (D ABBE D(A ABB|T \BB A(D0G@Z0A(A BBBB@HEPEXE`EhEpExEEEEEU@ SBB B(A0A8J`Z8A0A(B BBBG`}hSpExEEEEEEEEEU`dBBH B(A0A8FP{ 8C0A(B BBBC L 8F0A(B BBBE Z 8F0A(B BBBA D8F0A(B BBBl1BBB A(A0D@} 0C(A BBBE HGPGXG`GhGpGxGGGGGW@|dP0BBD B(A0A8Uh 8A0A(B BBBE \\GDHDJHHHSC,8hAAP ~ AAF ,x"FOL&LdBAH G0N  AABD L  AABH D GAB,:FAS IKADx D f J CkKLBC A(H0p(A ABBH0D(H ABBW0t (A ABBF L (A ABBE D(G ABB$0qFD mAH LGAC G0N AABL0d AAB$<mFD mAH Ld`GAC G0F AABD0\ AABERBF A(A0X(A BBBE0A(A BBB`0z (A BBBG 4TlKAJ V HAK \AA <LBD B(E0A8D@N8A0A(B BBBZ@e 8D0A(B BBBN  8A0P(B BMBJ \ 8C0A(B BBBE S 8C0A(B BBBN ,OHAI yAAd0BBB B(A0A8GP 8A0A(B BBBA N 8A0A(B BBBE L,BEB D(E0[ (A BBBD S (A BBBF |($0aRHFDxmlAG  AAG F pF LMn$4<9DAE J@ AABLt2:+DBB B(H0A8MA8A0A(B BBBL UBBD B(A0A8GA78A0A(B BBB\dBBB B(A0A8G 8D0A(B BBBE ~ HNA$@AAD AAL0ABEI A(A0r (A BBBG A(A BBB<{B,TrBgDDA ZABBLH~BBD B(D0A8LD  8C0A(B BBBE dx.BBD B(A0A8GP 8A0A(B BBBD O 8D0A(B BBBA T0EP K t1,1QAGpAADH2BAA DpG  AABE b  FABE L3HBBB B(A0A8GM 8C0A(B BBBF LT@BBB B(D0A8G8A0A(B BBB<PBdDLE E(E0E8E@EHEPEXE`EhEp\<BNBBD A(L0 (A ABBF L$EBBB B(D0A8G 8D0A(B BBBC 4tJAAS s AAF CAJo BBB B(A0A8GO 8A0A(B BBBF #ae\Jsbsgl R \  LLT BBB B(A0A8G2 8D0A(B BBBH `$`:AAG lCALaBBD A(M0v (A ABBF j (F ABBA $,aUIUJlLTaAAD ` CAF U CAG N CAF X CAD LPb6EBB A(A0c (D BBBH S (D BBBC L@cFBBB B(A0A8D@l 8D0A(B BBBI DD@dEAA _ CBE V CBE ` CBK LdBBB B(A0A8D@m 8D0A(B BBBH DxfEAA _ CBE V CBE ` CBK D$0gAAD0o CAG T HAC \ HAK 4lgBAD G0S  AABK $hCF] M Fh 4hBAD G0S  AABK \ HiBBA A(D0F (C ABBH T (H ABBG e (C ABBK D| jBAA D0z  CABH T  HABA   l l$  lRK [ J Q G I!Xl44!PlAAJ0U8`@z8A0K AAG Tl!lPBEB B(E0A8! 0C(B BBBC A0F(B BBB!m!mB<!0nBBD A(G0u (A ABBE 4"nBBB B(D0A8GP 8A0A(B BBBE  8F0A(B BBBJ XN`XXAPyXA`OXBP`XH`VXBPL"rBBB B(A0A8D`o 8C0A(B BBBG \#pvBBB B(A0A8GE 8A0A(B BBBH WhA,t#mTAM nAAT L# BBB B(A0A8J 8A0A(B BBBE L#pPBBB B(D0A8JЂ 8A0A(B BBBF LD$pW BBB B(D0A8D 8C0A(B BBBD d$KBBB B(A0A8Dpp 8A0A(B BBBH 2 8F0A(B BBBG |$hBBB B(A0A8D` 8F0A(B BBBB N 8A0A(B BBBH ] 8F0A(B BBBD L|%7BBE B(D0A8Np8D0A(B BBB%\:WAUT%xBBE A(D0N@~ 0A(A BBBF P 0C(A BBBF dD&S5BBD B(A0A8Gw 8A0A(B BBBD 7/HIB4&BAD  ABI rAB&BBB B(A0A8DUBdGv 8A0A(B BBBH HAAT 8F0A(B BBBA R 8A0A(B BBBA 'xRBG B(F0A8Mw 8A0A(B BBBF `IIIIIIII[U`IIIIIIII[U`IIIIIIII[U`IIIIIIII[(0i$(pCHcA(iBBE B(A0A8 0A(B BBBE  0F(B BBBC  0F(B BBBD 0F(B BBB,\)BAA ABD)x BBI B(A0A8} 0A(B BBBD) BBI B(A0A8x 0A(B BBBL*( BBI B(D0A8O Z 8A0A(B BBBI l* *L*1BBB B(A0A8D@8A0A(B BBB|*xBBB B(D0A8D`: 8A0A(B BBBK { 8A0A(B BBBK X 8A0C(B BBBD l+4+AAD g AAA _ AAA +(%H[L+8TBBB B(A0A8DP 8D0A(B BBBH L,,H.BFB B(A0A8G g 8A0A(B BBBJ 4|,(sMAG z FAJ DCAL,p2BBB A(A0 (A BBBJ  (A BBBB -{4HAF<$-4BBD A(J(A ABB,d-TBAD k ABK L-0;BBD A(QPq (A ABBG } (C ABBC L-6BBE B(D0A8M8D0A(B BBBL4.BBE B(D0A8PpZ 8C0A(B BBBJ 4.8BBD A(H0v(C ABB,.8sBAD hAB,.>9{BAD pAB/.BBE B(D0A8J-u 8A0A(B BBBG -D-q-A-*-A-Y-B--D-k-A-\/`HBBF B(H0A8RFKNBO 8D0A(B BBBD \0PBBB B(A0A8DdRYAK 8C0A(B BBBK 4d0QAP x CD U(O0B8H@Z l0hRTKBE B(D0A8M` 8D0A(B BBBJ D8C0A(B BBB$ 1XSmAAG ZDAD41SLEA cABH T ABI T|1T1eBB A(D0Gl0A(A BBBG|1VKBF B(D0A8P@8A0A(B BBBD@W 8C0A(B BBBM |T2VGBE B(E0A8P@E8A0A(B BBBK@W 8C0A(B BBBM 2W\2WBBB A(A0 (A BBBA c (A BBBA c(A BBBL3W.jBB B(D0A8P`8A0A(B BBBE`w 8C0A(B BBBM t 8D0A(B BBBG 3H[nAQ F  4[$4[<4[T4[l4x[4p[4h[4`[4X[4P[L4X[qBBE B(D0A8P 8A0A(B BBBF ,L5]NAAD A AAA L|5]BBB A(D0 (D BBBE A(C BBBL5^BBI B(D0A8S 8A0A(B BBBG <6b|BBD A(G@@ (A ABBA 4\6(c~AAD X DAE c DAA L6pcABBB B(A0A8G 8A0A(B BBBA d6pk}BBB B(D0A8G@p 8A0A(B BBBB l 8D0A(B BBBA L7lDd7lBBB A(A0D@: 0A(A BBBA ,7m`AAG ] DAE T7nBBB D(A0 (C BBBD " (C BBBA L48q=BBB B(A0A8I2 8C0A(B BBBA L8!0BBE B(D0A8J`8A0A(B BBB<80vIDA f ABI  ABI L9xBBE B(D0A8J1 8C0A(B BBBI d9 |9(BBB B(A0A8GiIDIABRXIJIABPsIADCH\8A0A(B BBB:%D`4:|L:BBB B(A0A8DP 8A0A(D BBBH v 8C0A(B BBBF d 8F0A(B BBBE d:5BBG B(A0A8D` 8A0A(B BBBB s 8A0C(B BBBA 4;Ѝ,FdT;mLl;8BBD B(A0A8G  8A0A(B BBBH ,;rFAJ REAd; BBB B(A0A8D`t 8A0A(B BBBD \ 8F0A(B BBBE ,T<wBAC mAB<9<St<jBBA A(D@ (A ABBG | (F ABBA R (F ABBC H (C ABBH D,= AAG O(B0](A V CAF R CAB Lt=BBB B(A0A8G!j 8A0A(B BBBK =0C=h=`JAH|>+BBE B(D0A8D` 8A0A(B BBBC R 8C0A(B BBBA R 8F0A(B BBBA D>@BAA GP  AABK ^  AABF <>BBD A(L0t (D ABBN L?BBB B(D0A8J f 8C0A(B BBBG \l?(PBB B(D0A8J8A0A(B BBBG|?ȷ\BBB B(D0A8Dp 8F0A(B BBBC N 8A0A(B BBBH  8K0A(B BBBE ,L@mTAM nAAT |@(@<@BBD A(S0E (D ABBF L@HBBB B(D0A8J 8A0A(B BBBA \BAD qCBe`iFZe=MBE B(D0A8G@ 8D0A(B BBBA F 8A0A(B BBBA LC@t &;M]nĮЮܮ     "1BO^k{ǯ(ԯ)*+, ./)081G2[f-t34'56Ͱٰ%& / @!Q7]8n9}":;#$DZ<>Vk~          %/ 7? ER ]t  ˟(` ``}#*3;WtAFLRZyzdo˟x      k50118NNNNNNNNNNNNgNN K9NNmQnNQB@NNNNNO OO#O'O+O/O3O>OIOMOQOWO]OcOiOoOuO{O OOOOOOOOOOOOvOOOOOOOOOOROOOOOPP PPPP#P*P0PS7P=PCPJPPPWP]PdPkPqPuP{PPPPPPPPSRPP%T7TPPPPPPSPPPPPPPPPPPPQQQ QQQQg$Q Q$Q(Q.Q3Q8Q98=QCQIQOQTQZQaQgQkQoQsQwQ}QQQQTQTm$QQQQQQQQQQQQQQQQQQQRR RR7RRR#R'R-R3R9R>RDRIRORTRZR`R!eRkRpRvR{RRRRRRRRRRRRR-RRRURRRRRRRRRS SPSSS'S4SESRS]ScShSmSsSxS~SSSSSSSSSSSSSSSSSSSST TTTT$T*T1T6TUEUMUTU\UaUfUnUtUp@`0P~ M  `>k`M      8 '   6? HQ Zh v0   _t '/      ' 9? 9G U] em }  GR            ?IBI&  EIHI  KI3P  NIq   J  AJ s  DJGJJJ    MJ      A  PJ:P      SJ   VJOYJ \J _J bJ eJ<hJ kJnJ   qJ     '</  Q    tJ 7  wJ               zJ               ';            }J     S       k          S     W  EI f WINI K cI  I lI  J P  [g I JS ISJ 7;  $ P      O J  HI TI Jq R~   I    i  8J  JR 2JJ  J    SJ    I uI  J I  &J O  _r I  c& < JN ZS  fI     ]I  xI h  I J E S   R -k    I  ՍJw   JOK   JJ        J  k OR $ J  7    I I  Q I< IJI  kJ :    VJ  Ik R    R  6R R  I r    K I `I  I K  IKu  S 5J  mR T  }J P  O IK tJ I  I r  I +Q   G:P   )  DJ =m  I ~I  ';   $R OB    oI   P     +  ' m  I PJ  J I    ;J   2K    I?K   AJ N'        I    /J    MJ  YJ I  I      :P  hJ      ;RK             q    JJ    A         $         O   J P  ,J      Sl           J            J    #J                        \J    i         I              _J         yi                           wJ           nJ    eJ           VK                                    qJ                                                                                   )J@<@3@<f|||||9  9@|||||}08 }@}}}#}-} N{|N{:}N{4}N{9}N{خN{N{ N{@N{N{YN{>}@N{WN{4N{3N{@ N{C}N{K}N{N{N{հN{N{ N{P}@N{N{N{ɰV{бV{ïV{V{zV{W}V{c} V{|@V{j}V{p}V{ܯv}ܯf88*8J8{}8s8} 8}@8}8}8}8_{}_{}h{}h{}h{}h{}q{}q{}w{}w{}w{~    @+A5&?$D+4>* D9?FI OHIWa r;g>p: u=yC~Gۉ     vr ƍˍEэ  O ؍  ߍA   !    8               <     B ')$(%   .)-7,7 D6G,*.   2(17  &#%7   577  8"72~   7:7  [2=4g   (7   A@    C-F/  K"JD!   M7   *5         Q0P3        '                            p1    p v{     ")/ >JVb n z       # ; Q k |  /r   2A I T  a  l  u       #3  G  V fu        '  1  @  U  d   t         !< <|<@<<<<<@<<<<<<<<<<r<Al<`<T<R<@< <<6<4<(<$<"< < L`!h!Lp+!Kx=!Ebxjxxxxxxxxxx y y y ,y ?yOy^ylyyyyyyyy z!z2zDzRz^z oz!z"z#z$z%z&z'z({){*,{+;{-P{.e{/r{0{1{2{3{4{8{9{:{; |< |=/|>C|?O|@c|At|B|C|E|F|G|I|J|K}L}M}N'}R6}SG}T]}Vs}W}X}Y}Z}[}]}'vz~'Y9Ѕ9%f'm't'{''R'T'W'Y'Z\']'^_'`'a'b'e'f'j'k'''((tuvwxyz{|}hq((((5(B(O(\(i(v(Q('('''''''''!'%'-'_'a'b'.g.f N!N"N#N$N%NNNNNN(%O-O1O(5O(6O(8O(go"@ 0 pz`;P`;&L6LFLVLfLvLLLLLLLLLMM&M6MFMVMfMvMMMMMMMMMNN&N6NFNVNfNvNNNNNNNNNOO&O6OFOVOfOvOOOOOOOOOPP&P6PFPVPfPvPPPPPPPPPQQ&Q6QFQVQfQvQQQQQQQQQRR&R6RFRVRfRvRRRRRRRRRSS&S6SFSVSfSvSSSSSSSSSTT&T6TFTVTfTvTTTTTTTTTUU&U6UFUVUfUvUUUUUUUUUVV&V6VFVVVfVvVVVVVVVVVWW&W6WFWVWfWvWWWWWWWWWXX&X6XFXVXfXvXXXXXXXXXYY&Y6YFYVYfYvYYYYYYYYYZZ&Z6ZFZVZfZvZZZZZZZZZ[[&[6[F[V[f[v[[[[[[[[[\\&\6\F\V\f\v\\\\\\\\\]]&]6]F]V]f]v]]]]]]]]]^^&^6^F^V^f^v^^^^^^^^^__&_6_F_V_f_v_________``&`6`F`V`f`v`````````aa&a6aFaVafavaaaaaaaaabb&b6bFbVbfbvbbbbbbbbbcc&c6cFcVcfcvcccccccccdd&d6dFdVdfdvdddddddddee&e6eFeVefeveeeeeeeeeff&f6fFfVfffvfffffffffgg&g6gFgVgfgvggggggg;ࡱW .GzVBj/&IA42[vrC89pEhqO bD#u<~>^wJa]"KoN;LPg*}tT+-,0nkf5%!dMRc?{x)(sY3mUS|:_eFX1ilZH'\=$y7`Q 6{ 20!)[83=X:5e9\VsfNEkbYx^}Jmq<`>SB'Hru17MR"TjGd- .L]~loytC&v%$+(#A4 *D?w;UiacPgQIOFh|6pnz/_KZ,Wn -uR`q^I\b})6 |zkc3+hQfv1dTC<:>~E,*t'7DyY/o&rj9{?8wgSG4x]0#Z[lHUpi.L!$NP Vs5aKX;W"mM%(FJ2A=_OBe{D.2KA2~gQGp"%(P ` ` P p   T5        P ! Е + Е /  9    (?J   Q0 @&@    p  P  0   XP b` kp 7B777'7777777~8888%8.8*818*?>8G8P8`8s8888888u89w9;; <88889 9;B<9$9,969<9L9_9n9~99999999999: :::%:.:6:B:J:T:\:d:m:~:::::::::::::; ;;#;*;/;6;:;B;M;X;^;h;p;z;;;;;;;;;;;<<<#<*<2<;<J<R<\<<a<l<r<w<fhfffqffƭff\fffgff g gfg.g ;gBg: IgMg Tgc&Zg^gL"dgjgYSJ"rg"xg go+qgS!p"gg"ggY%g gg`&g"gU!!tg!g$gg"gagRg;kqo/g%g!g"gYq"g ho&h3Dq#" h #hIj<"h  h$hT%*h1h_%7h=hS%ChGh##Nh"Thi%R`"s "vn*ZhN"_h4"Sfh&nmh#shjzhO"h #h"o\hhk%h"h7!hhJw"~*ii#i,!iX!ki1i!i ih0i i ii% i #jjj|j"""jf" j(k%j)j-j3j%m:9j">jEj0 LjRjR"i&d"Xj%^j"dj~"Hh##jj%!n*pjtj{jjj_j="jj"jj"j%jjjjll"j%jjjq" je%@qv"jjj> jZjjk k?kH"k%k$k;)k0k"k7k>k1Iz"Ek5"Lk #Sk%$}*Zk<q>^kbkikok $("vkzk"kk!k k6'kDk4%k%kkkn4kk"krB&k#kk"#k! k,q)"kkk[k!k"l)l+!11! ll\%ll"l3 $lx)l1l5l;l@lElIl"Ll^Rl&!Vl[lK_ldl5 klP"qlwl`%}lb%l"ll!l lllOtBl@"l,%h%ll"lWlA "lllll!lR%t%k"lV!llmm}"& mm 'mm,#m)m/m#$5mj":m"!@m#Gm m<KmU%QmXm"_mlem"oHjm%om "Oh\"um#|mmg%mc%mY!m!t-m5!m hmmm"m_mm2&nma"lmW%mVm"m"m*hm)mmnJn" n)n%n%n"%n*n<%0nZ!i%7n>n!Cnl%InT"Pn.Un"\n!bn=q?*hnon'tn|"zn*n n nSnn n*nnnn%n^%gn"n"n2nnAsn"nn"n"na%n<"nXnn os ooqVJ "ooEoH"hG#o*oW!1os"6oRr DrIrt!Nr"Ur\r%br#+"ir%ork"rr xr Yp"}rrrS"r*rrr"r%m7'"rrW"r=pMrFrP%rr+rrT!r"rr!"s'rrrs`rsB&e"s#s ssj"s"s")s.s%4s"o;s@s`GsLsSs"Ys"_s"fqfs"ms@tsyssf&s6!s*sss's"ssS"s*s&s2 s)ss)#sj%s"s"sss^!s?t8=t  t*_gE"t"t"t t't.t"2t !9t$eo> = > = > = 7z'YZ7zXZ? ܊O_ 0/W bWz*@~OP_`. /30;_ xll/T}ll/TAh @ !+4>JU`mw$1CR]hs~"3AO\hzcba` _ A \ [ A A  WWWWWWWV U A A A A     F @  @@@@ F G JI HF [[ddddddddddddddddddddddddddddddddddddddddddd>ddd?456789:;<=dddcddd dddddd !"#$%&'()*+,-./0123dddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddpPC0CCCC>_<5L #tN&%ڔuΘD3ŋ~#7]$k9=Jq?@\34ʌ:"2qk j@P^`6b* Ʋ|lKv/S; %WhKT\#1ܱ39m6g);4~8<ѪESӨ,Y@2!BRUJn:opF]eh؏BLj-M2pUq)6r [fM+?=.(w}25 N._Q\]#k$nU,5T&?ѮD> lD f:}"/9!IRІ_ ȶžJ |\Ǝ9x{7$GDAsWC[ʌ~ Kz+uEXy*qӁ?DNXi`^w " Rw^=n }lsؒ89b&0̄)KWba^>2'z!Szɕ+d(")kR_ْg3*}9n;ҍ=Z%ӮXgvz暗Ϸ[[݋8rDr51{QW} *լ)]"PWIY}# U7z*I찝3i /SF2W>ڹ/ڽ˘uF Kcd_a$0hXt̠ gOFc&(Jin`ę[;֊K6T 2 x;M׌8C=ZrH D5_/UF<cpaEF~C(⢧!~CCpf*c@lߠ/ MS1daM%DժBS {xr{2J)pGp_Vt>+Ĩ'^ǝV L)EpcҪTt%d%g}RTTVI`,@slk&a Hِ!| `L•ƕ}7{ʕЕӕݕ          X!%)-15r9=ADHKORו V!g"v#$%&'()Ӗ*ܖ+m,k--(q..k//012jo34 5678 9'i:%;/<>=J>\?j@x[\\]^Ɨ^ؗ__`{{|%}1}o~EIȘ  /my O@ L 7h U[ vș |( ו    R^|ɚԚ8C_j   țӛ  H/p: GCC: (GNU) 5.5.0GCC: (GNU) 5.3.0.shstrtab.hash.dynsym.dynstr.gnu.version.gnu.version_d.gnu.version_r.rela.dyn.rela.plt.init.plt.got.text.fini.rodata.eh_frame_hdr.eh_frame.ctors.dtors.jcr.data.rel.ro.dynamic.got.plt.data.bss.comment  HH03xExE!!o>g>gD.okkT=okkLllXVBH"H")`KK$[LLfggHo0h0h~u{ 1dY;YZ;ZZ;Z Z; Z@ `;`j;; ;x <x 0x"usr/lib64/pkgconfig/0040755000000000000000000000000013365330317013264 5ustar rootrootusr/lib64/pkgconfig/libclamav.pc0100644000000000000000000000034113365330317015535 0ustar rootrootprefix=/usr exec_prefix=${prefix} libdir=/usr/lib64 includedir=${prefix}/include Name: libclamav Description: A GPL virus scanner Version: 0.100.2 Libs: -L${libdir} -lclamav Libs.private: -lz -lbz2 Cflags: -I${includedir} usr/lib64/pkgconfig/libclammspack.pc0100644000000000000000000000035013365330314016402 0ustar rootrootprefix=/usr exec_prefix=${prefix} libdir=/usr/lib64 includedir=${prefix}/include Name: libmspack Description: Compressors and decompressors for Microsoft formats Version: 0.5alpha Libs: -L${libdir} -lmspack Cflags: -I${includedir} usr/lib64/libclamav.la0100755000000000000000000000220213365330316013560 0ustar rootroot# libclamav.la - a libtool library file # Generated by libtool (GNU libtool) 2.4.6 # # Please DO NOT delete this file! # It is necessary for linking the library. # The name that we can dlopen(3). dlname='libclamav.so.7' # Names of this library. library_names='libclamav.so.7.1.1 libclamav.so.7 libclamav.so' # The name of the static archive. old_library='' # Linker flags that cannot go in dependency_libs. inherited_linker_flags=' -pthread' # Libraries that this one depends upon. dependency_libs=' /usr/lib64/libxml2.la /usr/lib64/liblzma.la -L/usr/lib64 -lbz2 /usr/lib64/libltdl.la -ldl -lssl -lcrypto -lz /usr/lib64/libjson-c.la /usr/lib64/libpcre.la -lpthread -lm /usr/lib64/libclammspack.la' # Names of additional weak libraries provided by this library weak_library_names='' # Version information for libclamav. current=8 age=1 revision=1 # Is this an already installed library? installed=yes # Should we warn about portability when linking against -modules? shouldnotlink=no # Files to dlopen/dlpreopen dlopen=' /usr/lib64/libclamunrar_iface.la' dlpreopen='' # Directory that this library needs to be installed in: libdir='/usr/lib64' usr/lib64/libclamunrar.so.7.1.10100755000000000000000000014567013365330320015005 0ustar rootrootELF>0 @@8@  (  PtdQtdRtd         t#i|o `-M  pet BU ,  e*F"__gmon_start___ITM_deregisterTMCloneTable_ITM_registerTMCloneTable__cxa_finalize_Jv_RegisterClasseswritereadmemmovememsetlseek64rar_init_filtersmemcpyrar_unpackrarvm_freemallocppm_constructorppm_destructorstderrfprintfrealloclibc.so.6libclamunrar.so.7CLAMAV_PRIVATE_UNRARGLIBC_2.14GLIBC_2.2.57c 2G'ui 2  п ؿ       ( 0 8 @  H  P  X ` h p HH HtaH5 % @% h% h% h% h% h% h% h%z hp%r h`%j h P%b h @%Z h 0% f%¶ fH=ٺ Hٺ UH)HHvH~ Ht ]fD]@f.H= H5 UH)HHHH?HHtHI Ht ]f]@f.=I uzH= UHATSt H= BH H H L% H)HHH9s!fDHH AH H9r[A\]͹ Ðf.H= H?u fDHq HtUH]AWAVAUATAUSMljH;1rUI͉AMML$C;l s1A9tCD%)ŹA)H[]A\A]A^A_ÉD1f.HH0 ЉGH9uuH~H1HVHHdžHH)H  H=ufDSHgL@ H y HLA@HH@ɋArAuNLAL@fDLLA@HH@ɋArAtH@A@@[f.AUATUSHHŋ@=u=]=5= H ӵ L H@ub@J@~@uǃ@L@L H J H[@t @@)ʉ@W@ @HH,J @@HHH@ArAvDLAL@LL%@HHArAwH@@@H[]A\A]Dǃ@ѫ@1HHm3H%@M?HISL, H e HHA( HA L)@ @ƒD)?ƒ%?uԉ @fL9 H r H#fDL1 H j HfDLI H Hsǃ@ǃ@]DAWAVAUATUSHH@LJ@=@HD@@y?L=Y1Āt Dn‰tAăA!Hm@H)Љ@p@(vBL H ı H@L<)ʉ@A@DpHEAJAuOHAH$H@HD$@H4$H|$A@DpHEAJAtHH@A@D@AzHA ADE䋃@tYuE@A9tHA9։@r?@9LJ@ѯ@@A9sŃUAF=w@)A?ǃ@@uHD@ @D@@H)@tC @f.щЃD)?? uӉ @H[]A\A]A^A_fDǃ@ _fL H HsfDL H HKfDLٯ H  H#AăA!@L! H Z H߉$@$AăA!fDH)񉋨@1@A1vf.AWAVAUATAUSHDHH Eǃ@ǃ@Hǃ@ǃ@ǃ@ǃ@ǃ@5ǃ@ ǃ@ǃ@ǃ@ǃ@ǃ@ǃ@ǃ@H1[]A\A]A^A_Dǃ@ǃ@Hǃ@ǃ@ǃ@,t@ @H@HA@H@ǃ@H @@%?W;@ @@)? w 9tH@@@tPH߉@@9@vsH@HcHZH[]A\A]A^A_fD@@W҉@teH߉@@9@vH@Hމ t @HH@@ǃ@H߉@. @@@$w5 5  ֩ D҅ALĩ L @E1AIAD1AIׅuH AA  Aǃ@@H߃ D)D@X L H * HPu A u@H@@ACD;@HD@H@D@ @r@H)DžHH@ @уD)? у?@ u҉ @Hǃ@f ڧ D҅Ll~H=ŧ E1A7IHE1AADхuH AE@Hǃ@D)Љ@ L H Ĩ H߉HH@t)@ǃA@ȃA@@@AUAHȉ@ @@@H@H)Ћ @H@fDA)? у?A@ uщ @6fDHPǃ@@HA1щىHցuHALA1HAHǃAHHǃA)AHAHLHHǃAHHǃAH)HH׉HǃAHHǃA)AHH@ǃ @f @H@@D@HH)DžHH@r @@уD)? у?@ u҉ @oH߉D$ D$ =0 @H@D@HH)DžHH@r @fуD)? у?@ u HuL H Ǧ HHDxAIHAH@DAD @D@AuH)EHH@f @уD)? у?@ u҉ @ǃ@E1E1@D @D)с?wlA?wcABAȃ @FEЍAFt}AFD9FuD։ @D1t=ȃ%?DAA?D9uD @fATUHcSH@H@I1UH@@HtH@H9~)HLH9})Hc;HL~ HH@[]A\D9r)H7{USӉHH7H?THHH[]=f.USHHHH@F\HF@1Hp$5THEHc@1Hp(THH@H[]zXf.AWAVIAUATUSH8 @@։D$)Ɓ?H@zH1HD$(H@HD$AE HI9@;Ix@L L,MA} uEeD+T$?9zD$AmA9t'DLLL$sA @LL$D)?9E<,LL$A?E9D|$0E'L|$(H|$?D)D1LVL$H|$LVLL$I}@~IuLLL$>LL$Ix@AMpHLL$Im8J< L$$4tIx@LL$L$$J I;@Ix@MyJT HD;";Jr t5xIx@IJ:Ht|D;"uwJD9uoR uhH|$H1 VIx@N,:I}@L~IuLXIx@J<:Im8EmpH\sIx@J:I;@pHDLBA @+t$?I9@A @t$LA @A@H8[]A\A]A^A_@Ix@J HtB tB HII9@wE@H8[]A\A]A^A_H3DHT$(H|$1TLL$A@@@DHc@HDVHcHcL ȹ+@D7 @f.AVAUATUS@Hc@AA)=@HA~HnHc@D)ʃ9GH@)@‰@J;@@}~p)"[]A\A]A^ÐEHnMcLHtHǃ@D@LDM@@|DHcHHs/HzEm1fT a@HUHEHD HH)HHH0H1H HH9rHnE14@[1]A\A]A^ED Hc>fHc@SH=P@D[fD¸tHc@Df.S@H @9r$H) @@[Hځ? @HHl @@[@f.AUAT1USIHcHHIHHHHH1eEAD$LILHH9uHct$$C1CDD$@E111ALL$DL]@Ic4|DDDHHHHHIODǃt|HA<Hu1E~3f.ATtHcL@qt@HA9D#HĈ[]A\A]1/Df.AWAVIAUATUSHH%;E$ss;E;E ;EEAA ;EEA;EAL?B+\DB\D;]HC؋H[]A\A]A^A_fD;E4s3;E,;E(EAA;E(EA ;E( AfD;E<;E8EAA;E8EA ;E8AY;Es[;EEAA ;EEA;EA-@;EEAA;EEA;EAf;E EAA ;E EA;E Af;E0EAA;E0EA ;E0 AfAAA}@AWAVAUATUSH1H|$@;@|$H@HރdH|Ā@Dž @Dž$@Dž(@aH1Ll$fDDdHHthH HAAuH HDEAD$fDHADtHuL @H|$Lt$/L|$.1LH|$021H|$Hf.@;@|$HtKLHO,@D0HHv@@9@Dž@l1H[]A\A]A^A_ÃHh HD` AD$H HHA4A4iHuht{v HD` BHCAt$H@HH9HAH=ufD# HD`Df. HD`DDHft$H`@H@Dž @H9H\$H@+HoH@H+<WHd@Hg?H,@Hx'HT$0H4@H,@HHH)H,@HH)H@HH4@HDž,@HDž@H)@1Hg6fDSHH@HtHǃ@Hh@ǃ@ǃ@gHx@[gAWAVAUATIUSHXHT$0L$8D$<D$@@Ip@AI9HD$bA;@UL;|$A@#Ih@N4AFf1I1I@Ix@HH)Hǃ@HHމ[]AWAVIAUATUSH5`HD$0D$1H$D$2D$3D$4D$5D$6D$7D$8D$9 D$: D$;D$<D$=D$>D$?D$@ D$A(D$B0D$C8D$D@D$EPD$F`D$GpD$HD$IH1D$JD$KD$PD$QD$RD$SD$TD$UD$VD$WD$XD$YD$ZD$[D$\D$]D$^D$_D$`D$aD$bD$cD$dD$eD$fD$gD$hD$iD$jD$kD$pD$qD$rD$sD$tD$uD$vD$wD$xD$yD$zD${D$|D$}D$~D$Ƅ$Ƅ$Ƅ$Ƅ$Ƅ$ Ƅ$ Ƅ$ Ƅ$ Ƅ$ Ƅ$ Ƅ$ Ƅ$ Ƅ$ Ƅ$ Ƅ$Ƅ$Ƅ$Ƅ$Ƅ$Ƅ$Ƅ$Ƅ$Ƅ$Ƅ$Ƅ$Ƅ$Ƅ$Ƅ$Ƅ$Ƅ$Ƅ$Ƅ$Ƅ$Ƅ$Ƅ$Ƅ$Ƅ$Ƅ$Ƅ$Ƅ$Ƅ$Ƅ$Ƅ$Ƅ$D$ D$!D$"D$#D$$ D$%@D$&D$'D$(D$)D$*D$+D$,D$-D$.D$/[LLt A@uL6I,@A @M@HD$I@H$Id@HD$DA@%?A9@A @~A@)?w 9tLA @sLL=AA @QA @A{L1HĨ[]A\A]A^A_@=e-HDl0\PAH4$L;HcDtpEt3 AA(@hA$@A(@vAEADFA@A@A@A@A@A@A@A@E @DLA @ffDL~A @df.I@LH ,AA;`@A @PA @ED==Z==-H\ Dl(E5A@A@ALJ @LA@A@A@A@A@A@A @@LL)AD-HcȅA@t$I @@tHcf.Ht$A@LHDl0DtPAELyDLD)AA@LH[*,3LH*pL`A @ @A @AA @DLDLD)@LĀLX1@A@LLHLAʼnD$AA AAA}HcVHIAE1ۉD$A@A9@|L#u 9\$rLLAHA9t$DLL>L/LCALJ@LnuL9DLD)AE1@LH(AtDAAA@LAvLD)AVLp A @fA@LA @DLHt$LA$@H$ALJ @LLDhLH&D$D$HcTHIgE1f.CD5ID9t$LH&uL%LeAL5A}Hc)THIE7ALJ(@A$@hLH&D$Dt$A~HcSHIE&L$t$LLrLcLH%AGLH%1ADD$nfAUATUSHt'~=t uSHHʉ[]A\A]HHʉ[]A\A]@uHʉH[]A\A]HʉỈʼn?t H[]A\A]M$@L0LuLLf.D@H@@D @H)@@ @D)с?w~A?wuȃDDDABDA @FEBAFvwfAFD9FuD։ @Dt=ȃ%?DAA?D9uD @fAWAVAAUATUSHHH@;@ HC%@@HAv@t> C;@@ Dž@H@AAAL|$MoLfDHH HCL9uL @LE1LrH|$01EH|$H)fDIcA @D 0E9@;@HDnLHK~HB HX E9~1AGIcD0A9A@ƅ@uE9j@@9@@\@1Ll$L@~,LL@IIĈ9@HT$0H@H@HH@Ht$H)HH)H@HHH[]A\A]A^A_@ HXHE9DEtAGHL0IcLjL0AE9u1iH@HDž@HDž@H)@1HH\$H@*HH@H*0H,@HZt f.H,@1dž@dž@Hdž@dž@)Hdž$@Hdž@@H @HHH@Hdž@Hdž@H)@HHdž@Hdž@)֍$@HHÐAWAVAUATAUSHH5bOHXD$ D$!H$D$"D$#D$$D$%D$&D$'D$(D$) D$* D$+D$,D$-D$.D$/D$0 D$1(D$20D$38D$4@D$5PD$6`D$7pD$8D$9HHDD$:D$;D$@D$AD$BD$CD$DD$ED$FD$GD$HD$ID$JD$KD$LD$MD$ND$OD$PD$QD$RD$SD$TD$UD$VD$WD$XD$YD$ZD$[D$`D$aD$bD$cD$dD$eD$fD$gD$hD$iD$jD$kD$lD$mD$nD$oD$pD$qD$rD$sD$t D$u D$v D$w D$x D$y D$z D${ D$| D$} D$~D$Ƅ$Ƅ$Ƅ$Ƅ$Ƅ$Ƅ$Ƅ$Ƅ$Ƅ$Ƅ$Ƅ$Ƅ$Ƅ$Ƅ$Ƅ$Ƅ$D$D$D$D$D$ D$@D$D$D$D$D$D$D$D$D$D$}Hމ#EbH@H,@L@L@L-?MH4$HH@Hw @@%?W;@ @Y@)? w 9tH @Hc@HHiH@=vLc@ @Mk\WLƉ @J @@D|@x@D@<@@@H@+8@<@H@8@D@$@B D(@D<@DD,@D@@Aˋ0@D@Aˋ4@AD)AAEA1E)DL@AD+8@EAE1E)DP@D8@AEAE1E)DT@AD+<@EAE1E)DX@D<@AEAE1E)D\@AD+@@EAE1E)D`@D@@AEAE1E)Dd@AD+D@EAE1E)Dh@DD@AEAE1E)Dl@AE)EAE1E)Dp@DAAD1D)t@*|@H@@x@|@usJ P@DL@E1ǂL@fDE9sAEʃH uA w*KcDLIk\H؋4@4@D;;@@4H@HH@DLH=> @J @fDHމ @= ~q=)2-HD| t@ALHQ/1HX[]A\A]A^A_@HމftH@fDt==-HTD|E-HH@ǃ@@;@}7@Hc@HHiH@s=tHfDHt`WRvAGADFDHBH@fDHމ6Ik\H؋0@0@Ik\H؋0@0@Ik\H؋,@{,@mIk\H؋$@W$@IIk\H؋,@3,@%Ik\H؋4@4@Ik\H؋$@$@Ik\H؋(@(@Ik\H؋(@(@DH߉t$Tt$H)A@H)ƉH4$@T$LHT$D| t@AAH@H= Hމ*}H߉t$ T$t$ T$H)‰T$VT$vH߉T$aT$DD)H‰T$"T$@ @HH@)H߉t$ t$ H)AT$AGADFDHG(H;G0tHt$1Ht$Ht$HHD@HufLLLD@HHpHAfHpHD$fHLD@HMuHHHLuH9uDH6fDBD4HJLLH LBLAJfHfHɍIHfztHH9uHD$H9fDHPHH HHHHJDHAEHhADLDRI I fDHH HHhHL9uAAGLAAHHGHWpD9t*nA)ɍIMcJ HLI8LLHA8HcHHP@IL@@HD$H9HHHLH1@IpfDATUSHG8AL9tuHLHuR?v [1]A\غ\RHUHHE tHDLe8HE[]A\DH HE8蟱D[]A\@f.AUATUSHHH;N^t6DI @LAHH ALA DAHDI AfDAH9NuӀA E1IFPfVA Dʋ< A)ADA fFCHDLAI A@ A)DA@ fFAh A:hvFM(E`L@:h&HPH HP PfPHVH9uL*Db@j M9uCHDHAx 1ҐH x tFA)ffFDʃHIA)fDN9CLnHHGBHIDH9IHHH1RHHHcL'HIHIULHHEI$H[]A\A]HF3HFHNDAA LfA)ASHcHWHLL HHVHLVDFFH[]A\A]HcHcAtA|)@QHcHITLI4|9t,IHH8Hv)HcHЉʃHcITIHHHLLUSHFD\D)f=DBD^IcL HLTHI)X9A9NMAA9EHJXHMAAK1)…fA,4 HFDLMHHE1H H HD8L tH HAEHJt HAf( A )1ҋ$ + 4 1A( A19veA9L$oD, 0 F+\L HD$f.L@APHL9DL ufA F\H[]fAH 9|HLA@ 9~0 A@ ), ACAku@fA#ACACLA@ HfFA@ |GH LMD H[]fDLXLJ4 DBElf.@HcLAJHuX&ufHcHWwpHH+7@ HH9H)HGHcHWH)HGDHHcJOpwp)֍RNHcHcLOHNOAp9t)J LI8L HQ8EnC @D)HcHʉHcHOH Hq@H2HQ@1ff.SHcHHwHHC@HtHHS@H[fHcHG(WpRHcHH;W0HW(vfIHG(tHL[}Dt$ fHC@t$ Hu@HIƇL HN HƇM HW ƇV LT H_ DML IBH)L IO HAƁL AƁM AƁN f. uFHL9uLDI HIǁL Iǁ ) 1HHDHHI ID )L HAƁZHG0H;G(tHHG0DHG@HtHHW@ft1HfzHG@Ht HHW@H1Hf.AWAVAUATUSHLH_M Ll$HHMHI9M9sA,$fH9`s0HC@:hHp @:hH H9vD1H[]A\A]A^A_@HLl$LD$M}HtHhfxHPYHPAH8JGH :JuHI9>IHIOHHIfxHPuP C)4)9rz9EAADsH`IHD$0fM9HfPL`H@hDpIH|$IMHufDD1DDADpfHIHPf.USHHT 1HHGHLJHA)L`L HHHǃHǃH)H*HfDfHLHL`HHH?HHH)kT)@MLAHxLhLffDкfH@LAHfDf f fffffH=u111f fHcK9fCHH=u׃@ LN@ ЉH tHHCHCaH@ L߉< HCfPHCfHHkUHHEHH ƃMM1҉D 1fDHKHITHKHID HKHIHH u1A@HcDUL 4<E1HfDDAH@A)DHcЃH:9ftS uAIAt ADuHZ HCfPH@H9uH@fuH[]H1[]fHLJHGHG@Hu@HHLJH馢fDSHHtHHǃ{H`JƃLMǃ@ Hu[H[Df.AWAVIAUATAUSHHDHH˾Aă D$KHD$ A@DDž$ Dž Dž( E1LDjD ƒA׉$ uߋD$AA\$CDdM؃t$ H`8u,HfD1H[]A\A]A^A_ƅLM@ Ht/Ht#1H}H[]A\A]A^A_f.HtHHDž迠zf.LDeA@D$ LDLDHHDžD$eD$ff.LOH`I9fHpI9VAWAVAUATIUSHHXfAyIQH9H9vAy( 1D $ D)1҉4 MAAA‰( A92AH 9C 0 L9MMD AA@ fAA|D D( 10 1Lǃ, )D AM( tU %( D$ L»( AD 艃$ (  1vv< HsH`@H;pw!V;\u0< H6H9HswָHX[]A\A]A^A_f.Ht֋( , 0 L) M ( CA@D$0ANj< ML;`LSLS ( Sf.%( D$ Lr( AD 艃$ (  1vvD$0fHHƃMMAqHtMpf.L9IIp Dv D9}䉋0 F H3), F fAAF :F#H~HVH>~HNFVf~LF|D( , D 0 DKLHH@L NMI AQD IHcL MMAIL D 4H( <Hc$ HHHc( HD)1LsAL 9?G , )H,fAL f ǃ0 @?ǃ\LM08 AAL Ⱥ@)ƃMMHD ( BLMMމL , NMAC@L AAH\HHI)MFfI ACM9@L uD0 E1LHED( , D 0 LDUIAHAAAAǃ, AL W 0 f)1fAL ƃMM1D D D( LEp AHCHHfx HHD:yu DHHQ D:zur @:rr#LBH:LDBHzDz@rfDBH@΃r@r f@< EH`HHH`D8H`H;xHD$ML9< LkHC1LT$I9H)`PDHC<6|$H`H|$(D)D)L9T$,l$Ld$ HLT$8DEVf.99ƒfAED\KH|$AHAH8XDX fEuMmL;mEuAM?AIMA}BA9B@9lj!C46A9@@BfAEЍrT$t$H@3<@3<@3<@3~3<@3<@3<@3<@3)‰к)9Ǻr=6@{KAJ(DA<A9w!ʉ AR(SH8A9fH8AfD+2t9 AJ(H8A )Ήt9 AR(H8Af.DCE: 1f.H8A^fDAB$I H8AƒAB$AR(.fDAB$AJ(H8IAAB$% AB$I:IR$p fH J9uH8Af.D{E6 DsE8H8AH8A~fDDKEH8ASH8AACϸ)׉9ω% AB(CH8AC>Ⱥ9ȉ AR(SkH8AKθ)1҉9% DDCE!sDsE{ fD{ER!Љ¹DAR(DKEHCE*f.CAB(H8AAB(H8ApAB(H8AXEB$HT$hA@A$:I2HD9<uAj$ H8A f.C؅tDAR(S|fCljCljDэH AB(CtP@>H8A^fDC@DэH AB(Cu>H8ASH8AfDAR$ I Ћ;D$4l AEqH HAR$H)If.AB$IH8A%AB$mDAB$IH8AAB$% CAB(H8A(AB(H8AAB(uH8AAB(UH8AAJ(4DAz(H8AIUIt$ H~fHHvH[fDM$M1rH8AzZ%S:@ !`H8A} DsEH8AY 1AJ(DAJ(>cAz19HA@MNAuAJEABPBAr 3DvM:H\$8Ld$(DD\$@D$LT$HLl$XAxZHUHDEtGE1EA*D\$D$AsDLmD$A)D$uID9t$DbAABD@AjI Er A1AA9M9HqB@A8u0f.HVxD8HA9uABD$`ABQƉD$dI HHD$XHDŽ$Ld$xHD$pH$D$L$L$fDHD$PHH@H@@$9D$d%L|$XE1AD$D$(E1D$ E1E1D$@D$H1D$81E11D@t$HDD$8EA)DI+D$XDELd$p4ΉD$DDD$@EDEG@DD)EC4AA)̉EAA1A)A)D$1)B 7<A$AD1D)Dω$D)AAD1D)|$ $A|AAD1D)D߉$)AAD1D)|$($1)D$D$$ukDŽ$HD$P1fHD9sAȃ@Huw+HH HcHL$HL$HDT$`D9T$d,$$DD$D$D$D$ $D$($D$L$H)L$H둋L$@L$@yL$@)L$@aL$8L$8IL$8)L$81ErI:EzEJ AFD =qAGA9dAZD1Ll$HLHD$Ld$H\$ D\$(ADL$8LT$@D1ҐA9lj:Hу*OA9A 0wAAuDL$8ALd$H\$ D\$(LT$@Ll$HE9AAADAAAAAE9wEBIAR A@={D A1E1f.E9v%D1@I:@*4DA9@4wAAE9w)L|$X$$9D$`Ld$xH$D$L$L$MI M AMLΉL$ wL$ )غD\$σDG҉ȉ׃L@"8 D9@8uD\$HΉЋVDxMсxRHNP)II #Ld$(H\$8D\$@LT$HLl$XxV)VMM1HH+L$LDYA )AA)EAE1E)A)E)EAE1E)AAD1D)E9 A9jA9DO\AWAVMAUATLcUSIպHHxAFH|$H>INF L{AAT$IE1ITfD2HH9uHpAF@A8]LaIcF@1ɍPAV@HHH)IHP@(@HPHP,HP AF@1҅WfHx t1AF@H89~:HIHxuHx HpHpufDHp,H8Hp AF@9ǐEuHx[]A\A]A^A_M~A9LιLH- Lq X7@uK~҃+9~HcH<HH)A<H8uɃ~҃)f.'wAC*@t9HcL$IIM)L%GMGA8A@ubLBN$LHL)AA)LMN$IM)O$&f.DGA8VH8A@uI9u߃>KcLDDLD$5D$hWD$D$9D$ ~jm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-FFF))EE FFFF))))))FFFE @ffUNRAR: rar_malloc(): Can't allocate memory (%llu bytes). UNRAR: rar_realloc2(): Can't allocate memory (%llu bytes). ;Bg8i`jkkHo(xsx|}(~(~X~XxȂhh8،(ؕ@hxX0   ؾ X@ X  8    8 X Hx h ` Xx X (0XPp8XHzRx $eFJ w?;*3$"LDgBBH B(D0A8I@J 8C0C(B BBBA gz8hA<hkBBA A(G0 (A ABBF L l%BBB B(A0A8GP 8A0A(B BBBG d\ol BBB B(D0A8OP 8C0A(B BBBF 2 8F0A(B BBBG y,ykBAD `AB, ySYAW OMA$<(zVAAJ yKAdd`zhBBE B(A0A8Dp 8A0A(B BBBE z 8A0A(B BBBD h}p}BL}BBB A(A0 (D BBBB  (C BBBA L(AHY G lXrAo H y<ABBC A(U (A ABBA LȀBBE B(A0A8G@s 8A0A(B BBBG LX:BBG B(A0A8L 8A0A(B BBBA lHMAGdxBBB B(D0A8Fp 8F0A(B BBBF f 8A0A(B BBBH ,AAI FAL$7 BBE B(F0A8W8 8A0A(B BBBE ltBBC A(D0U (F ABBL D (F ABBI N (A ABBL Y (A ABBA L؛BBE B(A0A8J  8A0A(B BBBE L8Ld+ BBG B(D0A8S 8A0A(B BBBE Ъ DȬBAD ` CBD w ABF YFBL (BBA A(D0 (A ABBI ~ (A ABBA <dfAAG AAJ  FAG 0,(AJ a AC z DJ -vJ` A FL$BBB B(A0A8G 8A0A(B BBBE 4tAAR b FAA DCA *8aAS D DdBBE B(D0A8PP 8A0A(B BBBH s 8A0A(B BBBK ld fBB B(D0A8I 8A0A(B BBBK F [   AZ< #QP\ t MT AAG0g CAD Y AAM h CAD ` CAD WCA\ <BBD A(P0u (D ABBI x (A ABBB \ (A ABBF D 2L\ BBF B(D0A8R  8C0A(B BBBG L BBE B(D0A8O/ 8A0A(B BBBH   (F`4 wAuT `l XJAu J I kAi BFl, ]FAI IAA, 8KAEF \ DAA 4, XjFAA _ ABF G ABF   ؖ@ >   X ooo(ooo fv  $5u$,<LPP !!!!! "$@  GCC: (GNU) 5.5.0.shstrtab.hash.dynsym.dynstr.gnu.version.gnu.version_d.gnu.version_r.rela.dyn.rela.plt.init.plt.got.text.fini.rodata.eh_frame_hdr.eh_frame.ctors.dtors.jcr.dynamic.got.plt.data.bss.comment  @@@>!o0.o8=o((0LXXVB `  $[PPf o0 0 uؖؖ{ d     jп п0 x   0 usr/lib64/libclamunrar.la0100755000000000000000000000166213365330314014310 0ustar rootroot# libclamunrar.la - a libtool library file # Generated by libtool (GNU libtool) 2.4.6 # # Please DO NOT delete this file! # It is necessary for linking the library. # The name that we can dlopen(3). dlname='libclamunrar.so.7' # Names of this library. library_names='libclamunrar.so.7.1.1 libclamunrar.so.7 libclamunrar.so' # The name of the static archive. old_library='' # Linker flags that cannot go in dependency_libs. inherited_linker_flags='' # Libraries that this one depends upon. dependency_libs=' -L/usr/lib64' # Names of additional weak libraries provided by this library weak_library_names='' # Version information for libclamunrar. current=8 age=1 revision=1 # Is this an already installed library? installed=yes # Should we warn about portability when linking against -modules? shouldnotlink=no # Files to dlopen/dlpreopen dlopen='' dlpreopen='' # Directory that this library needs to be installed in: libdir='/usr/lib64' usr/lib64/libclamunrar_iface.so.7.1.10100755000000000000000000002412013365330320016116 0ustar rootrootELF>@ @!@8@      Ptd<<QtdRtd          iot PN  t @ J #U , F"__gmon_start___ITM_deregisterTMCloneTable_ITM_registerTMCloneTable__cxa_finalize_Jv_RegisterClasseswritereadlibclamunrar_iface_LTX_unrar_openmemcmpmalloclseek64ppm_destructorrar_init_filtersrarvm_freesnprintfmkdir__strdupcallocppm_constructoropen64rar_unpacklibclamunrar_iface_LTX_unrar_extract_next_preparelibclamunrar_iface_LTX_unrar_extract_nextlibclamunrar_iface_LTX_unrar_closelibclamunrar.so.7libc.so.6libclamunrar_iface.so.7CLAMAV_PRIVATECLAMAV_PRIVATE_UNRARGLIBC_2.2.5GAE 2Gui          ( 0 8 @ H  P  X  `  h  p x     HH Ht;f H5 % @% h% h% h% h% h% h% h% hp% h`% h P% h @% h 0% h % h % h%z h%r h% f% fH=a Ha UH)HHvHv Ht ]fD]@f.H=! H5 UH)HHHH?HHtHA Ht ]f]@f.= uzH= UHATSt H= BH H H L% H)HHH9s!fDHH} AHr H9r[A\]U Ðf.H= H?u fDHi HtUH]AWAVA AUATAUSH T$ t$Ld$ D|$ALLvL9uA)tM DLFD9tȋD$ )H []A\A]A^A_D$ ))fDD$ 1AWAVAUATUSH8HtfLt$)HID$0RLD$1aD$2rD$3!D$4D$5D$6D$7UD$8nD$9iD$:qD$;uD$HLT$H|$LT$LT$AUATIUSHDg@_f.C C$sHk0HfHs8H9{t1DH;C8H1DHHt{@IHHti HDH uKC^Hs DHu'CLfDCHH9Hs8TDHIEH[]A\A]D1DCHxHHHC(tHD2SH9qHS(0I]_HH]C SH{(H HЋS HEC$H HHECE CE(HHE"IEHEE$HHhImIE@u1H[]A\A]ÿ Am@HHtں HƉ[H C <w{ 0v-HH1[]A\A]ImImyIM(ME0HbH11AHQxSA}@H;1&H{(+!Hf.ATUHSHH@1pHp0HJHJ0H9=BteHC@$HHr8{@1HH;B8Hz((H;H{Ht HǸ@HC01[]A\f.uHC @ f tLcHLC0H%H1Lj1BLHKHS8CDH@Hz0B H@H@@Hp@wz1H{0vHC Pf{@HBHz(H;DkH;cfH{0tP{@WDxftfxHp@R{@sHDHHx(H;nf.SHGHH@|H{ H{JH{HtHǸ@H{H{([fHI Ht(UHSH7 HHHHuH[]HH%s/comments%s/main.cmt%s/%lu.cmt%s/%lu.ura;8T||,, <zRx $ FJ w?;*3$"\DJBH B(D0A8I@Y 8A0A(B BBBI VLHBBB B(A0A8Gx 8D0A(B BBBJ dBBD A(G  (A ABBF  (A ABBA O (C ABBI ,\p#BAD  ABK pNAH P   H o@ooxooo & 6 F V f v   & GCC: (GNU) 5.5.0.shstrtab.hash.dynsym.dynstr.gnu.version.gnu.version_d.gnu.version_r.rela.dyn.rela.plt.init.plt.got.text.fini.rodata.eh_frame_hdr.eh_frame.ctors.dtors.jcr.dynamic.got.plt.data.bss.comment  PP!o:.o@@8=oxx@LVBHH` $[  f0 0 o@ @ u{2.<PP    j (   0  usr/lib64/libclammspack.la0100755000000000000000000000167013365330314014436 0ustar rootroot# libclammspack.la - a libtool library file # Generated by libtool (GNU libtool) 2.4.6 # # Please DO NOT delete this file! # It is necessary for linking the library. # The name that we can dlopen(3). dlname='libclammspack.so.0' # Names of this library. library_names='libclammspack.so.0.1.0 libclammspack.so.0 libclammspack.so' # The name of the static archive. old_library='' # Linker flags that cannot go in dependency_libs. inherited_linker_flags='' # Libraries that this one depends upon. dependency_libs=' -L/usr/lib64' # Names of additional weak libraries provided by this library weak_library_names='' # Version information for libclammspack. current=1 age=1 revision=0 # Is this an already installed library? installed=yes # Should we warn about portability when linking against -modules? shouldnotlink=no # Files to dlopen/dlpreopen dlopen='' dlpreopen='' # Directory that this library needs to be installed in: libdir='/usr/lib64' usr/lib64/libclamunrar_iface.la0100755000000000000000000000176213365330315015441 0ustar rootroot# libclamunrar_iface.la - a libtool library file # Generated by libtool (GNU libtool) 2.4.6 # # Please DO NOT delete this file! # It is necessary for linking the library. # The name that we can dlopen(3). dlname='libclamunrar_iface.so.7' # Names of this library. library_names='libclamunrar_iface.so.7.1.1 libclamunrar_iface.so.7 libclamunrar_iface.so' # The name of the static archive. old_library='' # Linker flags that cannot go in dependency_libs. inherited_linker_flags='' # Libraries that this one depends upon. dependency_libs=' -L/usr/lib64 /usr/lib64/libclamunrar.la' # Names of additional weak libraries provided by this library weak_library_names='' # Version information for libclamunrar_iface. current=8 age=1 revision=1 # Is this an already installed library? installed=yes # Should we warn about portability when linking against -modules? shouldnotlink=yes # Files to dlopen/dlpreopen dlopen='' dlpreopen='' # Directory that this library needs to be installed in: libdir='/usr/lib64' usr/lib64/libclammspack.so.0.1.00100755000000000000000000023434013365330320015115 0ustar rootrootELF> @`2@8@&& ..!.!x 8.8.!8.!Ptd   QtdRtd..!.!%=:+58;,<*2./9#13604    % &'(!"-$)7x x. | @ p  _ Ѕ| _ <R =zS ` =l1!  px3 ` x _  w _  ^i ?O }u P[ { `|U  `dN @_ _ ;, l } _F"q `? 0_Z _|1 0__gmon_start___ITM_deregisterTMCloneTable_ITM_registerTMCloneTable__cxa_finalize_Jv_RegisterClassesmemcpyfreemallocstderrvfprintffputcfflushftellofseekofwriteferrorfreadfclosefopenmspack_versionmspack_sys_selftest_internalmspack_valid_systemmspack_sys_filelenmspack_default_systemmspack_create_cab_compressormspack_destroy_cab_compressor__assert_failstrchr__ctype_b_locmspack_create_cab_decompressormspack_destroy_cab_decompressormspack_create_chm_compressormspack_destroy_chm_compressormemsetstrlentowlowermspack_create_chm_decompressormspack_destroy_chm_decompressormspack_create_hlp_compressormspack_destroy_hlp_compressormspack_create_hlp_decompressormspack_destroy_hlp_decompressormspack_create_lit_compressormspack_destroy_lit_compressormspack_create_lit_decompressormspack_destroy_lit_decompressormspack_create_kwaj_compressormspack_destroy_kwaj_compressormspack_create_kwaj_decompressormspack_destroy_kwaj_decompressormspack_create_szdd_compressormspack_destroy_szdd_compressormspack_create_szdd_decompressormspack_destroy_szdd_decompressormspack_create_oab_compressormspack_destroy_oab_compressormspack_create_oab_decompressormspack_destroy_oab_decompressorlibc.so.6libclammspack.so.0GLIBC_2.3GLIBC_2.14GLIBC_2.2.5ii ui 0!0!1! 1! 1!p(1!@01!81!`@1!@H1! P1!0X1! `1!h1!/!/!/!/!+/!3/!6/!;0! 0!(0!00! 80! @0!H0!P0!X0!`0!h0!p0!!x0!$0!%0!&0!'0!)0!*0!-0!.0!20!:HHU!Ht>H5b!%d!@%b!h%Z!h%R!h%J!h%B!h%:!h%2!h%*!hp%"!h`%!h P%!h @% !h 0%!h %!h %!h%!h%!h%!h%!h%!h%!h%!h%!f%!fAVAU1ATUHSHHAHHLtL9tOEu13H=^AHuEy)1H51U0|HPu*H1[]A\A]A^HH1@H=!H!UH)HHvH!Ht ]fD]@f.H=!H5!UH)HHHH?HHtH!Ht ]f]@f.=A!uzH=!UHATSt H=!H!H!H!L%!H)HHH9s!fDHH!AH!H9r[A\]!Ðf.H=Y!H?u fDH!HtUH]HHHRff.HHUSHHHT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$HtxH51HX!HWH;H$H;HT$HD$D$ 0HD$HD$ HD$H3 PH;H[]fDH!Df.Ht H?1f.HtwH?^fDfHH@@tJHtEUSHHHcҾHHYH;H.u H[]Ðff.HH@@tJHtEUSHHHcҾHHH;Hu H[]Ðff.HtSHH?H[VfD@f.ATUSto~Ut@L%uOHHHt:HhLHHHt9H[]A\L%L%t[1]A\fDL%H1w31Hu$TuHDÐ1@HtSH?tMHtFHt?Ht8H t1H(t*H0t#H8tH@tHHt1HP1DHHuHHtCAUATIUSHHHHS(1IźHS tH[]A\A]fDfHS(1I$LHS uD1f.f.@AWAVAUATIUSHHHHS(IHHSt5|$IHL$ufHyt6w9uAE1H51S01H[]A\A]A^A_ÐDIcL1HS u2McHLS8HHtCHLLSHAEHDAE1뙾AAE1AE1q@HO@HQHt HOHHHIf.ɍAthHL3HH9utEt 1t 1fDH1 1HHy fD1HH~zATIUHS'HEHuH}P9u;HcI)M~@HcE HuH}L9HHEAM܉P9t[]A\[]A\fD[1]A\1@f.HtKt6t tfD~WX1D~WP1DWT1f.f.Ht G\f.HtVHG@HtMATUSHHt9PpHtd~2tMu HHC@H@xHǀ[]A\uLeH}AT$@HAT$@HC@ŐHHC@fH(HC@fHAWAVIAUATIUSHHH_HG\RInXHtfDLeH}S@HS@MLuMf`MtJfDIG@M,$Ht L9 I|$HtH/S@HHuLMS@MuI~8In(S@I~@S@I~HS@I~PS@0fH}8Le(S@H}@S@H}HS@H}PS@I9tHS@LHuIn0Ht2@Le0H}8S@H}@S@H}HS@H}PS@HLS@MuI.LS@Ht7I@HHtSLI@S@IG@H[]A\A]A^A_f.HtcHtfAWAVAUATIUSHHH(Lf(LHMtI|$(tJ1HUH5-1AW0C\H([]A\A]A^A_@fG\N0FHHHHHHH/A;D$ wHG@H&L; HLs@IHtII9D$t;AWLs@ID$1LIHpAIHC@HH1It$ AW C\;HrHdLLAHItrEC\tFHC@PpHǀt U0+PuLHPxC\LAWHC@HǀC\tC\cHK@Et$HDDqp/@H5 11QHLS@H#pDHE1HLT$IBxIzjDKXjmLT$IZYHC@H*HC\L I@@L`HHC`LAW8HHC@HH@HxLH HǀHǀHǀHH(H HH0qH511QHC\sH511QHLK@H\DDCXHڃHIyIAxLL$觭LL$I111H5QHLs@H(IFxCXD$IFHHD$AVPHct$HD$H|$AVPHT$HHHL$HBD$HZHZH B IAH511QHLs@H HڋKXDCTHI~IFxIHPxuC`C\HC@C\C\ C`H RH5+H=2HHT$AVXHT$HAVX1%f.AWAVAUATUSH(HtmH9Hu HtH~0t!G\H([]A\A]A^A_fDHz(uHF(Hu6fDH@(Ht'H9uH([]A\A]A^A_@HB0HuDH@0Ht H9utBhHHf9FhH|$LoHtH511AU0Ejf9Cj[L{`Le`DIIHuMw0MAD$A9Gt%1H51AU0HD$@\AD$ AG =wID$(HHD$tAN09H0H@A9FIHHt-HJ09H0J9HHHHuԾLAU8HHk0IwH](HHHuHIT$HIT$HPIT$ HPAD$ AG ID$AG ID$0HtL;`(tIG0 fIIHuI$LIAU@LsXL fDLL8MuHUXMHugMHItUM;f(I.uM6I/I~AU@LAU@I|$(^Hk0HSXH](M'HHHuHEXHHC(Ht HSXHPXHS`HP`H@(HuHC0HtfDHSXHPXHS`HP`H@0HuHD$@\1H5e11AU0D$AV0HD$ DHHt09P0uHA9NuD$M6Muʃ|$ufIVH5-11AU0HD$@\`HkXff. f.HHHfAWAVAUATUSHHHoHH|$Ht$ T$,PLl$8L@T$(IEHD$fIIH)t[Dt$(Ht$ D9AOLcLUHHL$Ld$ Ly@D)ىL$(MD$,+D$(HH[]A\A]A^A_fDAGPAWI;B III IDt$H$IIUIGILJHHIGjH@1HIHpUHI[IWHHr1U uLILUAIGH@HcIU ADHD$D``HH[]A\A]A^A_HL$Ly@A`AWptLIAW;Q AOpI4dfHD$Lx@ffDIHJIHL$Ly@AMDDH511U02f.H5Q1U0A1H51U0D$,+D$(HH[]A\A]A^A_1AWAVIAUATEUSHHIHHHHHBXHB`HB0HB(HB@HB8HBPHBHHJD$L1S tAHĘD[]A\A]A^A_AHD$P$HHD$HS$tA|$PMSCFtA릋D$XT$pAF D$q T$rfAFhD$s fAFjD$jD$ D$lD$$D$i<tT$htH5H1S0T$nAVpHcT$`IVzfAFlAdžD$AFpID$1D|$8E1ILd$HD$(DM'AD;l$ MHt$HSL$tHt$(HS l8HS8HI?HD$VDH5HID$Mt$ID$(ID$0AD$D$TAD$ D$PHD$ID$ 1S01AT$ H5HS01AT$H5HS0MMf` H5HAS0H5HAS0Ht$HSD$QT$PL$R T$SEfAFlL$Au f=`AFlfAHS &ALl$LHHLT$LIF8uQHxH5*11S0LHHuT$LIFHu HV1H5?1S0AFpALl$LHHL.T$LIF@uHH5B11S0LHHT$LIFPuHH5911S0KD|$81T$ H5HAS0D$$HD$D$(D|$<D$8HD$LHD$0AD$Ht$HD$S8HS8HIHH@(D$PD|$XD9|$ AED$^AED$TAE0IF`AAtHtAHAuHIE(T$\HH߉Љ? >AUAMAED$ZƒAU AE AUHT$0T$LIEHI}(LS@L$$T$H53H1S0AD;d$811D|$HIHIIHEJHtHH[]A\A]A^A_@1@DD$ LAT$8HH$DD$ 1LDLHuxAT$ H $HH $LAT$;H $9PutyMunyGuhAwXH9$vRAD$IIU? AEyD@>AwnH9T$vgAUI? ЉW IT$H9$vyAD$ I? A|$? %fDD@ AMEL9D$A]AU %I?? ЉWwXIT$H9$vMAD$? AD$? AD$? ǸMIfIĿjD@AwVMEL9D$vKA]AU??  A]? =øMI#fIջ LH)9LcLd$\$JD-HHD$MfDL94$H9\$A>IF@IHSDHD9tDAA9t\$EA)HEjL$TI97}HExHI9uW>whH9$vbAFIHS? GD@>AH9T$SH? A@W wIVH9$WwRIVH9$vHAF? AF? AF? ǸMIIƿ|D@ AwLCL9D$D@Aw]LCL9D$vRDcSA??A D DcA?D =AĸDMHf.HAfDd$0E)ED$XD$8t$<9t$8D$8D$1HD$@DI HHt$ HH)RHH) JHD$@H(rff.AWAVAUATUSHHHHD$0HD$8WHNHEA(;HG0HT$HHHA1HAHAIHA HHvHD$ HHH$HEE;HD$8Le@L|$0HD$H}0H $LLHIxAAMLL$HL$HaA}LVHT$0HL$8E1"fAHHT$0A zzH9rHD$ H<$PE@HH[]A\A]A^A_@HH[]A\A]A^A_@EE;Ht$8HE@AH\$(EHt$Ht$0HHt$RfAAHLL$LD$HL$ AdAGD9A9AH}0H $ELHaHIu]@EEHD$ H<$P]@@H\$(HD$0H|$81DHHD$0 ʀxyH9w@E1fIN0MVHHCLDLS(@HKHHD$0HH HSxy H9rGHC,HKHHD$0HH HSxyH9wf1HD$ H<$PE@A1AVAUATUS1H0H:tH0[]A\A]A^DIH6IHHA(LLw07tf.H|$t(LAV8HHEtOH$HHT$HPHT$HPHT$HPHT$ HP HEL` IEHUHH(H HUHP(H>f.HHHFHAWAVIAUATIUSHH8Lo8Ho0L8MI}xHt M;}tLULk8I}Ht OaLk81M}IEIEIwHUIExHC8HxxLHUHII|$M|$C@AGu]HC8HxHt%HHI9L$Y`HC8H@M|$IWH (LHLs0yC@fDLUC@DC@H8[]A\A]A^A_Iw(H~HSHH$ H4$H|$(苼D$HD$H<$P@D$D$ID$LS8AHL$(HIGIz L$IrxH@HB@HHD$0IBD$HH)IBHL$(jQDD$(DT6LT$IBHC8ZYHxuC@C@HC81HpHxxU ugLs8It$I+vIdžiC@6I~xU(IFC@HC8HxHt ^HC8H@uDC@d@G@IIt$1Hp@HC8HxxU uM|$Lt$0M0DLLUA9cMcM)MHC8IAENLDHxxUA9tC@ff.HUC@1@IWH LHRiIwH~(C@WHU8HHC8HUH L8H@H@IHP HUHP(HUHP0HUHP8HU HP@HU(HPHHU0HPPHU8HPXHU@HP`HUHHPhHUPHH8H@xHǀHPpC@@C@I~It$M6Ls8C@I~o6Ls8C@HHH(xLZXCtAV@C@@=$G D$G$AV@$=J=.==JA|$9D$+|$ID$HcHHHHߙIW LȉD$HC0L$H HD$uIw H~'HC0IW(H LHHD$0HD$1=tG= t5=}A.AV@C@G D$GAAAAAHHH$7x tHHD$P@H$H|$(Hp*H4$T$NF ;VIw HvH)H9tmH $H|$0H4жD$HD$H<$P@D$L$ȃHHD$(H‰HH!HD$('C@H$LHL 4D  HHD$0HD$P@HD$H<$P@@f.USHHHH1tgHHS8HtWHYH H5HX0@@HHHHHOHpH H5HPH@8HH Hp(HH[]H HkfHtSUSHHHG8Ho0Ht(HxxHtUHC8HxHt XHC8HU@HE@HH[]fDfD1f.f.@1f.f.@1f.f.@1f.f.@1f.f.@Ht3HG(Ht*USHHHH~8PHC(HP@C0H[]fDHAWAV1AUATIUSH(H_(HIľ@HS8MHtHu@MtkHtvAV0HtMtLSHtHS@1H([]A\A]A^A_@Ll$L`8LLSt<AV0fHAF0uAF0fD1D|$KWAJu|$'uD$T$HEHE HE( fED$HET$ЉU1ҨfU0U =LLS!D$HDAʼnD$IwS8HHE(AHLS9D$HE(1B8fDm0LLSHcD$HEJLLSU7LLSst$LS tDZ HS8HHE tUIuxuAU UIGA.LLHD$SLL|$1H9IDIEDGuvHD$ LLS1HL$ VH9~A|5L<1@@<1u u|$u1rL)HcS Uƒu|$t 7rL)HcS fDHt G0f.USHHG0t8HƇG0HHkHC 1H[]fDHHHHPHcиxuC0ƃff.AWAVIAUATIUSAHHGEo(H A_,X t},$H͍JAITH$EA)ރ~+HF6DAA H9HrLuGIwI )݃~q@AO0DA$9^V@1H[]A\A]A^A_L`uIwI HF6A H9Hrɐ "@#!IGI Eo(A_,k)݃mAO0DA$t90$AAvAL$InAMtH9HHA EG0DEE@A9~ @gH9HA A DEA9~ @I$H9LHD)كA E@DAA9؉$~ @6$ELLIwI HF6A H9Hr1f.A4HA9wIGI Eo(A_,$AAAL$InAITHT$IAEA)H9snLHDDsA EG0DA^AED9}6$D$L$HUH;l$ufLxIGI uLXIGI L8EG0IOI E@AO0DA9}s@uHH9,$@LJIGI EG0$EHHL9 @D)I9sHIAE A^AE EDAD9É$L(MOI EG0뚃$$U]1HgHLbAWAV1AUATAUSA1ɅuLDA9s@DF8uE A!EAA9fB BuDA9rAAA u=6f=wDAffF BuACAE1D)uf.AA9AD8u=wgAA#EG$AED$AAMDă9tNNMWMG IE_(EO,LLT$LD$D\$D $nD $D\$LD$LT$H,$Ld$E1H\$D$ MĉD$ELDA0u5EAA)ރPL9s1EDAHA H,$Dl$Ld$H\$oLIoMg DAGf@1D@ HAGfuH,$Ld$H\$A)ރJL9s/EDAHA H,$Ld$AH\$LuIoMg DAGf@1D@ HAGfvguNHcAL4AW0)AA9}D$$D)ABL9s#EAHA HcALDLIoMg DAGf?vc@1D@ HAGf?v;uD)AL9smEAHA HcDALtAW0)A9}A)كL9EHA L)*IoMg vDAG4 f@1D@ HAG4 fuLL$(IoMg L$(XAG0DAt9Hl$(݋\$ A փl$$D$$D)%A#HcI#A#IIPukHcDALTAW0)A9}M D$$Aƃ|$$)كhL9sAEHA H,$Ld$AH\$|\$ E1Hl$(LL$(IoMg L$(DAGf=v3@1D HAGf=v uAAW0)A9}WHcT$ A#II#IPl$$D$ %D$ @f.HtKATUHSHHIt?HHHHS(HtI|$8RHS(LR@k0[]A\fC0f.USHHHtrH1蘛tT8HS8HtDH]H H5HX(@0HHHHH3H HpHPHH HH[]fDHi H@Ht HG(`@@f.@1f.f.@Ht3HG(Ht*USHHHH~PHC(HP@C0H[]fDHt G0f.HHAVAUATUIS>HLvLo(HHL1҃H AU tE0[]A\A]A^fDLLAUHItYALLLDDsLE0AUE0ff.G0E0pDf.HAWAV1AUATIUSHH_(HIľ HS8MHtHu@MtkHtvEu0EHtMtLSHtHS@1H[]A\A]A^A_L|$L`LLSAt9AEu0DHAE0uAE0fD1Dt$H IG@:5 IOuk:@88u`HHH9u8D$uJELLSk|$AfD$ E1EHcD$ HEM@:5 H IGIOuh2@80uXHHH9uA8D$ELLSHcD$EE1HEDADHtKATUHSHHIt?HHHHS(HtI|$RHS(LR@k0[]A\fC0f.USHHHtrH1tT8HS8HtDHmH H5oHX(@0HHHHH3H ,HpHPHH HH[]fDH H@Ht HG(`@@f.@1f.f.@SHGHcHHH9GHPxHcH)S[USHHHHEHP~/HUH5H| H2K3H9uUH[]Df.AWAVAUATUSHHt>H_II1HHIt)l$8`L<$Lt$1밽L<$Lt$L<$Lt$L<$Lt$ vfDHtbAWAVAUATIUS1HHoHUHI2Ht$0HUt MH[]A\A]A^A_f|$0uԃ|$4uD|$8L$<LHAˉL$DFUHIDHU8HIHEHl$@Hl$`H$HELd$HLt$hH$HEH$HEH$HE H$HE(H$HE0H$HE8H$HE@H$HEHH$HEPH$H&H$HGH$HD$`L4$HD$HD$@HD$ H$HD$(IcHúLLUoEuAM AEAuE9L$ D;t$urA9DLLUA9DLH<$UA9dD)t$sL4$1LU@LULU@A9vuED$pHD$XjE1ARHT$(AHt$0H|$8LT$ HHXYLT$HHT$LT HT$u[H3HT$XHuZHT$XHH)HHT$Xt?H9LLACUyL4$f.H׉L4$23D$ 9D$pL4$ L4$L4$L4$ff.USHHHtJH1t,HS8HtH H &HXHHHHHH[]fDH Hff.Ht HG`@@f.@SHHHwxHPx*Ht HSxHHH1[{ktCp[@HCx@CkfAWIAVAUATAUASDtoA11ɅuODA9s@DF8uDE9C3DAA9fC AuDA9rAA9sA9JDE9vDAfGADE9wDn9BAADd$Aމt$ED+d$E1D)uAA9AD8, u9D$vnEtv(AD6AArAAID9tGMHT$(I LL$ALL$t)AFp A E^pH8D[]A\A]A^A_Ët$$9t$ SD)A~5HCD#I9v\HXAA AE AgI9wLD\$D\$zIMHCD#I9wLD\$D\$EIMwDAF fv5 1D@ HAF fwAHAA)f7fItR|$ HT$)HHt$ t$ 9t$$IMEElEAE)5@HC+I9vTHX@DAA A EYI9wLD\$UD\$IMLD\$+D\$IMAwCl-@D)I9ىD$HCD#I9HXL$AwD ʼnAF fv6 :E1AD HAF fwHcȋ|$ AE)HL$A 1)ȍIHABLH|$7t$ 9Ήt$ uA<LD\$ D\$IMLD\$D\$IMAAE)=fHC+I9vWHXDAA@ A A\I9wLD\$ZD\$IMLD\$0D\$IM|t$ DAAD0T$ H|$H9Ɖt$ uAD)5fDHCD#I9vQHXAA AE AYL9rLD\$D\$*IMLD\$UD\$IM녋t$ DAAD0T$ H|$H9Ɖt$ u#fAWAVAUATUSHHD|$X EDDD$H$IIALAU8HILƉt$ AU8LID$(HcAU8I|$(ID$xHsHL$ fHT$PAL$0H tH4$A$\$M,$IT$ UMt$It$ID$HcAD$4AD$<I$ AD$@AD$DA\$HAD$`AD$dAD$hAD$pAT$8I$zE|$lAD$LAD$PI$I$I$AD$TAD$jAD$\AD$iDHH9uI$P I$J @HH9uI$I$LADŽ$ADŽ$AD$kH[]A\A]A^A_AU@I|$xAU@LAU@1H[]A\A]A^A_11H5jAU0E1Htflt[HuTDO0A9rKUSIHHHt+Ht>Ht9A)ɉʉK4LHw(LP¸9k41H[]fDHtHw DAWAVIAUATUSHHHt$tbHHH?uTE~pEu,IIH)HcЉH9L߅H|$u/HĨD[]A\A]A^A_f.AIF(HT$H5iIVMMIHD$8AFM$M$IFAI9wLuI$M$E|$pGAƄ$zAD$\t$P9N)t$pAD$\AD$i<<<AD$p A f.IPHH))HOƉD$ |AP\HT$HIA@LA@PA@TA@jA@\A@ifDHH9uHT$@IP HH9uD$XD$(D$,LLD$LD$&MMLLD$LD$IMLLD$sLD$MMLLD$CLD$IMD|$0l$0E}AAD$i<D)M9AIFAI9LpDE}  AGA E)M9IFAI9LpD AAAAAAA AD$iEL$XEL$\<2 < < I$H5cM11R0AFp A bLM$M$IFAI9LI$M$f.LT$T$M$M$LT$tT$hI$M$HcIIFH)D$E1AD$XM9} Ivt$pD$pD$\$0LEIŽD)A~5|@IFE>I9vKLpAA AD AIM9wLMM@LIM땉AE f= PfD1ٍ@ HAE f= uMD$pD$A;D$0$D$p\$H\$8ODl$D$IMLHL)u.I9rLMIft$L9IOLLcLMMPH)l$t$$Dl$IMD$D$ t$p)t$PD$PsD|$0AD$@MT$)9T$ AEw7M9IFAI9ULpD)A A DtAAIIH9AAxh'EH`EDL$p8AxDwt$ A@@I@(Il$ AhdIDd$ IxL\$H.IHD$LD$H9HcHIcHMIP9LD$H|$H)IIXHD$A@@L\$DA@@A@DPA@0APD9E9\$A@@ @|$pD$pD$Il$0MLEAE)A~5~fDHPI9vLHBDAA AKL9rL6IMfDL`IM딉AO f ~AA1A HcAW f vPAAuM|ExpI11H5\Q0DD$\L\$ ELD$ED$\IAA)f#L$HT$8l$H@< t$T$El$0IMIA A)f=L$H|$8l$AD$L$L\$0EIa@EpE}pLLD$LD$IM~LLD$\LD$MM@AD$0l$0    D$(D$XD$,D$,D$( D$AM0D<A9|$,DT$DHD$8D9LI;}@ D)A;}49)HL$89A~1A)DGgIP1D 9D 8HH9uHL$8JDEJ1I98HL9u)t$D|$UADAAeA< Eu A#F H daH=\F4)BrADt$XDt$0- E=E9A$E)DEA<HPI9HBDAA E9I9wL/IMI$ HD$pHD$I$ HD$0A4M9IFA.I9LpD)A A Ht$DAAHH9t$0Ht$uHT$pI$yL\$L\$hHt$`1M$M$E$E$L*AD$8Ht$`L獈mHL$hHT$`  M$M$A$A$<A$tAD$hHt$x1M$M$A$A$LwM$A$ H$HT$xAƄ$zM$L\$D$0E$L\$/HD$xHT$@ HH9 8tMEA܋$DAOyf Hcϋt$0E D)AAB t$(E)ԉt$X49DAt$(D́9t$A0D43A9 T$t$(HL$89AM;O~ )A;w4NDL$(D+L$A9D)H|$8D9A~3E)EEQ IRE1B4B4 IL9uH|$8JLAUE1HB4B4 II9uL$,t$()\$Dt$t$,L$(EAD$htSH$LpHCH$H9M9LwLqiI$M$M9vIM9v(IL;3M$M$LM$M$LM$M$LI$M$T$AL$\9m L$AL$\KH|$LEMD$INLLDDD$AFI9vKLpAA AD ATM9rL0MMLiIM땅#AH nYD E9l$Xt$0LD)AD3IFE>I9vVLpAA AE D9M9rH$l$LLH$>$HLyHH5SA}l.AD)9fDIFE>I9vKLpAA AD ABM9wLMMLIM땋L$(t$,L$,t$(|$,+|$AlAAE)7fDHPI9vJHBDAA A`I9wL:IMLIM떋t$XL$(t$(t$,L$,t$XH ~RBrt$0DqE9M\$XD)3HPD(I9vJHBAA AD E9I9wL!qIMLQIM떉AEUf=v<f1҅ HAEUf=wAP HƃA)ZAOUfvI9v/LpD AD$D`@L eIMLEMMAA1ɍ?E HcAWyfAAuAL$Dt-3D)I9Év`HHI9v41HA AL$A DDaADL)yIML YIM뀍X AL$D43D)I9ÉvZHHI9v.1HA AL$ A DADaD6LjIMLJIMAEt$E)4L9HPI9!HBDAA A ~ƉEf AEt$E)4L9HPI9HBDAA A ~ƉEf .MIH5J-LPIMH|$8;M$H5 KM11A AP0AFp SHL$8MIUH5JL-IML IMLIMD}pMIH5fI6AD$4D)M9vVIFE>I9v)LpD AD$ D`LDIML$MM늸Al$D)A5M9IFE>I9LpDAD à ~ƉDe 1Al$D)A(IFE>I9v\LpDAD à %M9rLZMM뮉De L#IMAAE)4DHPD0I9vGHBDAAD AEL9rL\IML<IM뙉AOyfv8A AO1 @ HcAWyfwHA A)̋t$(t$Xt$0t$(LIMLMMMMH)H‹L$ H5G11A AP0AFp MIUH5'FMMIH5FMƋL$ MH5?G IzAx@IzIx(L\$PE`dHHD$IHILD$0PHL\$PDL$pLD$0H;\$;HCtCAH㋜$E E)D)L$Xt$(D$(t$XSD9|,A9~'AD)IˆCSCSHAdD$ A@dMIH5SEMIUH5@EMIUH5DHt;USHHH/HxHtU@H{(HtU@HE@HH[]f.@SHWlHHw8HPxHtHS8HHS@HCH1[À{`tC([@HC8@C`fAWIAVAUAAATUDSD$AĽ1AEE1AEutAA9shA@8,uD݉D)1fAAD AuDA9oDDADȃfGZuAA9rA@9eA9wDAE9v01EAAD ȃuAEfA BE9wЋD$D$9BADl$DnAEAE1A)E)u@AA9AD8,u9\$A؉1AfEAAD ȃuEtg"AD AAAAAIDA9t>MIF@InHLPكA ǃL9LwHiHDt$AD;L$wRDAD9@@uADA1 DA1$$AWAVAUATUSHHHHG@LOHd]h<$H H|$HH|$>D,$DsAAL9 L`DDsA EA^AAAALe@LMHHD}d]hm&Le@LMHHUpD}d]hH LL$nHL$HT$ LL$RD%Ef= D҃ Ef=uHH[]A\A]A^A_ÐHHE@LMHE1HD$<)AqD8AApHAu߸HH[]A\A]A^A_M98A$IA HL pA)f=UJM LL$HU LL$EfL9H $E(HH[]A\A]A^A_fDf=HHD$H^AD48D9H=AIcEDD)GH|$AfD$*HAxfD$~! fL`كA ŃM9LrH>HE@LMH@H HE@LMHL`كA D9NM9Lr@HUpHHfHH9uHpD HH9uHDHH9uHDHH9uHDHH9uH'_Le@LMHD?E fvWfD҃ E fv*uHHE@LMHH A)fHHD$ H9?D48D9|=DL`كA D9}"M9LwHBzHE@LMHH=?IcH?D) GH|$ DD!A zUDl$,D$*9AA)΁A!D$AAA \$AHLDC 7DD)ABD Av DA)H A)DAƅDKH HtH1fHH9uDKADDAESfAu HfDL`AUBD,Dt$<A9ED|$MXf.ULL)L)H D9AG9FHEAA)LMPHE=EtGEt"M9rH5mLe@LmHM9uD|$ML1$.D<$HU EM͐AAEANPUB5 A@ uþHU E맸DHS u^C.IhID|$,H݋\$MD|$,L9HC+I9HXD)A IEXI+EPA D1ҹAAt$AE2fT$HfL$Jt$0T$ AM )‹D$L9G9F9ƉD$xEMMT$HD$l$JEH))1҃AAAfA;@Ar!DICA|fA96IÃ9uLcJA|HBL10@ft$Jt$HA1DlAfD$HKf@HfAxHL\$Dd$HDfD1xXEH9HB*H9HPA A DGl-EE DfD1yfA@fA@@fA?fA@|D$JffwfMAE4 D$ D$ HĘ[]A\A]A^A_fD$ fDL(utIV@INHHB*H9LuPIF@INHLu:I]@MeHHC+I9.LuIE@MeHfDMAE4D$ A\$(IEHP9tUAE4D$ ICLcLH|$XD$HL\$Dd$HD$HcD$(IEPI)Ax1AA&D$JfDd$HIf\$HӃQI~pt!ItIIHDHOT$HED$DDODY))D1҃AAÃAAf;AAr}fHBDDfD9HAE9uMcJDDHD10@f$ul$HAD1fD$JDAfD$HJAf@HEfyHLl$J\$HDd$D$Mf1xWEtH9HQD1H9vcHJAA A Dl-EEA ĉf1y@f@fA@f?f@DLcIU@I}HLFIM@I}HVDDt$JMEL|$ IMD$0ME@MMHEe`AmhfEu,AE$D$LAE(D$HfAE.D$fAE0)DD$(Hl$ D$0Ht$PHD$LIUX=uADtAAAveDAA=uIUXAE2AD$LD$0A;E IEPH9D$8 HD$8HT$@DD$(Hl$ L9s.HCI9v CAB_INPUTMAX (%ld + %d)WARNING; bad block checksum found: 0x%xran out of splits in cabinet setcab_chkname: File name contains disallowed charactersWARNING; unexpected cabinet version %d.%d (expected 1.3)WARNING; reserved header > 60000.CAB: Invalid name of preceding cabinetCAB: Preceding cabinet name: %sCAB: Invalid info of preceding cabinetCAB: Preceding cabinet info: %sCAB: Invalid name of next cabinetCAB: Invalid info of next cabinetCAB: Folder compression method: %dWARNING; cab header file %d of %d has invalid folder index (%d out of %d folders)WARNING; cab header file %d of %d has invalid filenameCAB: * file is a system fileCAB: * file modified since last backupCAB: * file to be run after extractionCAB: * file name contains UTFWARNING; omitting file %d of %d from file list.No files found, even though header claimed to have %d filesWARNING; found InstallShield header. This is probably an InstallShield file. Use UNSHIELD from www.synce.org to unpack it.WARNING; possible %lld extra bytes at end of file.WARNING; file possibly truncated by %lld bytes.mspack/cabd.cself && self->dFailed to merge folders%/*?|\"+=<>;: no folders in cabinet.no files in cabinet.CAB: Next cabinet name: %sCAB: Next cabinet info: %sCAB: Folder record %uCAB: Folder offset: %uCAB: Recorded folders: %uFolder not found for file %sCAB: File record %uCAB: File name: %sCAB: File offset: %uCAB: File folder index: %uCAB: File attribs: 0x%xCAB: * file is read-onlyCAB: * file is hiddenCAB: Recorded files: %u =}?)?B?n>n>n>n>>e?)>u?n>n>n>n>x>m?>?cabd_init_decompWARNING; CHM version > 3invalid section number '%u'.WARNING; contents are corruptWARNING; chunk size is not a power of twoWARNING; first PMGL chunk is not zeroWARNING; PMGL quickref area is too smallWARNING; PMGL quickref area is too large::DataSpace/Storage/MSCompressed/Content::DataSpace/Storage/MSCompressed/ControlData::DataSpace/Storage/MSCompressed/SpanInfo::DataSpace/Storage/MSCompressed/Transform/{7FC28940-9D31-11D0-9B27-00A0C91E9C7C}/InstanceData/ResetTable|{ "|{ "Detected LZX Compression Type: DELTAlzx_decompress: end_frame = %ulzx_decompress: current_frame = %ulzx_decompress: bytes remaining at reset intervallzx_decompress: detected an invalid reset interval during decompresionlzx_decompress: bad block typelzx_decompress: LENGTH symbol needed but tree is emptylzx_decompress: match ran over window wraplzx_decompress: match offset beyond LZX streamlzx_decompress: match offset beyond window boundarieslzx_decompress: match ran over window boundarylzx_decompress: overrun went past end of block by %d (%d remaining)lzx_decompress: decode beyond output frame limits! %d != %dlzx_decompress: %ld avail bytes, new %d framelzx_decompress: bytes left to output  0@`  0@`  "$&(*,.02468:<>@BDFHJLNPRTVXZ\^`bdfhjlnprtvxz|~   "$&(*,.02468:<>@BDFHJLNPRTVXZ\^`bdfhjlnprtvxz|~  "$&*2Bb"MSZIP error, %u bytes of data lost.       !1Aa  0@` #+3;CScs?? &.6>N^n~   0@`  0@` 0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-;r  ( #    ( X p P   Xp0h 0PPx !h + p0( @1 2 2 2 2 20 3 3 4 05 6` > > > GP K KTTU U0U(@U@PUX`UppUUUUUUYY0Z_ ahl`mmHn` nx0npnno0pqqprr r8rPrp@s wzpP{p{{}(pxІP`(x`h``p0p@h@X0zRx $`pFJ w?;*3$"D\t,AAJ AAG @H4Pf\AR ] AAB P4$f\AR ] AAB P\"FO<|EAA E ABA \ CBG  ?H @ [D {WBD A(M0`(A ABBO0L d L| BBB B(D0A8Pw 8A0A(B BBBB  # yL GDD M FBD A FBG ACBL@ Vd 4| PAA FABE L KBE B(D0A8D@j8A0A(B BBBlH LBB B(D0A8J`x8A0A(B BBB]`hFpRhA`dtBBB B(A0A8D`q 8A0A(B BBBG t 8F0A(B BBBE x| pBBB B(A0A8D 8A0A(B BBBG  8A0A(B BBBD  8A0A(B BBBA <pBBD A(E0m(A BBBL0h BBE B(D0A8Sl 8D0A(B BBBD lP!ZKBB B(A0A8D~ 8A0A(B BBBA ZC\@&KBD A(D0G@V 0A(A BBBE pH@,&AAG  DAE ,`'RFAG sDAL'd'|'+L'[BB A(D0](D BBBU0((D0(KBD A(G0 (D ABBF xD(C\# Lt)~BBB B(A0A8DPx 8D0A(B BBBE lH*KBE B(C0A8M 8A0A(B BBBH H4 1L 1 Ld 1BBB B(D0A8O> 8A0A(B BBBD d 8:BBB B(A0A8D^ 8F0A(B BBBE I 8A0A(B BBBE D P=BBB A(A0F`J 0C(A BBBF d =aBE B(D0A8J2 8A0A(B BBBA A[APP, `EAAG  DAH ,, EZFAG }DA\ Ft F F E E E E E E4 E,L E:OAJ \AAl| EKBD B(D0A8D`U 8A0A(B BBBE PH` H, HAAG v AAG L4 XIBBE B(D0A8GP 8A0A(B BBBH D NBBD B(G0A8\ 0A(B BBBI t 0PB PBE B(D0A8Ii8A0A(B BBBV`P4D[eLAD AABK ,|@[AAG k DAG [[[,[:OAJ \AA$[T<[TBB A(D0u (A BBBG P`0lH\KBD B(D0A8DPV 8A0A(B BBBD PHP4]eLAD AABK ,<^AAG k DAG l`^h^`^X^(Af$h^QAAJ BAA\^BBB B(A0A8LJ 8C0A(B BBBD Q[At\ bLBB B(D0A8IB8A0A(B BBBD5EfA,hedAAG C DAG e$enAw H S E DDeBED B(G0F8 0A(B BBBC LgBBI B(D0A8DpH 8D0A(B BBBA dmXBBB B(A0A8DP 8A0A(B BBBA Z 8A0A(B BBBA ,DoaAO xAAM t8p L0pP&BBE B(A0A8GT 8D0A(B BBBK ,0BFAG cDA$ P^An A S E D4ZBED K(A0D8 0A(B BBBB L|BBE B(A0A8Ge 8A0A(B BBBE |0BBB B(A0A8G^ 8F0A(B BBBB e 8A0A(B BBBA  8A0A(B BBBG LpldxKBB B(A0D8D@ 8A0A(B BBBA L8C0A(B BBBLBBB B(A0A8DP 8D0A(B BBBH L$h@BBB B(D0A8K@ 8A0A(B BBBA ,tX2FAG RDA$h^An A S E 4/K nABDAD dBBB B(G0A8GP= 8D0A(B BBBA Z8C0A(B BBBLlBBB B(A0A8G{ 8A0A(B BBBJ ,2FAG YDA|mbBB B(A0A8Jx8A0A(B BBBR 8F0A(B BBBG  x X   0!h o`oo o 8.!&6FVfv0! 1!p@`@ 0 SZ '3SZDD'3GCC: (GNU) 5.5.0.shstrtab.hash.dynsym.dynstr.gnu.version.gnu.version_r.rela.dyn.rela.plt.init.plt.got.text.fini.rodata.eh_frame_hdr.eh_frame.ctors.dtors.jcr.dynamic.got.plt.data.bss.comment    !o z.o``@=GBhhQxx$LpW`  7fXXl t    l.!. .! .0.!0.8.!8.[/!/80!00!0 1!1011usr/doc/0040755000000000000000000000000013365330317011142 5ustar rootrootusr/doc/clamav-0.100.2/0040755000000000000000000000000013365330317013201 5ustar rootrootusr/doc/clamav-0.100.2/COPYING.zlib0100644000000000000000000000156513350521603015171 0ustar rootrootzlib/libpng license ------------------- This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages arising from the use of this software. Permission is granted to anyone to use this software for any purpose, including commercial applications, and to alter it and redistribute it freely, subject to the following restrictions: 1. The origin of this software must not be misrepresented; you must not claim that you wrote the original software. If you use this software in a product, an acknowledgment in the product documentation would be appreciated but is not required. 2. Altered source versions must be plainly marked as such, and must not be misrepresented as being the original software. 3. This notice may not be removed or altered from any source distribution. usr/doc/clamav-0.100.2/ChangeLog.md0100644000000000000000000000017413350521603015343 0ustar rootroot# ChangeLog ClamAV is Open Source! So check out our work [on GitHub](https://github.com/Cisco-Talos/clamav-devel/commits).usr/doc/clamav-0.100.2/clamav.SlackBuild0100644000000000000000000004236413365330317016411 0ustar rootroot#!/bin/sh # $Id: clamav.SlackBuild,v 1.58 2017/08/08 14:16:45 root Exp root $ # Copyright 2006-2018 Eric Hameleers, Eindhoven, NL # All rights reserved. # # Redistribution and use of this script, with or without modification, is # permitted provided that the following conditions are met: # # 1. Redistributions of this script must retain the above copyright # notice, this list of conditions and the following disclaimer. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR IMPLIED # WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF # MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO # EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, # SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, # PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR PROFITS; # OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, # WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR # OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF # ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # ----------------------------------------------------------------------------- # Slackware SlackBuild script # =========================== # By: Eric Hameleers # For: clamav # URL: http://clamav.net/ # Needs: # Changelog: # 0.80-1: 30/nov/2004 by Eric Hameleers # * Initial build. # 0.80-2: 02/dec/2004 by Eric Hameleers # * Fix permissions on "/var/run/clamav" directory # 0.81-1: 02/feb/2005 by Eric Hameleers # * Rebuilt for new version # 0.83-1: 15/feb/2005 by Eric Hameleers # * Rebuilt for new version # 0.83-2: 15/feb/2005 by Eric Hameleers # * Patch freshclam.conf and clamav.conf for better package # defaults. Make rc.clamav executable. Add option to rc.clamav # to disable milter support. # 0.84-1: 30/apr/2005 by Eric Hameleers # * Rebuilt for new version # 0.85-1: 14/may/2005 by Eric Hameleers # * Add '--enable-id-check' to configure command. # 0.85.1-1: 21/may/2005 by Eric Hameleers # * Rebuilt for the new release. # 0.86.1-1: 27/jun/2005 by Eric Hameleers # * Rebuilt for the new release. # 0.86.2-1: 27/jul/2005 by Eric Hameleers # * Rebuilt for the new release. # 0.87-1: 16/sep/2005 by Eric Hameleers # * Rebuilt for the new release. Removed 'contrib' from the doc # directory as none of it makes any sense. # 0.87.1-1: 08/nov/2005 by Eric Hameleers # * Rebuilt for the new release. # 0.88-1: 10/jan/2006 by Eric Hameleers # * Rebuilt for the new release. # 0.88.1-1: 04/apr/2006 by Eric Hameleers # * Rebuilt for the new release. # 0.88.2-1: 29/may/2006 by Eric Hameleers # * Rebuilt for the new release. # 0.88.2-2: 15/jun/2006 by Eric Hameleers # * Fixed permission for directory '/var/run/clamav' again # (it is now 771 so that the AllowSupplementaryGroups works) # 0.88.3-1: 22/jul/2006 by Eric Hameleers # * Rebuilt for the new release. Since 'configure' now uses the new # DATAROOTDIR, explicitly configure the mandir. # 0.88.4-1: 10/aug/2006 by Eric Hameleers # * Rebuilt for the new release. # 0.88.5-1: 18/oct/2006 by Eric Hameleers # * Rebuilt for the new release. # 0.88.6-1: 07/nov/2006 by Eric Hameleers # * New release. Patched the default value of 'DatabaseDirectory' in # the /etc/*.conf files to be '/usr/share/clamav', to reflect what # this package uses instead of '/var/lib/clamav'. Also correctly # creates clamav user/group and assigns ownership if the target # root is not that of the running machine (using chroot). # 0.88.7-1: 13/dec/2006 by Eric Hameleers # * New release. # 0.90-1: 14/feb/2007 by Eric Hameleers # * New release. Since clamav's .conf files changed quite a bit, # I had to re-do the .patch files. # 0.90.1-1: 05/mar/2007 by Eric Hameleers # * New release. # 0.90.2-1: 16/apr/2007 by Eric Hameleers # * New release. # 0.90.3-1: 02/jun/2007 by Eric Hameleers # * New release. # 0.91.1-1: 23/jul/2007 by Eric Hameleers # * New release. # 0.91.2-1: 22/aug/2007 by Eric Hameleers # * New release. # 0.92-1: 22/dec/2007 by Eric Hameleers # * New release. # 0.92.1-1: 13/feb/2008 by Eric Hameleers # * New release. And the day I buried my dad. # 0.93-1: 15/apr/2008 by Eric Hameleers # * New release. Note that if you build this release while you # still have a previous clamav package installed, the binaries # will link dynamically to the present libclamunrar_iface.so.3 # which will be gone after you run upgradepkg. This results in # runtime errors. Remedy: build this release after removing an # existing clamav from your disk. # 0.93.1-1: 10/jun/2008 by Eric Hameleers # * New release. # 0.93.3-1: 09/jul/2008 by Eric Hameleers # * New release. # 0.94-1: 04/sep/2008 by Eric Hameleers # * New release. Add "--disable-check" to 'configure', to avoid # a (harmless) warning about missing 'check'. # 0.94.1-1: 10/nov/2008 by Eric Hameleers # * New release. # 0.94.2-1: 28/nov/2008 by Eric Hameleers # * New release. # 0.95-1: 24/mar/2009 by Eric Hameleers # * New release. # 0.95.1-1: 17/apr/2009 by Eric Hameleers # * New release. # 0.95.2-1: 11/jun/2009 by Eric Hameleers # * New release. # 0.95.3-1: 30/oct/2009 by Eric Hameleers # * New release. # 0.96-1: 02/apr/2010 by Eric Hameleers # * New release. # 0.96.1-1: 27/may/2010 by Eric Hameleers # * New release plugs a critical hole. # 0.96.3-1: 21/sep/2010 by Eric Hameleers # * New release. # 0.96.4-1: 26/oct/2010 by Eric Hameleers # * New release. # 0.96.5-1: 02/dec/2010 by Eric Hameleers # * New release. # 0.97-1: 11/feb/2011 by Eric Hameleers # * New release. # 0.97.1-1: 11/jun/2011 by Eric Hameleers # * New release. # 0.97.2-1: 19/aug/2011 by Eric Hameleers # * New release. # 0.97.3-1: 24/nov/2011 by Eric Hameleers # * New release. # 0.97.4-1: 21/mar/2012 by Eric Hameleers # * New release. # 0.97.5-1: 17/jun/2012 by Eric Hameleers # * New release. # 0.98-1: 20/Sep/2013 by Eric Hameleers # * Update. # 0.98.7-1: 31/may/2015 by Eric Hameleers # * Update. # 0.99.2-1: 05/aug/2017 by Eric Hameleers # * Update. Adopted the enhancements from the SBo copy. # Enable milter. # 0.100.2-1: 28/oct/2018 by Eric Hameleers # * Update. # Enable milter. # # Run 'sh clamav.SlackBuild' to build a Slackware package. # The package (.tgz) plus descriptive .txt file are created in /tmp . # Install using 'installpkg'. # # ----------------------------------------------------------------------------- # Set initial variables: PRGNAM=clamav VERSION=${VERSION:-"0.100.2"} BUILD=${BUILD:-1} TAG=${TAG:-alien} # The 2-letter ISO code of the country that hosts your clamav mirror: ISOCC=${ISOCC:-"nl"} # Read "README.slackware" for compatibility with amavisd-new CLAMUSR=clamav CLAMGRP=clamav # Where do we look for sources? SRCDIR=$(cd $(dirname $0); pwd) # Place to build (TMP) package (PKG) and output (OUTPUT) the program: TMP=${TMP:-"/tmp/build"} PKG=$TMP/package-$PRGNAM OUTPUT=${OUTPUT:-"/tmp"} SOURCE="$SRCDIR/${PRGNAM}-${VERSION}.tar.gz" SRCURL="http://www.clamav.net/downloads/production/${PRGNAM}-${VERSION}.tar.gz" ## ## --- with a little luck, you won't have to edit below this point --- ## ## # Automatically determine the architecture we're building on: MARCH=$( uname -m ) if [ -z "$ARCH" ]; then case "$MARCH" in i?86) export ARCH=i586 ;; armv7hl) export ARCH=$MARCH ;; arm*) export ARCH=arm ;; # Unless $ARCH is already set, use uname -m for all other archs: *) export ARCH=$MARCH ;; esac fi case "$ARCH" in i?86) SLKCFLAGS="-O2 -march=${ARCH} -mtune=i686" SLKLDFLAGS=""; LIBDIRSUFFIX="" ;; x86_64) SLKCFLAGS="-O2 -fPIC" SLKLDFLAGS="-L/usr/lib64"; LIBDIRSUFFIX="64" ;; armv7hl) SLKCFLAGS="-O2 -march=armv7-a -mfpu=vfpv3-d16" SLKLDFLAGS=""; LIBDIRSUFFIX="" ;; *) SLKCFLAGS="-O2" SLKLDFLAGS=""; LIBDIRSUFFIX="" ;; esac case "$ARCH" in arm*) TARGET=$ARCH-slackware-linux-gnueabi ;; *) TARGET=$ARCH-slackware-linux ;; esac # Exit the script on errors: set -e trap 'echo "$0 FAILED at line $LINENO!" | tee $OUTPUT/error-${PRGNAM}.log' ERR # Catch unitialized variables: set -u P1=${1:-1} # Save old umask and set to 0022: _UMASK_=$(umask) umask 0022 # Prepare a sane build environment: mkdir -p $TMP/tmp-$PRGNAM # location to build the source rm -rf $TMP/tmp-$PRGNAM/* # remove the remnants of previous build mkdir -p $PKG # place for the package to be built rm -rf $PKG/* # erase old package's contents mkdir -p $OUTPUT # place for the package to be saved # Source file availability: if ! [ -f ${SOURCE} ]; then echo "Source '$(basename ${SOURCE})' not available yet..." # Check if the $SRCDIR is writable at all - if not, download to $OUTPUT [ -w "$SRCDIR" ] || SOURCE="$OUTPUT/$(basename $SOURCE)" if [ -f ${SOURCE} ]; then echo "Ah, found it!"; continue; fi if ! [ "x${SRCURL}" == "x" ]; then echo "Will download file to $(dirname $SOURCE)" wget -nv -T 20 -O "${SOURCE}" "${SRCURL}" || true if [ $? -ne 0 -o ! -s "${SOURCE}" ]; then echo "Downloading '$(basename ${SOURCE})' failed... aborting the build." mv -f "${SOURCE}" "${SOURCE}".FAIL exit 1 fi else echo "File '$(basename ${SOURCE})' not available... aborting the build." exit 1 fi fi if [ "$P1" == "--download" ]; then echo "Download complete." exit 0 fi # --- PACKAGE BUILDING --- echo "++" echo "|| $PRGNAM-$VERSION" echo "++" cd $TMP/tmp-$PRGNAM echo "Extracting the source archive(s) for $PRGNAM..." tar -xvf $SOURCE cd ${PRGNAM}-${VERSION} chown -R root:root . chmod -R u+w,go+r-w,a+rX-st . touch $OUTPUT/patch-${PRGNAM}.log # Specify the desired mirror in the update config file # http://www.iana.org/cctld/cctld-whois.htm sed -i "s/^\#DatabaseMirror.*/DatabaseMirror db.${ISOCC}.clamav.net/" \ etc/freshclam.conf.sample sed \ -e "s/^Example/#Example/" \ -e "s/^\#LogSyslog/LogSyslog/" \ -e "s/^\#LogFacility/LogFacility/" \ -e "s/^\#PidFile.*/PidFile \/var\/run\/clamav\/freshclam.pid/" \ -e "s/^\#UpdateLogFile.*/UpdateLogFile \/var\/log\/clamav\/freshclam.log/" \ -e "s/^\#AllowSupplementaryGroups.*/AllowSupplementaryGroups yes/" \ -e "s/^\#DatabaseOwner.*/DatabaseOwner clamav/" \ -e "s/^\#NotifyClamd.*/NotifyClamd \/etc\/clamd.conf/" \ -i etc/freshclam.conf.sample sed \ -e "s/^Example/#Example/" \ -e "s/^\#LogSyslog/LogSyslog/" \ -e "s/^\#LogFacility/LogFacility/" \ -e "s/^\#LogFile\ .*/LogFile \/var\/log\/clamav\/clamd.log/" \ -e "s/^\#PidFile.*/PidFile \/var\/run\/clamd.pid/" \ -e "s/^\#LocalSocket\ .*/LocalSocket \/var\/run\/clamav\/clamd.socket/" \ -e "s/^\#LocalSocketGroup.*/LocalSocketGroup clamav/" \ -e "s/^\#LocalSocketMode/LocalSocketMode/" \ -e "s/^\#FixStaleSocket/FixStaleSocket/" \ -e "s/^\#User.*/User clamav/" \ -e "s/^\#AllowSupplementaryGroups.*/AllowSupplementaryGroups yes/" \ -e "s/^\#ExitOnOOM/ExitOnOOM/" \ -i etc/clamd.conf.sample chown -R root:root . chmod -R u+w,go+r-w,a+X-s . # Compiling the package source: echo Building ... # Thanks to SlackBuilds.org, Matteo Bernardini : # Check if json-c is there: if it is, build over it to enable # the file properties collection and analysis feature # http://blog.clamav.net/2014/11/intro-to-collection-and-analysis-of.html if pkg-config --exists json-c ; then do_jsonc="--with-libjson" else do_jsonc="" fi # Slackware 15.0 and newer have postfix by default, so include milter support # only if we detect its presence: if [ -f /usr/lib${LIBDIRSUFFIX}/libmilter.a ]; then do_milter="--enable-milter" else do_milter="--disable-milter" fi # We need the "clamav" user and group to exist at the time of # configuring the software... # Add the 'clamav' group if it doesn't already exist: /usr/sbin/groupadd ${CLAMGRP} 2> /dev/null || true # Add the 'clamav' user if it doesn't exist already: /usr/sbin/useradd -c "ClamAV user" -g ${CLAMGRP} \ -s "/bin/false" ${CLAMUSR} 2> /dev/null || true LDFLAGS="$SLKLDFLAGS" \ CFLAGS="$SLKCFLAGS" \ CXXFLAGS="$SLKCFLAGS" \ ./configure \ --prefix=/usr \ --libdir=/usr/lib${LIBDIRSUFFIX} \ --localstatedir=/var \ --sysconfdir=/etc \ --mandir=/usr/man \ --with-user=${CLAMUSR} --with-group=${CLAMGRP} \ --with-dbdir=/usr/share/clamav \ --enable-id-check \ --enable-clamdtop \ --disable-check \ --disable-static \ --build=$TARGET \ $do_jsonc \ $do_milter \ 2>&1 | tee $OUTPUT/configure-${PRGNAM}.log # deprecated: #--with-libcurl --with-tcpwrappers \ make 2>&1 | tee $OUTPUT/make-${PRGNAM}.log # Install all the needed stuff to the package dir; make DESTDIR=$PKG install 2>&1 |tee $OUTPUT/install-${PRGNAM}.log # Prepare the config files: cd $PKG/etc mv clamd.conf.sample clamd.conf.new mv freshclam.conf.sample freshclam.conf.new mv clamav-milter.conf.sample clamav-milter.conf.new cd - # Where to store the pid, db and log files: mkdir -p $PKG/var/run/clamav mkdir -p $PKG/usr/share/clamav mkdir -p $PKG/var/log/clamav # Ensure that any db files are removed along with the package: touch \ $PKG/usr/share/clamav/main.cvd \ $PKG/usr/share/clamav/bytecode.cvd \ $PKG/usr/share/clamav/daily.cvd \ $PKG/usr/share/clamav/mirrors.dat # Our rc.d and logrotate scripts: mkdir -p $PKG/etc/rc.d/ install -D -m 0755 $SRCDIR/rc.clamav $PKG/etc/rc.d/rc.clamav.new install -D -m 0644 $SRCDIR/logrotate.clamav $PKG/etc/logrotate.d/clamav.new # Add a post-install script: mkdir -p $PKG/install cat < $PKG/install/doinst.sh # Handle the incoming configuration files: config() { for infile in \$1; do NEW="\$infile" OLD="\`dirname \$NEW\`/\`basename \$NEW .new\`" # If there's no config file by that name, mv it over: if [ ! -r \$OLD ]; then mv \$NEW \$OLD elif [ "\`cat \$OLD | md5sum\`" = "\`cat \$NEW | md5sum\`" ]; then # toss the redundant copy rm \$NEW fi # Otherwise, we leave the .new copy for the admin to consider... done } preserve_perms() { NEW="\$1" OLD="\$(dirname \$NEW)/\$(basename \$NEW .new)" if [ -e \$OLD ]; then cp -a \$OLD \${NEW}.incoming cat \$NEW > \${NEW}.incoming mv \${NEW}.incoming \$NEW fi config \$NEW } preserve_perms etc/rc.d/rc.clamav.new config etc/freshclam.conf.new config etc/clamd.conf.new config etc/clamav-milter.conf.new config etc/logrotate.d/clamav.new # Create log files touch var/log/clamav/clamd.log touch var/log/clamav/freshclam.log # Only way to create and use the correct uid and gid on the target system, # is to use chroot: chroot . </dev/null # Add the '${CLAMGRP}' group if it doesn't already exist: # Actually, the use of "amavis" group is for compatibility with amavisd-new. /usr/sbin/groupadd ${CLAMGRP} 2> /dev/null # Add the '${CLAMUSR}' user if it doesn't already exist: /usr/sbin/useradd -c "ClamAV user" \\ -g ${CLAMGRP} -s "/bin/false" ${CLAMUSR} 2> /dev/null # Restore the correct permissions chown ${CLAMUSR} usr/sbin/clamav-milter chmod 4700 usr/sbin/clamav-milter chown -R ${CLAMUSR}:${CLAMGRP} var/run/clamav chmod 771 var/run/clamav chown -R ${CLAMUSR}:${CLAMGRP} var/log/clamav chmod 770 var/log/clamav chmod 660 var/log/clamav/*.log chown -R ${CLAMUSR}:${CLAMGRP} usr/share/clamav chmod 770 usr/share/clamav chmod 660 usr/share/clamav/* EOR EOINS # --- End of 'doinst.sh' script ----------- # Add documentation: cp $SRCDIR/00README.slackware README.slackware DOCS="COPYING* ChangeLog.md \ docs/*.pdf docs/html examples \ README.slackware" mkdir -p $PKG/usr/doc/$PRGNAM-$VERSION cp -a $DOCS $PKG/usr/doc/$PRGNAM-$VERSION || true cat $SRCDIR/$(basename $0) > $PKG/usr/doc/$PRGNAM-$VERSION/$PRGNAM.SlackBuild chown -R root:root $PKG/usr/doc/$PRGNAM-$VERSION find $PKG/usr/doc -type f -exec chmod 644 {} \; # Compress the man page(s): find $PKG/usr/man -type f -name "*.?" -exec gzip -9f {} \; # Strip binaries: find $PKG | xargs file | grep -e "executable" -e "shared object" \ | grep ELF | cut -f 1 -d : | xargs strip --strip-unneeded 2> /dev/null # Add a package description: mkdir -p $PKG/install cat $SRCDIR/slack-desc > $PKG/install/slack-desc if [ -f $SRCDIR/doinst.sh ]; then cat $SRCDIR/doinst.sh >> $PKG/install/doinst.sh fi # Set ownership to root - the doinst.sh will set things straight again: chown -R root:root $PKG # Build the package: cd $PKG /sbin/makepkg --linkadd y --chown n $OUTPUT/$PRGNAM-$VERSION-$ARCH-${BUILD}${TAG}.tgz 2>&1 | tee $OUTPUT/makepkg-${PRGNAM}.log cd $OUTPUT md5sum $PRGNAM-$VERSION-$ARCH-${BUILD}${TAG}.tgz > $PRGNAM-$VERSION-$ARCH-${BUILD}${TAG}.tgz.md5 cd - cat $PKG/install/slack-desc | grep "^${PRGNAM}" > $OUTPUT/$PRGNAM-$VERSION-$ARCH-${BUILD}${TAG}.txt # Restore the original umask: umask ${_UMASK_} usr/doc/clamav-0.100.2/COPYING.YARA0100644000000000000000000002641413350521603014765 0ustar rootrootModified files from the YARA project exist in libclamav. These have file names with "yara_" prefixing the original yara file names. The YARA project uses the license below: Apache License Version 2.0, January 2004 http://www.apache.org/licenses/ TERMS AND CONDITIONS FOR USE, REPRODUCTION, AND DISTRIBUTION 1. Definitions. "License" shall mean the terms and conditions for use, reproduction, and distribution as defined by Sections 1 through 9 of this document. "Licensor" shall mean the copyright owner or entity authorized by the copyright owner that is granting the License. "Legal Entity" shall mean the union of the acting entity and all other entities that control, are controlled by, or are under common control with that entity. For the purposes of this definition, "control" means (i) the power, direct or indirect, to cause the direction or management of such entity, whether by contract or otherwise, or (ii) ownership of fifty percent (50%) or more of the outstanding shares, or (iii) beneficial ownership of such entity. "You" (or "Your") shall mean an individual or Legal Entity exercising permissions granted by this License. "Source" form shall mean the preferred form for making modifications, including but not limited to software source code, documentation source, and configuration files. "Object" form shall mean any form resulting from mechanical transformation or translation of a Source form, including but not limited to compiled object code, generated documentation, and conversions to other media types. "Work" shall mean the work of authorship, whether in Source or Object form, made available under the License, as indicated by a copyright notice that is included in or attached to the work (an example is provided in the Appendix below). "Derivative Works" shall mean any work, whether in Source or Object form, that is based on (or derived from) the Work and for which the editorial revisions, annotations, elaborations, or other modifications represent, as a whole, an original work of authorship. For the purposes of this License, Derivative Works shall not include works that remain separable from, or merely link (or bind by name) to the interfaces of, the Work and Derivative Works thereof. "Contribution" shall mean any work of authorship, including the original version of the Work and any modifications or additions to that Work or Derivative Works thereof, that is intentionally submitted to Licensor for inclusion in the Work by the copyright owner or by an individual or Legal Entity authorized to submit on behalf of the copyright owner. For the purposes of this definition, "submitted" means any form of electronic, verbal, or written communication sent to the Licensor or its representatives, including but not limited to communication on electronic mailing lists, source code control systems, and issue tracking systems that are managed by, or on behalf of, the Licensor for the purpose of discussing and improving the Work, but excluding communication that is conspicuously marked or otherwise designated in writing by the copyright owner as "Not a Contribution." "Contributor" shall mean Licensor and any individual or Legal Entity on behalf of whom a Contribution has been received by Licensor and subsequently incorporated within the Work. 2. Grant of Copyright License. Subject to the terms and conditions of this License, each Contributor hereby grants to You a perpetual, worldwide, non-exclusive, no-charge, royalty-free, irrevocable copyright license to reproduce, prepare Derivative Works of, publicly display, publicly perform, sublicense, and distribute the Work and such Derivative Works in Source or Object form. 3. Grant of Patent License. Subject to the terms and conditions of this License, each Contributor hereby grants to You a perpetual, worldwide, non-exclusive, no-charge, royalty-free, irrevocable (except as stated in this section) patent license to make, have made, use, offer to sell, sell, import, and otherwise transfer the Work, where such license applies only to those patent claims licensable by such Contributor that are necessarily infringed by their Contribution(s) alone or by combination of their Contribution(s) with the Work to which such Contribution(s) was submitted. If You institute patent litigation against any entity (including a cross-claim or counterclaim in a lawsuit) alleging that the Work or a Contribution incorporated within the Work constitutes direct or contributory patent infringement, then any patent licenses granted to You under this License for that Work shall terminate as of the date such litigation is filed. 4. Redistribution. You may reproduce and distribute copies of the Work or Derivative Works thereof in any medium, with or without modifications, and in Source or Object form, provided that You meet the following conditions: (a) You must give any other recipients of the Work or Derivative Works a copy of this License; and (b) You must cause any modified files to carry prominent notices stating that You changed the files; and (c) You must retain, in the Source form of any Derivative Works that You distribute, all copyright, patent, trademark, and attribution notices from the Source form of the Work, excluding those notices that do not pertain to any part of the Derivative Works; and (d) If the Work includes a "NOTICE" text file as part of its distribution, then any Derivative Works that You distribute must include a readable copy of the attribution notices contained within such NOTICE file, excluding those notices that do not pertain to any part of the Derivative Works, in at least one of the following places: within a NOTICE text file distributed as part of the Derivative Works; within the Source form or documentation, if provided along with the Derivative Works; or, within a display generated by the Derivative Works, if and wherever such third-party notices normally appear. The contents of the NOTICE file are for informational purposes only and do not modify the License. You may add Your own attribution notices within Derivative Works that You distribute, alongside or as an addendum to the NOTICE text from the Work, provided that such additional attribution notices cannot be construed as modifying the License. You may add Your own copyright statement to Your modifications and may provide additional or different license terms and conditions for use, reproduction, or distribution of Your modifications, or for any such Derivative Works as a whole, provided Your use, reproduction, and distribution of the Work otherwise complies with the conditions stated in this License. 5. Submission of Contributions. Unless You explicitly state otherwise, any Contribution intentionally submitted for inclusion in the Work by You to the Licensor shall be under the terms and conditions of this License, without any additional terms or conditions. Notwithstanding the above, nothing herein shall supersede or modify the terms of any separate license agreement you may have executed with Licensor regarding such Contributions. 6. Trademarks. This License does not grant permission to use the trade names, trademarks, service marks, or product names of the Licensor, except as required for reasonable and customary use in describing the origin of the Work and reproducing the content of the NOTICE file. 7. Disclaimer of Warranty. Unless required by applicable law or agreed to in writing, Licensor provides the Work (and each Contributor provides its Contributions) on an "AS IS" BASIS, WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied, including, without limitation, any warranties or conditions of TITLE, NON-INFRINGEMENT, MERCHANTABILITY, or FITNESS FOR A PARTICULAR PURPOSE. You are solely responsible for determining the appropriateness of using or redistributing the Work and assume any risks associated with Your exercise of permissions under this License. 8. Limitation of Liability. In no event and under no legal theory, whether in tort (including negligence), contract, or otherwise, unless required by applicable law (such as deliberate and grossly negligent acts) or agreed to in writing, shall any Contributor be liable to You for damages, including any direct, indirect, special, incidental, or consequential damages of any character arising as a result of this License or out of the use or inability to use the Work (including but not limited to damages for loss of goodwill, work stoppage, computer failure or malfunction, or any and all other commercial damages or losses), even if such Contributor has been advised of the possibility of such damages. 9. Accepting Warranty or Additional Liability. While redistributing the Work or Derivative Works thereof, You may choose to offer, and charge a fee for, acceptance of support, warranty, indemnity, or other liability obligations and/or rights consistent with this License. However, in accepting such obligations, You may act only on Your own behalf and on Your sole responsibility, not on behalf of any other Contributor, and only if You agree to indemnify, defend, and hold each Contributor harmless for any liability incurred by, or claims asserted against, such Contributor by reason of your accepting any such warranty or additional liability. END OF TERMS AND CONDITIONS APPENDIX: How to apply the Apache License to your work. To apply the Apache License to your work, attach the following boilerplate notice, with the fields enclosed by brackets "[]" replaced with your own identifying information. (Don't include the brackets!) The text should be enclosed in the appropriate comment syntax for the file format. We also recommend that a file or class name and description of purpose be included on the same "printed page" as the copyright notice for easier identification within third-party archives. Copyright [yyyy] [name of copyright owner] Licensed under the Apache License, Version 2.0 (the "License"); you may not use this file except in compliance with the License. You may obtain a copy of the License at http://www.apache.org/licenses/LICENSE-2.0 Unless required by applicable law or agreed to in writing, software distributed under the License is distributed on an "AS IS" BASIS, WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. See the License for the specific language governing permissions and limitations under the License. usr/doc/clamav-0.100.2/COPYING0100644000000000000000000004446213350521603014235 0ustar rootroot GNU GENERAL PUBLIC LICENSE Version 2, June 1991 Copyright (C) 1989, 1991 Free Software Foundation, Inc. 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA Everyone is permitted to copy and distribute verbatim copies of this license document, but changing it is not allowed. Preamble The licenses for most software are designed to take away your freedom to share and change it. By contrast, the GNU General Public License is intended to guarantee your freedom to share and change free software--to make sure the software is free for all its users. This General Public License applies to most of the Free Software Foundation's software and to any other program whose authors commit to using it. (Some other Free Software Foundation software is covered by the GNU Library General Public License instead.) You can apply it to your programs, too. When we speak of free software, we are referring to freedom, not price. Our General Public Licenses are designed to make sure that you have the freedom to distribute copies of free software (and charge for this service if you wish), that you receive source code or can get it if you want it, that you can change the software or use pieces of it in new free programs; and that you know you can do these things. To protect your rights, we need to make restrictions that forbid anyone to deny you these rights or to ask you to surrender the rights. These restrictions translate to certain responsibilities for you if you distribute copies of the software, or if you modify it. For example, if you distribute copies of such a program, whether gratis or for a fee, you must give the recipients all the rights that you have. You must make sure that they, too, receive or can get the source code. And you must show them these terms so they know their rights. We protect your rights with two steps: (1) copyright the software, and (2) offer you this license which gives you legal permission to copy, distribute and/or modify the software. Also, for each author's protection and ours, we want to make certain that everyone understands that there is no warranty for this free software. If the software is modified by someone else and passed on, we want its recipients to know that what they have is not the original, so that any problems introduced by others will not reflect on the original authors' reputations. Finally, any free program is threatened constantly by software patents. We wish to avoid the danger that redistributors of a free program will individually obtain patent licenses, in effect making the program proprietary. To prevent this, we have made it clear that any patent must be licensed for everyone's free use or not licensed at all. The precise terms and conditions for copying, distribution and modification follow. GNU GENERAL PUBLIC LICENSE TERMS AND CONDITIONS FOR COPYING, DISTRIBUTION AND MODIFICATION 0. This License applies to any program or other work which contains a notice placed by the copyright holder saying it may be distributed under the terms of this General Public License. The "Program", below, refers to any such program or work, and a "work based on the Program" means either the Program or any derivative work under copyright law: that is to say, a work containing the Program or a portion of it, either verbatim or with modifications and/or translated into another language. (Hereinafter, translation is included without limitation in the term "modification".) Each licensee is addressed as "you". Activities other than copying, distribution and modification are not covered by this License; they are outside its scope. The act of running the Program is not restricted, and the output from the Program is covered only if its contents constitute a work based on the Program (independent of having been made by running the Program). Whether that is true depends on what the Program does. 1. You may copy and distribute verbatim copies of the Program's source code as you receive it, in any medium, provided that you conspicuously and appropriately publish on each copy an appropriate copyright notice and disclaimer of warranty; keep intact all the notices that refer to this License and to the absence of any warranty; and give any other recipients of the Program a copy of this License along with the Program. You may charge a fee for the physical act of transferring a copy, and you may at your option offer warranty protection in exchange for a fee. 2. You may modify your copy or copies of the Program or any portion of it, thus forming a work based on the Program, and copy and distribute such modifications or work under the terms of Section 1 above, provided that you also meet all of these conditions: a) You must cause the modified files to carry prominent notices stating that you changed the files and the date of any change. b) You must cause any work that you distribute or publish, that in whole or in part contains or is derived from the Program or any part thereof, to be licensed as a whole at no charge to all third parties under the terms of this License. c) If the modified program normally reads commands interactively when run, you must cause it, when started running for such interactive use in the most ordinary way, to print or display an announcement including an appropriate copyright notice and a notice that there is no warranty (or else, saying that you provide a warranty) and that users may redistribute the program under these conditions, and telling the user how to view a copy of this License. (Exception: if the Program itself is interactive but does not normally print such an announcement, your work based on the Program is not required to print an announcement.) These requirements apply to the modified work as a whole. If identifiable sections of that work are not derived from the Program, and can be reasonably considered independent and separate works in themselves, then this License, and its terms, do not apply to those sections when you distribute them as separate works. But when you distribute the same sections as part of a whole which is a work based on the Program, the distribution of the whole must be on the terms of this License, whose permissions for other licensees extend to the entire whole, and thus to each and every part regardless of who wrote it. Thus, it is not the intent of this section to claim rights or contest your rights to work written entirely by you; rather, the intent is to exercise the right to control the distribution of derivative or collective works based on the Program. In addition, mere aggregation of another work not based on the Program with the Program (or with a work based on the Program) on a volume of a storage or distribution medium does not bring the other work under the scope of this License. 3. You may copy and distribute the Program (or a work based on it, under Section 2) in object code or executable form under the terms of Sections 1 and 2 above provided that you also do one of the following: a) Accompany it with the complete corresponding machine-readable source code, which must be distributed under the terms of Sections 1 and 2 above on a medium customarily used for software interchange; or, b) Accompany it with a written offer, valid for at least three years, to give any third party, for a charge no more than your cost of physically performing source distribution, a complete machine-readable copy of the corresponding source code, to be distributed under the terms of Sections 1 and 2 above on a medium customarily used for software interchange; or, c) Accompany it with the information you received as to the offer to distribute corresponding source code. (This alternative is allowed only for noncommercial distribution and only if you received the program in object code or executable form with such an offer, in accord with Subsection b above.) The source code for a work means the preferred form of the work for making modifications to it. For an executable work, complete source code means all the source code for all modules it contains, plus any associated interface definition files, plus the scripts used to control compilation and installation of the executable. However, as a special exception, the source code distributed need not include anything that is normally distributed (in either source or binary form) with the major components (compiler, kernel, and so on) of the operating system on which the executable runs, unless that component itself accompanies the executable. If distribution of executable or object code is made by offering access to copy from a designated place, then offering equivalent access to copy the source code from the same place counts as distribution of the source code, even though third parties are not compelled to copy the source along with the object code. 4. You may not copy, modify, sublicense, or distribute the Program except as expressly provided under this License. Any attempt otherwise to copy, modify, sublicense or distribute the Program is void, and will automatically terminate your rights under this License. However, parties who have received copies, or rights, from you under this License will not have their licenses terminated so long as such parties remain in full compliance. 5. You are not required to accept this License, since you have not signed it. However, nothing else grants you permission to modify or distribute the Program or its derivative works. These actions are prohibited by law if you do not accept this License. Therefore, by modifying or distributing the Program (or any work based on the Program), you indicate your acceptance of this License to do so, and all its terms and conditions for copying, distributing or modifying the Program or works based on it. 6. Each time you redistribute the Program (or any work based on the Program), the recipient automatically receives a license from the original licensor to copy, distribute or modify the Program subject to these terms and conditions. You may not impose any further restrictions on the recipients' exercise of the rights granted herein. You are not responsible for enforcing compliance by third parties to this License. 7. If, as a consequence of a court judgment or allegation of patent infringement or for any other reason (not limited to patent issues), conditions are imposed on you (whether by court order, agreement or otherwise) that contradict the conditions of this License, they do not excuse you from the conditions of this License. If you cannot distribute so as to satisfy simultaneously your obligations under this License and any other pertinent obligations, then as a consequence you may not distribute the Program at all. For example, if a patent license would not permit royalty-free redistribution of the Program by all those who receive copies directly or indirectly through you, then the only way you could satisfy both it and this License would be to refrain entirely from distribution of the Program. If any portion of this section is held invalid or unenforceable under any particular circumstance, the balance of the section is intended to apply and the section as a whole is intended to apply in other circumstances. It is not the purpose of this section to induce you to infringe any patents or other property right claims or to contest validity of any such claims; this section has the sole purpose of protecting the integrity of the free software distribution system, which is implemented by public license practices. Many people have made generous contributions to the wide range of software distributed through that system in reliance on consistent application of that system; it is up to the author/donor to decide if he or she is willing to distribute software through any other system and a licensee cannot impose that choice. This section is intended to make thoroughly clear what is believed to be a consequence of the rest of this License. 8. If the distribution and/or use of the Program is restricted in certain countries either by patents or by copyrighted interfaces, the original copyright holder who places the Program under this License may add an explicit geographical distribution limitation excluding those countries, so that distribution is permitted only in or among countries not thus excluded. In such case, this License incorporates the limitation as if written in the body of this License. 9. The Free Software Foundation may publish revised and/or new versions of the General Public License from time to time. Such new versions will be similar in spirit to the present version, but may differ in detail to address new problems or concerns. Each version is given a distinguishing version number. If the Program specifies a version number of this License which applies to it and "any later version", you have the option of following the terms and conditions either of that version or of any later version published by the Free Software Foundation. If the Program does not specify a version number of this License, you may choose any version ever published by the Free Software Foundation. 10. If you wish to incorporate parts of the Program into other free programs whose distribution conditions are different, write to the author to ask for permission. For software which is copyrighted by the Free Software Foundation, write to the Free Software Foundation; we sometimes make exceptions for this. Our decision will be guided by the two goals of preserving the free status of all derivatives of our free software and of promoting the sharing and reuse of software generally. NO WARRANTY 11. BECAUSE THE PROGRAM IS LICENSED FREE OF CHARGE, THERE IS NO WARRANTY FOR THE PROGRAM, TO THE EXTENT PERMITTED BY APPLICABLE LAW. EXCEPT WHEN OTHERWISE STATED IN WRITING THE COPYRIGHT HOLDERS AND/OR OTHER PARTIES PROVIDE THE PROGRAM "AS IS" WITHOUT WARRANTY OF ANY KIND, EITHER EXPRESSED OR IMPLIED, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. THE ENTIRE RISK AS TO THE QUALITY AND PERFORMANCE OF THE PROGRAM IS WITH YOU. SHOULD THE PROGRAM PROVE DEFECTIVE, YOU ASSUME THE COST OF ALL NECESSARY SERVICING, REPAIR OR CORRECTION. 12. IN NO EVENT UNLESS REQUIRED BY APPLICABLE LAW OR AGREED TO IN WRITING WILL ANY COPYRIGHT HOLDER, OR ANY OTHER PARTY WHO MAY MODIFY AND/OR REDISTRIBUTE THE PROGRAM AS PERMITTED ABOVE, BE LIABLE TO YOU FOR DAMAGES, INCLUDING ANY GENERAL, SPECIAL, INCIDENTAL OR CONSEQUENTIAL DAMAGES ARISING OUT OF THE USE OR INABILITY TO USE THE PROGRAM (INCLUDING BUT NOT LIMITED TO LOSS OF DATA OR DATA BEING RENDERED INACCURATE OR LOSSES SUSTAINED BY YOU OR THIRD PARTIES OR A FAILURE OF THE PROGRAM TO OPERATE WITH ANY OTHER PROGRAMS), EVEN IF SUCH HOLDER OR OTHER PARTY HAS BEEN ADVISED OF THE POSSIBILITY OF SUCH DAMAGES. END OF TERMS AND CONDITIONS How to Apply These Terms to Your New Programs If you develop a new program, and you want it to be of the greatest possible use to the public, the best way to achieve this is to make it free software which everyone can redistribute and change under these terms. To do so, attach the following notices to the program. It is safest to attach them to the start of each source file to most effectively convey the exclusion of warranty; and each file should have at least the "copyright" line and a pointer to where the full notice is found. Copyright (C) This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. You should have received a copy of the GNU General Public License along with this program; if not, write to the Free Software Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA Also add information on how to contact you by electronic and paper mail. If the program is interactive, make it output a short notice like this when it starts in an interactive mode: Gnomovision version 69, Copyright (C) year name of author Gnomovision comes with ABSOLUTELY NO WARRANTY; for details type `show w'. This is free software, and you are welcome to redistribute it under certain conditions; type `show c' for details. The hypothetical commands `show w' and `show c' should show the appropriate parts of the General Public License. Of course, the commands you use may be called something other than `show w' and `show c'; they could even be mouse-clicks or menu items--whatever suits your program. You should also get your employer (if you work as a programmer) or your school, if any, to sign a "copyright disclaimer" for the program, if necessary. Here is a sample; alter the names: Yoyodyne, Inc., hereby disclaims all copyright interest in the program `Gnomovision' (which makes passes at compilers) written by James Hacker. , 1 April 1989 Ty Coon, President of Vice This General Public License does not permit incorporating your program into proprietary programs. If your program is a subroutine library, you may consider it more useful to permit linking proprietary applications with the library. If this is what you want to do, use the GNU Library General Public License instead of this License. REGARDING OPENSSL In addition, as a special exception, the copyright holders give permission to link the code of portions of this program with the OpenSSL library under certain conditions as described in each individual source file, and distribute linked combinations including the two. You must obey the GNU General Public License in all respects for all of the code used other than OpenSSL. If you modify file(s) with this exception, you may extend this exception to your version of the file(s), but you are not obligated to do so. If you do not wish to do so, delete this exception statement from your version. If you delete this exception statement from all source files in the program, then also delete it here. usr/doc/clamav-0.100.2/README.slackware0100644000000000000000000000361713365330317016040 0ustar rootrootAlthough the package comes pre-configured you must edit /etc/clamd.conf and /etc/freshclam.conf to at least remove the "Example" option. The package contains an start/stop script: /etc/rc.d/rc.clamav. I would suggest calling this script from /etc/rc.d/rc.M just before Sendmail is started with code like: # Starting ClamAV daemons if [ -x /etc/rc.d/rc.clamav ]; then /etc/rc.d/rc.clamav start fi The start/stop script will start: clamd, freshclam and clamav-milter. A user and group "clamav" were added your system for ClamAV to use. To use clamav-milter your Sendmail will have to be compiled with milter support, like Slackware's Sendmail package does (as of V10.0). ClamAV, Amavisd-new and SpamAssassin ------------------------------------ You might want to use amavisd-new to act as an intermediary between Sendmail and ClamAV (and possible SpamAssassin too). Amavisd-new can be downloaded at http://www.ijs.si/software/amavisd/ For clamd to be able to scan messages, when called by Amavisd-new, you must add "clamav" to the "amavis" group (provided that clamd.conf contains the "User clamav" directive), e.g. run: # usermod -G $(id -Gn clamav | tr ' ' ','),amavis clamav Be sure to enable "AllowSupplementaryGroups" in clamd.conf and restart clamd. Also, th enable Amavisd-new to scan ClamAV's log files and produce nice statistics, the reverse must be done too; add user "amavis" to the group "clamav" as follows: # usermod -G $(id -Gn amavis | tr ' ' ','),clamav amavis Add the rc.amavisd script to your /etc/rc.d/rc/M script inbetween the start of clamav and sendmail, so that the relevant section looks like this: # Starting ClamAV daemon: if [ -x /etc/rc.d/rc.clamav ]; then /etc/rc.d/rc.clamav start fi # Starting Amavisd daemon: if [ -x /etc/rc.d/rc.amavisd ]; then /etc/rc.d/rc.amavisd start fi # Start the sendmail daemon: if [ -x /etc/rc.d/rc.sendmail ]; then . /etc/rc.d/rc.sendmail start fi usr/doc/clamav-0.100.2/COPYING.getopt0100644000000000000000000000214513350521603015526 0ustar rootrootgetopt.c - my re-implementation of getopt. Copyright 1997, 2000, 2001, 2002, 2006, Benjamin Sittler Permission is hereby granted, free of charge, to any person obtaining a copy of this software and associated documentation files (the "Software"), to deal in the Software without restriction, including without limitation the rights to use, copy, modify, merge, publish, distribute, sublicense, and/or sell copies of the Software, and to permit persons to whom the Software is furnished to do so, subject to the following conditions: The above copyright notice and this permission notice shall be included in all copies or substantial portions of the Software. THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. usr/doc/clamav-0.100.2/examples/0040755000000000000000000000000013350521603015011 5ustar rootrootusr/doc/clamav-0.100.2/examples/ex1.c0100644000000000000000000000552113350521603015652 0ustar rootroot/* * Compilation: gcc -Wall ex1.c -o ex1 -lclamav * * Copyright (C) 2015 Cisco Systems, Inc. and/or its affiliates. All rights reserved. * Copyright (C) 2007 - 2009 Sourcefire, Inc. * Author: Tomasz Kojm * * This program is free software; you can redistribute it and/or modify * it under the terms of the GNU General Public License as published by * the Free Software Foundation; either version 2 of the License, or * (at your option) any later version. * * This program is distributed in the hope that it will be useful, * but WITHOUT ANY WARRANTY; without even the implied warranty of * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the * GNU General Public License for more details. * * You should have received a copy of the GNU General Public License * along with this program; if not, write to the Free Software * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, * MA 02110-1301, USA. */ #include #include #include #include #include #include #include #include /* * Exit codes: * 0: clean * 1: infected * 2: error */ int main(int argc, char **argv) { int fd, ret; unsigned long int size = 0; unsigned int sigs = 0; long double mb; const char *virname; struct cl_engine *engine; if(argc != 2) { printf("Usage: %s file\n", argv[0]); return 2; } if((fd = open(argv[1], O_RDONLY)) == -1) { printf("Can't open file %s\n", argv[1]); return 2; } if((ret = cl_init(CL_INIT_DEFAULT)) != CL_SUCCESS) { printf("Can't initialize libclamav: %s\n", cl_strerror(ret)); return 2; } if(!(engine = cl_engine_new())) { printf("Can't create new engine\n"); return 2; } /* load all available databases from default directory */ if((ret = cl_load(cl_retdbdir(), engine, &sigs, CL_DB_STDOPT)) != CL_SUCCESS) { printf("cl_load: %s\n", cl_strerror(ret)); close(fd); cl_engine_free(engine); return 2; } printf("Loaded %u signatures.\n", sigs); /* build engine */ if((ret = cl_engine_compile(engine)) != CL_SUCCESS) { printf("Database initialization error: %s\n", cl_strerror(ret));; cl_engine_free(engine); close(fd); return 2; } /* scan file descriptor */ if((ret = cl_scandesc(fd, &virname, &size, engine, CL_SCAN_STDOPT)) == CL_VIRUS) { printf("Virus detected: %s\n", virname); } else { if(ret == CL_CLEAN) { printf("No virus detected.\n"); } else { printf("Error: %s\n", cl_strerror(ret)); cl_engine_free(engine); close(fd); return 2; } } close(fd); /* free memory */ cl_engine_free(engine); /* calculate size of scanned data */ mb = size * (CL_COUNT_PRECISION / 1024) / 1024.0; printf("Data scanned: %2.2Lf MB\n", mb); return ret == CL_VIRUS ? 1 : 0; } usr/doc/clamav-0.100.2/examples/fileprop_analysis/0040755000000000000000000000000013350521603020534 5ustar rootrootusr/doc/clamav-0.100.2/examples/fileprop_analysis/analysis.cud0100644000000000000000000003404113350521603023053 0ustar rootrootClamAV-VDB:04 Mar 2015 13-58 -0500:246:4:80:522e2d42f00de65ececc1999e53ac3b9:X:clamav:1425495515 }s}ݩGt%v֖96"yE:9~3Jam~ g(V=,M _h4xa~{=~ߏO=?_'Ï ޽/ljv}g ߍe8y([oug'p ̰p*ܠgx6Vb0N`nQONGjEB oJg'OON;yt|f2[K[oi m5{`Znm+)1m شlh@hLӁui ˣ(w`Ysn< e3H€+-l3KBpH Gc&jbxƈ,1b:06+A60m<|+噋Lw-g51( y:t#embLdpn w\SjI3o\;u ׶&@pŦ;xp-2s]g - y[3c(|phf w/5[a֌+p*J5S2h9{o'`](>;(nP`6EQ8dnx͠/Bm:_`lnLW?]g暡s/ ΃@ P0a@-udæcXJ cM7hDu7}Ac;* wEC]n7 oD0vy<Y:H[غM$Cp*^rmg+C]G2>3ţ `Xܭ m*JrgNbnx8\5`nj5B{ d&6m@8uq6Oyv>qQQLM@9N.bGAzOWp7VZ:Aц-(#w`n1F@[\2p`] [tC . d9fphc@"Khn;06x'7"B;4`]ϪaQ[EM`XlnG L-Kvmh491 / 7!8kg$A#Ǟ{sp4 +͵l-8 h,Nxf+"@+c5zڻ7okBmxТd0DØ(DM G} %i&6y.4G9[{h%g^S9­}%[/ (4K˟0= ._ϗWqa5r^_/az~x=35]/΋JOq̍  nvdnSh\~2q(wo&@ܸIY6pjh% |s hP3֊v&ԉw6nA75GDw 7x"iApvMbK`MeFx0( |[tqnj4q޵Ʋ͖]t^ch5G[Hb /u[tF|YiiklpSy0C?`8ձb υ=;5Fv `]h4^H O}0Dooie͠1=Qs61քQ&L.,{/n# ¦c06p^~ 7@pp nZ[!M=={yIzH ?pt;hq; giod_Qn<m:P ރٯ8ثqr16[B~ؑ'щIpC{/srFz(pO-g@e]*)kV )#:,Ln>.ZmI&#=ol7mK"Fn_zE1WAΏFUv PP1;v&`oLnk1,o~f.zsVp2򮅭 '2r'LBqVvgao%RviE.$+)88(gMECXfBܓi.e.Ƈ}15.-\m` 5{6PQU c`WZ}s'vv2m|-T6`uk΅9ߤ>s;gA6&a St݆b`9QB n$ 6Qd?Ԟs;O06xF]썑I,ű\bEƻ.r.Eө-t4-bQ,`Pct+w^mh=!nSdüc쥲mdfib 1Ny 1uM[*HYfP{5l&X"A>AM#{ 5Qym \Yy4t򮅏cAVBtPs#ظv66JFj@aFl  hS΅I\O7 {фaQQG)Ư]LJrnM<nX{f){&4m\]LMՠۈ:øӊ5# s/!i }j10w 쑊c?i llk"OhfnBe6f7F2x$,C^ ?w6&6f3 %Ӌ)YMglTda$QP38]`"X]=3JDFIHn0̈́>*ިi+P;6n tč8oVqV_ gGzX'"C hil G‘[XťW72hq (e;#LN{\Fb5{V&ah;@LXpuV;ADױR,6uί]j'SL'??>}Eoq|m:Yo:芤; 10-CpLGGmi:Ӛ= x \{؆DQ= +,!(f(f tX1]mﰛymܭYeܻB".ʹߠ ꌳLvPK:r0|F x9}WЈB^lcX\#|05dDQ3u0:`6PTའ:Z0o"}7? CSh}=r>!? CZhqŻ$c#6 t٘ 1rGKq6]T{:] M6 ЁSwĖ\5{Wc'Y 4??iNrzP''GP^M/f|;w?^N"b_Û .gX]`r|;_%]4_.gw毦 Φjn ˷_,5r~#,Ż..ognzŻˋL}3]| 2_x쉇70=6?=|vv -%zw6'P_?͗װ,ߛ[piv|9-g7lHgKxbvQ .HӾw7?M_;"/‡G^7ygofgpfIދ%\^X.8).gKWWy-G0? <;_b?\KX_ ..a ollyf,Zld<;X6iF.ab:SX,I&$ǣ"h6¤uM%x8#mnaF2F00!e /ۘ܄.k 7Cq6Ee8 :,a)6-jNykӱ4ل~r'T`ucX Nvri%?Ȯw@N -[ rA:-gøPgs]3T]nۣݰ= 7{( GyAð;퐐\kjF`|g=7-"}v@O][M M2jcpANk@\nw1bՁв݀ v}wSckmL;,6qnܖ=<{0rzeNn_tvp0 6|ۧ ˂.|p*5Ŗnnr5{mQD06.d:/ bW $iwmbEbT$,98ڛN?{^@0w;wxlnϲ.a l~ y 24`>ESdt8~ LIcX=y;̫w=*HRt 7$7uK7Y..g?N/_w(`ecCJ4Ʈ2UbkWmuN5,N?؁NxC1`u1.=Q'K%c1\w{JR(v[#M5=DŽJ{K9S?BNf2p}S[tcx;oH)2%CrÁ{X8G=&+H{*M=m`$ܟǏ~|ӯgsl?c =~q/닿 xϟ<9yRpK,18$^z ^<=OcӓuBO?z&O=z|S)<{Bٓ'_HGO={*ONc Vϟ<=='N? ?* k ?>=yB x 飓ϟ==<>F:>9Nrs~qǧߟ)6{?9=>9̧O'ώ|DL>Ó'ϏTGǏO{u8ɣ'OǏ:6_B]dNo+(J jVJX2 -"J4 g0+zbi<kwW,YJD%%k kkfZ13k&dD*B$*BT;.G_QREjZZZ"ŌH&ɿRB;ecvJ(RUUoDHhY T1+Ҥ"]U7B)Z94i1U9&HXIiҨv(VVi%uPo<%L=iu9ۏImtYU*RUwR{*i'h7JZW2) [YIQY mV*jj-:EJQns(*~V/+𕬰K!KJJKTQU%RɒTyJVPԥ/+jT4l\]VdB,Ke%qRpɲd+.%ɲR).-,V)RK(_Ni!FrVT5Da?d$UT!V4σݾ{REBI%D)QT2RE #b_J"zҟD\"BXTj$A-OuUV(cC5eT$D5"^f) 6*iI"^mA"U q-ܔE"6EIQSMk-KvBU0I"#©KDxD$$TT!UDX)JDRJ?e5:$fk"Ta;WhҏBHD}o45Tt(me "-" "4FmŗrHEowh@ I?f"nL"$"J"*( 0҇H$qjphE(jj%"tȈ&l5!Jr)*z))VL1/(D0!C+"芨"ZUUK˖fB̂DJ+&f5D$d+lI(QV Md@3k"b*R%U$+g+2J*PEըHj+1NQb%tEW䨐XKkĠ#*FRب"j)*M:"F)eP6)* R*hiƐ C(z!R`ǵtɕt,eB2w%;ieE(+6"ܴ6 8EdRHǍde#WˆZ8fQQ+*ҢuUH6I+Q6HɆMH+Ov`h$+UE%;n%ʚʊHPbHJjFWکkM2j%!H8xCg]%uIǘb$BZ"/-DjJU?rRF5*QHK-t4ꊌjUSMNU: T (},0ɐVzAԬI[UQK(Vb*1]|ZS*'5+ґjs*;ޙ kMDB7i*BDCUJ,vnp'z=C+Q$ևvwiSij*MwGfeLh+F4?{6E7%GXY:FILpz wѪ&襝RҪ8!wZZPS&JTdTEhE+2*æ%U4#'a&>^ D?6"2eh75A8IF2%ak?j;uġZ?6>{TVI56p #5LaZ~FHk"UE+B'lYV27٪8yȘ`,'ؾ;2D)bѤY)ͅy> qLsC7D}\R;(jk{83qE@#kJ%Iknʣ3QՎ!qN={dTLIy}ıB)UZ%T*=+hXR{n G|,4kR2ig+X[%<\خJs|׋~LJ?'OfO_cħ?4k>Wgn?-fMv.f-~|=׳_:S^/~9TsL՚Ik&X3I$4i&Lfr*V15iQLbjTrh}ekI b-I֒$XKrukKj\&׾$Ql1b55LUe1BEB}^JOWO d}Pwy EZV/+'EK'KRʗO^qYq)eES\6eE|NN5maL=hL'{+.,,Y,I j?RtyJSҩ"bEeJTeEUSeERVuj"]mTTV$]:~!oҌiM ]J]NGp-)er%K+K'Kͥ/+j\pB/M`|qG5[v2[3[8/nHרFV(1Tۡ|9g˩}G=0};pÏ'}ާ{>g̐ PP,>uq/]w_}W>laR*K"&$Q#D#\"DX^GF"RɪQ."lDD*?4 LPUihE@,&< U*6Qlh&@PQE&"REf:h_UJl#d*"ľ!zU!D}pe)*$*Z8>*DR cȫD^ݓwcVTd2ychzBHml %"HxUd0U,\MkŦ(ݵY.JDjjjB+1^% %"tQ)jbEENۄm!F",JDR|QDIċo& )lMd8_4F.1jYR(AjV Rs 5+"TcZՔRVe;D RK{:cJ}%HW}55HxCE}E"ž"9$[b_bII1ԤӤ I5)4)HQŞ&^YӤjRiR4)VTTMH+4)&)"L$Y}M Ց~+U)0)Drb_VDWj%U)CU=e(Kȱȅ$dcRMSJxX,jVr,%r,-"劐ʊRD*PFIBL+Rɪ$+dGJҕ EHV#Rj+JxK%%x,rCA+X  UPWTU%D$(Tf\JQU{B<fx=L$ U{1<՞`Y fĒdlL3L'v$#*%"$㘴Z&iDUV{A;E$/K$]ŋB9jTc0j!sJj$"ip*>YI.V'ޮDU=fx3Sە"b¤=Vff[[;FLKěSL*u'g QSͤcIzoј+B*-VV"4trVYWB%!xr{D%-O1WeV"tËMTQ"ju6@z35g? =TS$LUT\Qs#*n_vɚ[HΆ~᝹ŧXJQl$KwlJZf۷dU(w"C@ oa{jh@B/r w 3i.Lj/@=J/>;SHɛZ@e\*F|tlfI;UhFgK(10E UtX,gP BES{C CC]g? Q=7tϢ 8gTa$(7?O^7?{HjlW=ϦhG8k#<,~cmGp0?㓧OT_O.{2~PkWdUQz1TQ.Wó6֡8㯺s"?Oҹ0t._DT)&LwRK 1y'c·Ws>:^fBR#!Y|x·?w}23>v؃k9';d>J\tC<޷^;sNyt}S5USJIN'SuLKR5Y̹hrW}.ʦ=w墯ۢW)mݮhDfnS2ij+lc2dO!qK(ۦCs $RTL^zCcFN^F}bU唴 NI\5L-$t}P3 E'MIi5>W©#"+B5m҆O-*eASvLDN%۲u$!;$U*OA,*`5{IrM- 4v ^A%yOr|kDl+R#M"""Dj[+J Dj]sZ H6]~GI-!R%{# 4H"pHߢH/ ABWI8H Hh,$w)"b!"6~~@}Td]W6 |#DM|6iq+H#=DYHĸeHMEUQ$Ddt2J%ImJ䍇N,G1m%ˉSL$s(^"!F&%i7IߴD+HU1UEWV޸e*6Xjo]K6[SEғ7w{zI}GP1Y6zW[aU~S{LT]7zY&dN9%uPٯ{55Z STR_MAXLEN) strlen = STR_MAXLEN; /* acquire string data, note strlen includes NULL terminator */ if (json_get_string(str, strlen, obj)) { /* debug print str (with '\n' and prepended message */ debug_print_str(str,strlen); /* check the contained object's type */ if (strlen == 14 && !memcmp(str, "CL_TYPE_MSEXE", 14)) { //if (!strcmp(str, strlen, "CL_TYPE_MSEXE", strlen)) { /* alert for submission */ root = 1; } } } debug_print_uint(root); /* acquire array of internal contained objects */ objarr = json_get_object("ContainedObjects", 16, 0); if (objarr <= 0) { if (root) foundVirus("Root"); return 0; } type = json_get_type(objarr); /* debug print uint (no '\n' or prepended message */ debug_print_uint(type); if (type != JSON_TYPE_ARRAY) { return -1; } /* check array length for iteration over elements */ arrlen = json_get_array_length(objarr); for (i = 0; i < arrlen; ++i) { /* acquire json object @ idx i */ objit = json_get_array_idx(i, objarr); if (objit <= 0) continue; /* acquire FileType object of the array element @ idx i */ obj = json_get_object("FileType", 8, objit); if (obj <= 0) continue; /* acquire and check type */ type = json_get_type(obj); if (type == JSON_TYPE_STRING) { /* acquire string length, note +1 is for the NULL terminator */ strlen = json_get_string_length(obj)+1; /* prevent buffer overflow */ if (strlen > STR_MAXLEN) strlen = STR_MAXLEN; /* acquire string data, note strlen includes NULL terminator */ if (json_get_string(str, strlen, obj)) { /* debug print str (with '\n' and prepended message */ debug_print_str(str,strlen); /* check the contained object's type */ if (strlen == 14 && !memcmp(str, "CL_TYPE_MSEXE", 14)) { //if (!strcmp(str, strlen, "CL_TYPE_MSEXE", strlen)) { /* alert for submission */ embedded = 1; break; } } } } debug_print_uint(root); debug_print_uint(embedded); if (root && embedded) { foundVirus("RootEmbedded"); } else if (root) { foundVirus("Root"); } else if (embedded) { foundVirus("Embedded"); } return 0; } usr/doc/clamav-0.100.2/examples/fileprop_analysis/sandbox.c0100644000000000000000000000063613350521603022340 0ustar rootrootVIRUSNAME_PREFIX("SUBMIT") VIRUSNAMES("Sandbox") /* Target type is 0, all relevant files */ TARGET(0) /* Declares to run bytecode only for preclassification (affecting only preclass files) */ PRECLASS_HOOK_DECLARE /* JSON API call will require FUNC_LEVEL_098_5 = 78 */ /* PRECLASS_HOOK_DECLARE will require FUNC_LEVEL_098_7 = 80 */ FUNCTIONALITY_LEVEL_MIN(FUNC_LEVEL_098_7) int entrypoint () { return 0; } usr/doc/clamav-0.100.2/examples/fileprop_analysis/notpdf_sample.c0100644000000000000000000000274713350521603023542 0ustar rootrootVIRUSNAME_PREFIX("SUBMIT.NotPDF") VIRUSNAMES("InActive", "Submit") /* Target type is 0, all relevant files */ TARGET(0) /* Declares to run bytecode only for preclassification (affecting only preclass files) */ PRECLASS_HOOK_DECLARE /* JSON API call will require FUNC_LEVEL_098_5 = 78 */ /* PRECLASS_HOOK_DECLARE will require FUNC_LEVEL_098_7 = 80 */ FUNCTIONALITY_LEVEL_MIN(FUNC_LEVEL_098_7) #define STR_MAXLEN 256 int entrypoint () { int32_t type, obj, strlen; char str[STR_MAXLEN]; /* check is json is available, alerts on inactive (optional) */ if (!json_is_active()) { return -1; } /* acquire array of internal contained objects */ obj = json_get_object("FileType", 8, 0); if (obj <= 0) return -1; /* acquire and check type */ type = json_get_type(obj); if (type == JSON_TYPE_STRING) { /* acquire string length, note +1 is for the NULL terminator */ strlen = json_get_string_length(obj)+1; /* prevent buffer overflow */ if (strlen > STR_MAXLEN) strlen = STR_MAXLEN; /* acquire string data, note strlen includes NULL terminator */ if (json_get_string(str, strlen, obj)) { /* debug print str (with '\n' and prepended message */ debug_print_str(str,strlen); /* check the contained object's type */ if (!(strlen == 12) || !memcmp(str, "CL_TYPE_PDF", 12)) { foundVirus("Submit"); } } } return 0; } usr/doc/clamav-0.100.2/examples/fileprop_analysis/old/0040755000000000000000000000000013350521603021312 5ustar rootrootusr/doc/clamav-0.100.2/examples/fileprop_analysis/old/analysis.cud0100644000000000000000000003436213350521603023637 0ustar rootrootClamAV-VDB:03 Jul 2014 13-14 -0400:243:4:78:d6dd071e4bb38792271c937e508b5d6e:X:klin:1404407650 ]w.|nr^Hygmӱf#tP@C8hP\f7Eɲd3ǚFBPӳ=_~'>OP;}N_"6_wY8-GEj㍮ϏgS=qvVxX 1*qOt]pv?OGGa>-`v~,`ž5!@J :0\' VP#v ҉u6LDV0X]<(x[j(5:PC]8zɝ6Rpɀ׸[ByfZ=ZI`0܀p6xBQVlcQK18^GaJy"AKnBg<`Ӏ ;6]1& 2iZ5;.)5*݀VBpv.au:\k[ bE[92 &١['Q{%:rk4j&Inn-j \jLGyYwIYa:pBظ5xq.sy3ܤWzLBmVmP&*L"i \PCv^u/C.9:ZY<8~N)IM;umD \q56q:l&C |p6rE]qJpkm>)\j y^[ɾ he׋"SG6m6:ia ε,7] Vu, \sE7Ԡ0uVj6 t.N VQmZD2\wpm Y5,8;HyQ]M< Ԟ1e . &>m+ lCw+õj fh58cϽ:8߁Si564 ?3cbťBf7h6QyjbhQ2aLݤ G%j&>y.lal샭< ӯ\DVcdkQDkw}Po sWgOgsxs~jO狋 gקoN_MgEpxt\c '?e ـvuUI_CSF7ɵmqS.uDf?y{qHw nwkQprh% |wjP3ފv&ԉ>n@7WGDnE\Ӧ0MlK<Vlt&&E"?C8PelrYZjEVQXT8wѬ%K6viMHm% G! EWu,;nTsu1$g.[9jGRE֡3:VYUPpk{(gO$yl nVʻvJ1p֝m6`Ёp6 YCE+b+p j2V1hh{(~xP̯b_8;$D'79f_-u}7csmhYu;wWF-ʈ[wMWіcf55#$"JK'MB4hZTKP.X=7R| 5RV08h7ۮ 2:0N%4N:mEK)tT:aUo:#Izs>őI`*Y~ /cOi>( $n>Wl1e+eP;Pη[M$QOf0xس $w{QI,:/n]2M>zwlv@05Ϙ5Zzŋ"tȀ++m-k08 }upL:7L`lPg&ȣ0\Z˾ ?N_<̮{[[l xFc3he Oy\qIg ~mgJ&aVCua18/EkL 8Xyc8t7Qh[[-ې6acŃ _~y*m8$o{G`Od'sAp)be<|iye]Nuڻ18d&5{ fA](ΛB$66n#x 5p(Ap}أw3Cp@{vǙ| merbpf]ޘRٓC2tM`o=KnLJrµ-{aa[ok}z^PoTX@!)(8AF%F"-(9_rH,}<#rҏINC| Z' w` uh7v&+ &ZMù}ެbFYBpE޿kW&J0 48t3:x, pvf'73\.Yu(M{t[vcs2<7r}] -^:µ+gن&&gn>ZMA&#_nkp+PEr1P.T;?ZdN)ʻ01a淀kmav;}M1onmCʑ+j1AvM3 :  qP8 օ tkj:ZFD5s5VU `ܮBBt `ʙ6MŐ65{*u|]kYMmʻ6n{h`0 Y E[ ܢ`,u-KcЊ=ǻiU9u B& ͐uрp1h6İ8Bzy0}D w Oew!b>{7 &&6걃҈^k#Ab4Ì>')/vsIP'1LAČGS٤9DH\X W a ceE2O]Tkjp`۠6qM@{%؃bB%zIV9/ՃRJs\qDNUA8.RC}4i9*oH%yvƒmnM|5w'@ s⣄>HMy~=灷aާm(Y#nk࿉uuo7B.ɺ0wL6ЙvE1AɯZb؇~Bܸu󖵗7Iۣgܺ\Ĉwl噇{'QhSDu ׵l)"gM ڻaqE9,[7g/P )5ܺ@ G3)Z >7R ðqQ2R0=3bݠaX]@7 l&E J|Jn4HK WF*vEq: ~:s3VU?@t[XʻI3Ѡi3P/bMZԩkL'׌(Y16 G"N]5ܲM[*3<`w?ݪ@r ͖[ǜy?_jIJj Lb,xN`L/K? zէ{סvQ FAi`Z>E=MЙ4XVƛs67byDF)`,HhH#|EP4`osg`:- Hctoa-Cٸ[0pA".ߡ ꌳMP c:r0|F xb:ܘ6ǂ$٦ǰW~jdDAv3u:`&P:j0ko"}? Ck}>rh>n[?5CZhq c#Sda:la^%\;p*=.:yf)>ؓk]fj$+sFWt'f[tvN/.gEptt|3xqg8gTkxs1xvzlG}9v09,`lg?.P~N_Mw3x7`W 8_]z:|1]^zq8= ogNjӟ.׳9L^/.bq:/9}=w9ο_Oo?,z L>¿tvvN^ pvw?.faq>Yn{?MbZ;]|kxs8#x)x>@dbHӾ7?O^ͮ =]o?{ "7xq ^^-NM~%~pl>^|Wg?M_٫Y-pzg0evgf9\>M t1@ů Og=#0cRb#Z1sZ2@9w 9ӟ?擢W}` ^NMb.rl>]ӳ,_Y֑9۱wXûb 񳜝׳k8=zb;gs/gP~,> X=x_LO}cs8?.fQzd%?Wo`j? 9^qiy!~KOo#LjZ5a]o;>3λ\W}XE7n-rPߖPziԞ1pblO<ڥ7wqcҵ+NOĹd0q vqpsP 's0WlRN[רa ;T܅"mn܅ buα(p_,+P"fP8{śͺKnlVƮiڭ/B]|)l+glXSZǤ֭L q10`Xls +010 Rˆ+Xlcxsj5M7, Ǿq$n"2{4"أnw<n +Qo0LŦcXV8oBt;Vf"oӳc_R ]5TO;mz H;=sVѭGzRp"w4斗?Q`].FI?}&00E1m:(#l k6n nXpZ4M{#x$\U,1-k`B4N],]['9~uWѵdg9o=x-x]S鴜8|VC?.]{{3\s#\ 옇r%U=ÉDJYPs0-;hvT[2:EZ}v@Oxu M2jci/i)-[whXvF7l(_"d^9guG0]yg &sgr/Fpbv(Km#|Al@dC[Эɻu0K!"h^eJca0"uCH(\gh.n~f].n?O~]Q7  30ah]2Ubkܖ:'|.V;؁NxCѕ`u1(]Dpc%גpۚ9(m鐣  4[]zL4m7}4{8RÌ=εrdA07ƌtй"cQr(11$7xw.`Rq08{]lT56W9=t.whum 'X䱟ѣo)?l#uLJG'p臣ɣ'/>{}l}qtrxrrÂ[b.ā ɣã,O=>>DϟJQH9:ώGO?bUw{tgJ'O>{rH >c<|vGǏ?{gO<}.?'ua%հ㣓/NOɡc|GGGOHIyP?y~#=gG|R8|xő8>y&>::>?zɳcyH=;azNNXã' ?zFɱzG)?ON^wxxrrtmmY|&y)7jQVUU% ʪjVJX2Xb%5"J4 g0KzqrI1P|8ȕ=kqf?,k/xዧt|x||"=yGǏщ89:'щ:bR"b-((XKTXKX30Ӓ. UX3!#bT"QET{?%U$F%Z%%!b]̈.aK%SV96JhǨ(YU]1FPNI1i"M)U#DXbJ6*sWUcbn ЊԎQ&hǍbeVRת1Fz[B4V7޳L̿FWUU"ſQu+qJH|vuU!߰JEVjߨӣS.+F֖CTUSzYQ˥SU%ҨҪU)UdIT%RRR5\*YU6!F.Yhɥe#KǥpYqɲt\\,k.YWU]r)d.I,,%J&tidYLizDr}bZQE!!# ~Mf7y*J( %JID⥤*j#URRE[~$ZĢP# jyB;, !j2v[O~/~HH.QH BiC ""lp7"(sWRؠFD_S Dt"%UDjZKh1> [T=a'UH"J.I jlcSHHB"Sp|UUjtH*6$REd\I_ %"-5`S%#^Z RX4$Jh[|)d[4G`EL2H tc5!Q"Q%e&Pa8qJ"12 @ђPNJDҩ8M5!Jr!*z)*VL1/P)D0!CK"蒨"Z%%UUKf\̂DJ+&f5D$d+lI(QV MdhO7k"b*R%%U$h+w+2JPPEqbE*TR vʊ*MکJ"-QQkRrM(eFV$F5"MiV9i"%q#Y*fHǕ0YTԊE$a_lVl hV֟P1lVLRc)Y H$Yji%JboZFi'{fi;کEЬPVU)BERTi+"j%*RTDg,3MItʪHqRZjVRUS+Ҭ2J)H)*kVd\V~ UDTK) AB @J$H6BH!(J T,B))X*(bN)UQ\b!F9VZ"]N%RI5i*j*+klVVajJh;Pz>$+UE%;n%ʚʊHP'?XY%5i+THXݨHAV4TQt"nwnbeUCE2sjI9&}hy)zMjٛ&L)ʨF"ըH0FE%tEU T6ʩhL|&N852TR;B&Ipq"mRj oqu ~CD y9&"!w;wr5QCP*ah)鉡Ȧ?ōSMHSVb:fUiVVČVZhTZǺlCK1%%cXY:FILpRPeo1M?94+jV%ᒻM,)RIUb)*2FWRT%_շ+vtJVθd>dn&CKыvi# mQVf-W%YIsKXZ.}.1qblpKg*].q}eQ7|w #Nu1F+rJjV- EDgZFVWdLڡcKrT 7ۦ}{Tih5lS: )J)m@J5)w61EV>5쉺Rw;(jkbq݌'q T](E&M2}(߽aTi{#k|MB.[#5RTHQEHb*ZU![a[)e, E 9rb77;ݕէsj doxaMUF --J9*RUny^|K?i?s''G@Q?F|:La~?쯳w/z~z_w9l׳ɩ`OL֚Ik&X3I$4i&Lfr*V15i.QLbjthޝ4$kIDXKBZE%9:5$cN{bs(XKliњ&RJ uߴ(",k)ԧR'kLR}2 YZBˊjɒeES+.+.%H}me#_Vķ7ttls1=s^&>L''?Hm+.,,Y,IJ:%n+*M"WT֪DU ]VTZU:UVT*5UH/+r^GEeKҥSҹfLKJRt;DHNZ[?i}n2sieʗ_o}rW>kh,ΓJ^~o_ ^?r170}uEF}YZULƨR%y9ч}G=0rь> ? ǟI;bS|Χ;3Cr*BI@q| >:_T۟ޓ;M[LRe U$$b$#xH DH\*Y5T UZ#G%F Q#RU61M4-D^J!\.*Q vD*#ADDیABm q5PEw@`?~DZj$6ȰJ&θB TBpB($Xzy<ȫ{.yzL e&TD5Q? Dj(g%a+Y\%"bMQ"RAg \+ӄhBWb|JD+JD R2*4I9;m(I#II$[N0w[c5@$CD3iIHZ&HeT-4RIjTUJYUH-Ȑ"- vH"]ƧvH -J R )v)lY]I$Ŏ$PbG$Rؑ AD;${abGb(I#I1XRYS5m$"-EHtB5"JdU.w%˴VPKTG&ɉ]Q Z]ƧRRE)wEr ,!,PJ9VM)Cc1YɱK˱¢KB*+JmLPb$ A2/eH%h,KIX%"5rGZ$#HŧܑV+Sq;r1* y,dj-c*xTCJ^RIT86'ɑdT +wyT$$Ua;LHƧwcx\a̒%oØfȘv1162FRU"JDr1611iIL iӈvjGvI&>$5)ZJ\̥ONX'j89T^b5uJ_p$V];(LU.&mov ̭ƹ56`fܜ"fRܮjqsnq5L:YO=&|w֜9$b5m%"NKN%ie(Tb%C\RIiݶL])SELIT>7k4QE ſ ޗ $Lm*X]-jn$QCN:Ys+>9ذ݃[NlQ;H$nklRZfdU("Cş8}?@_9? @? b{jhb$/> ? Vގ7`]}E&~7~6o wK=n> #R=DJےYF6VI5}{@_>u"L3[QDwϿ(8 P,E'A+:Bo,<?9:97+T̅w.Ԛp{Ńg\x|zyɓ{k8ɄrXL!bLVމ/~I+3f:!7KKuIlUiT)\d!REt!U/U)/JX[dU8J֝[wߜIOc}DDSR nh'k;CJ3$A %RB)-B)%XB #|Y(B F,w_ѫ̲ I1=3z;vVs?[~tlT_}?K7?K ¹pG'Ǐ< S3Y+=_>iZ:PǢ~WKϹZZ_x6wt髥/}%߻NXݿT}%}-wKn$-?wJ\T0žw7x}b\<;O(#>}˺EM8%$KQqu.bۤ/K;uTg.J7o"6(ҝئ7᮰Eo. Uo6VtvD*+L216 QDz2QKJ*W) "TxM4C{nE+ mS_]iv%6 +Jݘ[EX*)XRA[6#.N JeM$ނ2U뺑$`m|qwBc5;`mMvAnDMkd1 c_ LӒPВIZR;OH Z7ӒHж (S{GI-!R%J""QB'ASc!-"+")x T!q] ].UD#R= {"#RnT$WF+S86ͳIj $ vnHd%#'c1$ƛ藉X2J%I-%r͊$jLb2/)&}R=XђϋjIDZZ47-R~!2m䲢KI˾$,V[REԦR3UvJ4REa2WbREқ`!,RU=dUX[ALH}JY0QEcW*{ 5KoPclo }nw\\\-Wpz_;/ Le2Vo[I?p*b5ۛggZ,r ?o]U#w޶w[vֿݷ?񮊣+-:;{Fp07ڲVhhJ*C>Ϸ?|s,9o ͥ=p~.cdFl}g]Y83V)k)Vtv-3?cԁpusr/doc/clamav-0.100.2/examples/fileprop_analysis/old/onlype_sample.c0100644000000000000000000000775713350521603024342 0ustar rootrootVIRUSNAME_PREFIX("SUBMIT.PE") VIRUSNAMES("Root", "Embedded", "RootEmbedded") /* Target type is 13, internal JSON properties */ TARGET(13) /* JSON API call will require FUNC_LEVEL_098_5 = 78 */ FUNCTIONALITY_LEVEL_MIN(FUNC_LEVEL_098_5) SIGNATURES_DECL_BEGIN DECLARE_SIGNATURE(sig1) DECLARE_SIGNATURE(sig2) SIGNATURES_DECL_END SIGNATURES_DEF_BEGIN /* search @offset 0 : '{ "Magic": "CLAMJSON' */ /* this can be readjusted for specific filetypes */ DEFINE_SIGNATURE(sig1, "0:7b20224d61676963223a2022434c414d4a534f4e") /* search '"FileType": "CL_TYPE_MSEXE"' */ DEFINE_SIGNATURE(sig2, "2246696c6554797065223a2022434c5f545950455f4d5345584522") SIGNATURES_END bool logical_trigger(void) { return matches(Signatures.sig1) && matches(Signatures.sig2); } #define STR_MAXLEN 256 int entrypoint () { int32_t i, root = 0, embedded = 0; int32_t type, obj, strlen, objarr, objit, arrlen; char str[STR_MAXLEN]; /* check is json is available, alerts on inactive (optional) */ if (!json_is_active()) { return -1; } /* acquire array of internal contained objects */ obj = json_get_object("FileType", 8, 0); if (obj <= 0) return -1; /* acquire and check type */ type = json_get_type(obj); if (type == JSON_TYPE_STRING) { /* acquire string length, note +1 is for the NULL terminator */ strlen = json_get_string_length(obj)+1; /* prevent buffer overflow */ if (strlen > STR_MAXLEN) strlen = STR_MAXLEN; /* acquire string data, note strlen includes NULL terminator */ if (json_get_string(str, strlen, obj)) { /* debug print str (with '\n' and prepended message */ debug_print_str(str,strlen); /* check the contained object's type */ if (strlen == 14 && !memcmp(str, "CL_TYPE_MSEXE", 14)) { //if (!strcmp(str, strlen, "CL_TYPE_MSEXE", strlen)) { /* alert for submission */ root = 1; } } } debug_print_uint(root); /* acquire array of internal contained objects */ objarr = json_get_object("ContainedObjects", 16, 0); if (objarr <= 0) { if (root) foundVirus("Root"); return 0; } type = json_get_type(objarr); /* debug print uint (no '\n' or prepended message */ debug_print_uint(type); if (type != JSON_TYPE_ARRAY) { return -1; } /* check array length for iteration over elements */ arrlen = json_get_array_length(objarr); for (i = 0; i < arrlen; ++i) { /* acquire json object @ idx i */ objit = json_get_array_idx(i, objarr); if (objit <= 0) continue; /* acquire FileType object of the array element @ idx i */ obj = json_get_object("FileType", 8, objit); if (obj <= 0) continue; /* acquire and check type */ type = json_get_type(obj); if (type == JSON_TYPE_STRING) { /* acquire string length, note +1 is for the NULL terminator */ strlen = json_get_string_length(obj)+1; /* prevent buffer overflow */ if (strlen > STR_MAXLEN) strlen = STR_MAXLEN; /* acquire string data, note strlen includes NULL terminator */ if (json_get_string(str, strlen, obj)) { /* debug print str (with '\n' and prepended message */ debug_print_str(str,strlen); /* check the contained object's type */ if (strlen == 14 && !memcmp(str, "CL_TYPE_MSEXE", 14)) { //if (!strcmp(str, strlen, "CL_TYPE_MSEXE", strlen)) { /* alert for submission */ embedded = 1; break; } } } } debug_print_uint(root); debug_print_uint(embedded); if (root && embedded) { foundVirus("RootEmbedded"); } else if (root) { foundVirus("Root"); } else if (embedded) { foundVirus("Embedded"); } return 0; } usr/doc/clamav-0.100.2/examples/fileprop_analysis/old/sandbox.c0100644000000000000000000000111413350521603023106 0ustar rootrootVIRUSNAME_PREFIX("SUBMIT") VIRUSNAMES("Sandbox") /* Target type is 13, internal JSON properties */ TARGET(13) /* JSON API call will require FUNC_LEVEL_098_5 = 78 */ FUNCTIONALITY_LEVEL_MIN(FUNC_LEVEL_098_5) SIGNATURES_DECL_BEGIN DECLARE_SIGNATURE(sig1) SIGNATURES_DECL_END SIGNATURES_DEF_BEGIN /* search @offset 0 : '{ "Magic": "CLAMJSON' */ /* this can be readjusted for specific filetypes */ DEFINE_SIGNATURE(sig1, "0:7b20224d61676963223a2022434c414d4a534f4e") SIGNATURES_END bool logical_trigger(void) { return matches(Signatures.sig1); } int entrypoint () { return 0; } usr/doc/clamav-0.100.2/examples/fileprop_analysis/old/notpdf_sample.c0100644000000000000000000000150713350521603024311 0ustar rootrootVIRUSNAME_PREFIX("SUBMIT.NotPDF") VIRUSNAMES("InActive", "Submit") /* Target type is 13, internal JSON properties */ TARGET(13) /* JSON API call will require FUNC_LEVEL_098_5 = 78 */ FUNCTIONALITY_LEVEL_MIN(FUNC_LEVEL_098_5) SIGNATURES_DECL_BEGIN DECLARE_SIGNATURE(sig1) DECLARE_SIGNATURE(sig2) SIGNATURES_DECL_END SIGNATURES_DEF_BEGIN /* search @offset 0 : '{ "Magic": "CLAMJSON' */ /* this can be readjusted for specific filetypes */ DEFINE_SIGNATURE(sig1, "0:7b20224d61676963223a2022434c414d4a534f4e") /* search '"RootFileType": "CL_TYPE_PDF"' */ DEFINE_SIGNATURE(sig2, "22526f6f7446696c6554797065223a2022434c5f545950455f50444622") SIGNATURES_END bool logical_trigger(void) { return matches(Signatures.sig1) && !matches(Signatures.sig2); } #define STR_MAXLEN 256 int entrypoint () { foundVirus("Submit"); return 0; } usr/doc/clamav-0.100.2/examples/fileprop_analysis/old/embedpe_sample.c0100644000000000000000000000472013350521603024420 0ustar rootrootVIRUSNAME_PREFIX("SUBMIT.contains") VIRUSNAMES("EmbedPE") /* Target type is 13, internal JSON properties */ TARGET(13) /* JSON API call will require FUNC_LEVEL_098_5 = 78 */ FUNCTIONALITY_LEVEL_MIN(FUNC_LEVEL_098_5) SIGNATURES_DECL_BEGIN DECLARE_SIGNATURE(sig1) SIGNATURES_DECL_END SIGNATURES_DEF_BEGIN /* search @offset 0 : '{ "Magic": "CLAMJSON' */ /* this can be readjusted for specific filetypes */ DEFINE_SIGNATURE(sig1, "0:7b20224d61676963223a2022434c414d4a534f4e") SIGNATURES_END bool logical_trigger(void) { return matches(Signatures.sig1); } #define STR_MAXLEN 256 int entrypoint () { int i; int32_t type, obj, objarr, objit, arrlen, strlen; char str[STR_MAXLEN]; /* check is json is available, alerts on inactive (optional) */ if (!json_is_active()) { return -1; } /* acquire array of internal contained objects */ objarr = json_get_object("ContainedObjects", 16, 0); type = json_get_type(objarr); /* debug print uint (no '\n' or prepended message */ debug_print_uint(type); if (type != JSON_TYPE_ARRAY) { return -1; } /* check array length for iteration over elements */ arrlen = json_get_array_length(objarr); for (i = 0; i < arrlen; ++i) { /* acquire json object @ idx i */ objit = json_get_array_idx(i, objarr); if (objit <= 0) continue; /* acquire FileType object of the array element @ idx i */ obj = json_get_object("FileType", 8, objit); if (obj <= 0) continue; /* acquire and check type */ type = json_get_type(obj); if (type == JSON_TYPE_STRING) { /* acquire string length, note +1 is for the NULL terminator */ strlen = json_get_string_length(obj)+1; /* prevent buffer overflow */ if (strlen > STR_MAXLEN) strlen = STR_MAXLEN; /* acquire string data, note strlen includes NULL terminator */ if (json_get_string(str, strlen, obj)) { /* debug print str (with '\n' and prepended message */ debug_print_str(str,strlen); /* check the contained object's type */ if (strlen == 14 && !memcmp(str, "CL_TYPE_MSEXE", 14)) { //if (!strcmp(str, strlen, "CL_TYPE_MSEXE", strlen)) { /* alert for submission */ foundVirus("EmbedPE"); return 0; } } } } return 0; } usr/doc/clamav-0.100.2/examples/fileprop_analysis/old/ftype_sample.c0100644000000000000000000000616213350521603024150 0ustar rootrootVIRUSNAME_PREFIX("SUBMIT.filetype") VIRUSNAMES("CL_TYPE_MSWORD", "CL_TYPE_MSPPT", "CL_TYPE_MSXL", "CL_TYPE_OOXML_WORD", "CL_TYPE_OOXML_PPT", "CL_TYPE_OOXML_XL", "CL_TYPE_MSEXE", "CL_TYPE_PDF", "CL_TYPE_MSOLE2", "CL_TYPE_UNKNOWN", "InActive") /* Target type is 13, internal JSON properties */ TARGET(13) /* JSON API call will require FUNC_LEVEL_098_5 = 78 */ FUNCTIONALITY_LEVEL_MIN(FUNC_LEVEL_098_5) SIGNATURES_DECL_BEGIN DECLARE_SIGNATURE(sig1) SIGNATURES_DECL_END SIGNATURES_DEF_BEGIN /* search @offset 0 : '{ "Magic": "CLAMJSON' */ /* this can be readjusted for specific filetypes */ DEFINE_SIGNATURE(sig1, "0:7b20224d61676963223a2022434c414d4a534f4e") SIGNATURES_END bool logical_trigger(void) { return matches(Signatures.sig1); } #define STR_MAXLEN 256 int entrypoint () { int32_t objid, type, strlen; char str[STR_MAXLEN]; /* check is json is available, alerts on inactive (optional) */ if (!json_is_active()) foundVirus("InActive"); /* acquire the filetype object */ objid = json_get_object("FileType", 8, 0); if (objid <= 0) { debug_print_str("json object has no filetype!", 28); return 1; } type = json_get_type(objid); if (type != JSON_TYPE_STRING) { debug_print_str("json object filetype property is not string!", 44); return 1; } /* acquire string length, note +1 is for the NULL terminator */ strlen = json_get_string_length(objid)+1; /* prevent buffer overflow */ if (strlen > STR_MAXLEN) strlen = STR_MAXLEN; /* acquire string data, note strlen includes NULL terminator */ if (json_get_string(str, strlen, objid)) { /* debug print str (with '\n' and prepended message */ debug_print_str(str,strlen); /* check the contained object's filetype */ if (strlen == 14 && !memcmp(str, "CL_TYPE_MSEXE", 14)) { foundVirus("CL_TYPE_MSEXE"); return 0; } if (strlen == 12 && !memcmp(str, "CL_TYPE_PDF", 12)) { foundVirus("CL_TYPE_PDF"); return 0; } if (strlen == 19 && !memcmp(str, "CL_TYPE_OOXML_WORD", 19)) { foundVirus("CL_TYPE_OOXML_WORD"); return 0; } if (strlen == 18 && !memcmp(str, "CL_TYPE_OOXML_PPT", 18)) { foundVirus("CL_TYPE_OOXML_PPT"); return 0; } if (strlen == 17 && !memcmp(str, "CL_TYPE_OOXML_XL", 17)) { foundVirus("CL_TYPE_OOXML_XL"); return 0; } if (strlen == 15 && !memcmp(str, "CL_TYPE_MSWORD", 15)) { foundVirus("CL_TYPE_MSWORD"); return 0; } if (strlen == 14 && !memcmp(str, "CL_TYPE_MSPPT", 14)) { foundVirus("CL_TYPE_MSPPT"); return 0; } if (strlen == 13 && !memcmp(str, "CL_TYPE_MSXL", 13)) { foundVirus("CL_TYPE_MSXL"); return 0; } if (strlen == 15 && !memcmp(str, "CL_TYPE_MSOLE2", 15)) { foundVirus("CL_TYPE_MSOLE2"); return 0; } foundVirus("CL_TYPE_UNKNOWN"); return 0; } return 0; } usr/doc/clamav-0.100.2/examples/fileprop_analysis/embedpe_sample.c0100644000000000000000000000444213350521603023643 0ustar rootrootVIRUSNAME_PREFIX("SUBMIT.contains") VIRUSNAMES("EmbedPE") /* Target type is 0, all relevant files */ TARGET(0) /* Declares to run bytecode only for preclassification (affecting only preclass files) */ PRECLASS_HOOK_DECLARE /* JSON API call will require FUNC_LEVEL_098_5 = 78 */ /* PRECLASS_HOOK_DECLARE will require FUNC_LEVEL_098_7 = 80 */ FUNCTIONALITY_LEVEL_MIN(FUNC_LEVEL_098_7) #define STR_MAXLEN 256 int entrypoint () { int i; int32_t type, obj, objarr, objit, arrlen, strlen; char str[STR_MAXLEN]; /* check is json is available, alerts on inactive (optional) */ if (!json_is_active()) { return -1; } /* acquire array of internal contained objects */ objarr = json_get_object("ContainedObjects", 16, 0); type = json_get_type(objarr); /* debug print uint (no '\n' or prepended message */ debug_print_uint(type); if (type != JSON_TYPE_ARRAY) { return -1; } /* check array length for iteration over elements */ arrlen = json_get_array_length(objarr); for (i = 0; i < arrlen; ++i) { /* acquire json object @ idx i */ objit = json_get_array_idx(i, objarr); if (objit <= 0) continue; /* acquire FileType object of the array element @ idx i */ obj = json_get_object("FileType", 8, objit); if (obj <= 0) continue; /* acquire and check type */ type = json_get_type(obj); if (type == JSON_TYPE_STRING) { /* acquire string length, note +1 is for the NULL terminator */ strlen = json_get_string_length(obj)+1; /* prevent buffer overflow */ if (strlen > STR_MAXLEN) strlen = STR_MAXLEN; /* acquire string data, note strlen includes NULL terminator */ if (json_get_string(str, strlen, obj)) { /* debug print str (with '\n' and prepended message */ debug_print_str(str,strlen); /* check the contained object's type */ if (strlen == 14 && !memcmp(str, "CL_TYPE_MSEXE", 14)) { //if (!strcmp(str, strlen, "CL_TYPE_MSEXE", strlen)) { /* alert for submission */ foundVirus("EmbedPE"); return 0; } } } } return 0; } usr/doc/clamav-0.100.2/examples/fileprop_analysis/ftype_sample.c0100644000000000000000000000570413350521603023373 0ustar rootrootVIRUSNAME_PREFIX("SUBMIT.filetype") VIRUSNAMES("CL_TYPE_MSWORD", "CL_TYPE_MSPPT", "CL_TYPE_MSXL", "CL_TYPE_OOXML_WORD", "CL_TYPE_OOXML_PPT", "CL_TYPE_OOXML_XL", "CL_TYPE_MSEXE", "CL_TYPE_PDF", "CL_TYPE_MSOLE2", "CL_TYPE_UNKNOWN", "InActive") /* Target type is 0, all relevant files */ TARGET(0) /* Declares to run bytecode only for preclassification (affecting only preclass files) */ PRECLASS_HOOK_DECLARE /* JSON API call will require FUNC_LEVEL_098_5 = 78 */ /* PRECLASS_HOOK_DECLARE will require FUNC_LEVEL_098_7 = 80 */ FUNCTIONALITY_LEVEL_MIN(FUNC_LEVEL_098_7) #define STR_MAXLEN 256 int entrypoint () { int32_t objid, type, strlen; char str[STR_MAXLEN]; /* check is json is available, alerts on inactive (optional) */ if (!json_is_active()) foundVirus("InActive"); /* acquire the filetype object */ objid = json_get_object("FileType", 8, 0); if (objid <= 0) { debug_print_str("json object has no filetype!", 28); return 1; } type = json_get_type(objid); if (type != JSON_TYPE_STRING) { debug_print_str("json object filetype property is not string!", 44); return 1; } /* acquire string length, note +1 is for the NULL terminator */ strlen = json_get_string_length(objid)+1; /* prevent buffer overflow */ if (strlen > STR_MAXLEN) strlen = STR_MAXLEN; /* acquire string data, note strlen includes NULL terminator */ if (json_get_string(str, strlen, objid)) { /* debug print str (with '\n' and prepended message */ debug_print_str(str,strlen); /* check the contained object's filetype */ if (strlen == 14 && !memcmp(str, "CL_TYPE_MSEXE", 14)) { foundVirus("CL_TYPE_MSEXE"); return 0; } if (strlen == 12 && !memcmp(str, "CL_TYPE_PDF", 12)) { foundVirus("CL_TYPE_PDF"); return 0; } if (strlen == 19 && !memcmp(str, "CL_TYPE_OOXML_WORD", 19)) { foundVirus("CL_TYPE_OOXML_WORD"); return 0; } if (strlen == 18 && !memcmp(str, "CL_TYPE_OOXML_PPT", 18)) { foundVirus("CL_TYPE_OOXML_PPT"); return 0; } if (strlen == 17 && !memcmp(str, "CL_TYPE_OOXML_XL", 17)) { foundVirus("CL_TYPE_OOXML_XL"); return 0; } if (strlen == 15 && !memcmp(str, "CL_TYPE_MSWORD", 15)) { foundVirus("CL_TYPE_MSWORD"); return 0; } if (strlen == 14 && !memcmp(str, "CL_TYPE_MSPPT", 14)) { foundVirus("CL_TYPE_MSPPT"); return 0; } if (strlen == 13 && !memcmp(str, "CL_TYPE_MSXL", 13)) { foundVirus("CL_TYPE_MSXL"); return 0; } if (strlen == 15 && !memcmp(str, "CL_TYPE_MSOLE2", 15)) { foundVirus("CL_TYPE_MSOLE2"); return 0; } foundVirus("CL_TYPE_UNKNOWN"); return 0; } return 0; } usr/doc/clamav-0.100.2/COPYING.pcre0100644000000000000000000000472313350521603015161 0ustar rootrootPCRE LICENCE ------------ PCRE is a library of functions to support regular expressions whose syntax and semantics are as close as possible to those of the Perl 5 language. Release 7 of PCRE is distributed under the terms of the "BSD" licence, as specified below. The documentation for PCRE, supplied in the "doc" directory, is distributed under the same terms as the software itself. The basic library functions are written in C and are freestanding. Also included in the distribution is a set of C++ wrapper functions. THE BASIC LIBRARY FUNCTIONS --------------------------- Written by: Philip Hazel Email local part: ph10 Email domain: cam.ac.uk University of Cambridge Computing Service, Cambridge, England. Phone: +44 1223 334714. Copyright (c) 1997-2006 University of Cambridge All rights reserved. THE C++ WRAPPER FUNCTIONS ------------------------- Contributed by: Google Inc. Copyright (c) 2006, Google Inc. All rights reserved. THE "BSD" LICENCE ----------------- Redistribution and use in source and binary forms, with or without modification, are permitted provided that the following conditions are met: * Redistributions of source code must retain the above copyright notice, this list of conditions and the following disclaimer. * Redistributions in binary form must reproduce the above copyright notice, this list of conditions and the following disclaimer in the documentation and/or other materials provided with the distribution. * Neither the name of the University of Cambridge nor the name of Google Inc. nor the names of their contributors may be used to endorse or promote products derived from this software without specific prior written permission. THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS "AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. End usr/doc/clamav-0.100.2/clamdoc.pdf0100644000000000000000000051756613350521603015311 0ustar rootroot%PDF-1.5 % 5 0 obj << /Length 220 /Filter /FlateDecode >> stream xen0EY&Lf&K*Jn7EKHDsϽ&8Bѫr  0a[bd'QJ.G0ϸ Y*;V@GfyWlpT>g: ƢEd .!`LUf1g2> stream x lT۴4m%mShdLf;Lq A  B"EE& (" >(e+sNWrN~Zaw~ 6` 6` 6` 6` 6` 6` 6` 6` 6` 6` 6` 6`|Ţ 씂{>1: ʤa)tL*>!KŧX4(NxσR7)tԮ;v -[ B0ڛR;hd;C{%A ho~CpZ02[̷=r#pⴃ)62L0ewb-C/ N1[v0Gm.F{ޒB}bf-TdO"iI fx[`w-H;ؘ#bGF{;}BdXwF; l;DF{SjF{9rg' p)xRB}+OFh3D!͟Fq敎Dŷ3[RWWTS[w@1TA\CvЖw=0t~Kc8$΍#&hsAĹ:sͼg2 ML>x?xs<=Bqx6/T#g&MJ ^,V#z ]MKT~d1'#(aM%bgQNgOv?1A;yY3NƇN6)? ;F;gkR xݵY-fN,#9&53@N7NҾh0.󡾜#{C"U7]hoM}+ޓY9.i!yNjךJF{k"3O;tz?g;"W ߰=V@{!ǵ,kyfS`cYҾC w5y 姣8W.<78 MM6`WPgAwJVxk&1J;"欐\'ݍN_ʇ&q8bD;$2sO;hiŻ>'Zm9k;κ]i{gnZZ` Ȼ4n)zڏUha? -iG3MVph?K(i?$N0JO(=`hVco5sHr4DIQ)t8ԴʝW= s|zc=qF:i] *g7:*PӴC x1.[dc nzL;զ桦Lq|VD:hG.~ eJ)&Ti?&7J){D;. PeSЎw;4 M8?7v\c? `~y8kWh,o_,(EpSNC&jMG!l9F!.%QJF0 Aw9rIIbeG\fNϢ1U?K_qw%8e`XZ/x'9v6;>1xQfeEd!ߟ 1%%7 dB%([~K ^9?|qY 7 RIȸ\|R.?/yJᄞdlSkWkU\eGakxU{vg^C' m+lӎ`Kq":b&S`3XaVjd7svI E^S<,9;5gS) vjܞHQe׈ъi.8>3y&~om9BM|^NE{3#{[9XS>у (7kuH>G1#GI?xx&:Bw`?tN s*>x{n bQ&z$0s5ҮSð ?sUԾ?ffYlI|- u{v^( ŕMdvq1A{!gm@X"zx\ qyM>Tհhq_lpRѐmxۇoT_vk@quO33|! b7ɜ@e\‰C,eSZ/1A ^1/xqsulz":LI6vW=h?J/ɼ;+ʉ"'ʹZ U}W.O_}[^n]|'~^VVo7]Gq{وwwmn໡v:j Cxo5Ͽ+*uձ[9oZJĽpDyL~&9ܠ QN=BMZڄS S:l^ٺ<+|p3'g~(OM*|!7 Om#moQz%8?jsr Px6m<{Q a ?}^ lȺ?&bYnO1vpt(ɻ=Yxs_"ϔ7@As {Q;L98\R`T|8Q}M3QQΘ>Tn?|>'`%ǻaU.9+<qk2n9B}JLvj;ib6n(HWo)O{7ih5L2I89 LrhLsg2)`Q%J;MU+ qKS[%ܲi'}%jjۍȹ蝯 ^v60J}[61ZgjidKx; ѭ0jY}bw)ĬݓEJdS=&%n7ؾŹ\j>mG{KPe&jBkNI A̺%:e%mb~a_XҾЌf봏G@ΡhYMB`]Y g~B;Nen1p ӡS DbhS[)CG;hl-7FhM j[+!YB.Z$ߋg1wdݏ;)ws,ޅ.)(,\M2щs]G%0]s`9CQ 8|% ́5ֽ;kcCB[ ەZ lh'*j)O(d/)*yj2y}&?WDڿCp7}c!~;jci?hSPW djDYs*IqUf)JT?B **R؅/`ZUT{,?1Щ#&8epwBoP󯦊5SOhFL0"$:D;/U~*3w(jBi*mjSTT~G }[6ZߘkDDy!Ẁ{TX1s@1 ETSTR~oVI;hKM&pRMT]G;NTCyN&UYzSlc~Sm.ƀĴdJj̄X}[2 c23էUdݕgG3s@b,cbcEQMo Nnji[~!TRCiUuWbݷ"7=wR!L-?/y_v?+m=*TSƠڣbcia߄h_nLQqu!ڥDD;NED}5Q՚jfGL$W-oNov8ryW;gOK%UE !?P15).?6+\1#>}kU.Q%3t}X+?iZyW["ɽ=Wq9$wNi䆷CQʥ2<'B7|UH͸>8pŽjiG>uE1ы ڟwIVC{MJ2DUcIRE"h>yʄ`q qqqq qm㕯n?iUoAmkAys^+!]u<;픫m`e2;Oq5UMLv\l1fiꒌ<3/EHOi?%Uw]eFH$s r5\Rh|)) m$C^?~B^!?-%;\.5aB<8׼ʛAصǐ1?%љN28EGߘ[TqJ1fH] gF"أHۅg ߿(\K/"OM}֔d@H9Iu-gt,ÿ OJLRO|pK+e =*`v:?D%NQ_Si_Yڇ$c E}UÚeRuvI' 8wZӗcNLK{ <(EޒWC. 0sDTwS~M;E5c# ?璌1Yw[1y9j՝n! yט bX<eU~5jM* mSpf%o Q$祒h7V 6𧵨rWdvba7Vc#1d>a]>UfFF)uuHbfi\̫!#7jiVhm۶M6pwy tX A&{lIl׿9ILý=*HWHREtsdx s Y-hS,,r]v6~)xJ*ُ#ؿvMwl UiM(ڎi'3PouHB`jfhyDuhU6o׮]ovȐ!|BB|p,y%W day}>+*DRx yE'p/}۝@zFx%}9o/7.r{"Hy@Y,4NgAAArrrYf 3aS՘(WpPǚRn۟SU\u'֝! z%'cnj;vϣݫ2Y|9U]5Y3Qs6_"܃{Jog"6eB U,GuG|Kz322p=C[l:qD~;VYpUa3J$?%ev4Ogc+o1}K2!Ⱥ:+^ӵU3C\U[q#j!93/M6u30%Y- npI%?:=QB&'}ʻo!AՀEW3^m!&]柸>k?:lL8D,Z֭[ݾ}{WEEEPL*I5Lؗ}TCcH@L>%s(Q}jIr2>yM{->t{444hPރ[3dnN.)+J$wY9POMj^qt]U+9p *Ω I/CnӑV@F9s˗M9.wخ/뉉>Yx3 ?/~W1֢XgMBiRҊYԳp 󴇴 VK把P@F?a„a>}8?ImıSa>}3 131A.4Qֶ53 Օd^z$HM8]۶p >zho~xܸqj0v=ƥ$'0p'&ݐU}h 6RJ;BeSLZ298>>>l={9n.\!5%RψvVN:)֌v< ?073woyPFaʒ!g_~5;ALpf8va_H5ca1c0ev2(ZvirU]Bo }|~))@URŖjqld0(vp&)΀u>}z49NQQQQTXjmۦ[ {jovXJJݵDTr7LV*H;jT\ﾽvoٲԤ)̉ 'Nh̡+//Ϸügv<4Ymz! ;0:G;Y7ް|- FrɸU`i|/{DZ[6?qPM\J痻=+w&YU.nHw'\yK-;׻m̡۹[Դ\b`%Uuk3̈́}6?6-Yu Ti!6`gN>mԿ16-u0(y2֢q5<"ߒWAIǵktϚ1=8ڮ+7,O1^gK t>vvq5,k.1BCff0cխI#4š^t 9yyyy}3g\:>p \tiNɳa>|xD$\u.m'_˥gFy ixUeU)>W~(;/=dv(S\fu63!V+kViy_%F9\fק+*Ο?߰7j*-)Uǔ:;mƿR\j BBVfy YIC lx)s~zcn+N>ШgV89;8:9&jp;YJۘVL{_UU{{ř)c}c ㏕O;vor #MiٳgC k6軂W=+{;w&O#G oi믿:?K䔬{i1 BD0>jn# H;F/pI99nIڹsgUeeYYY佴xpE^gOx='zڟjRI?'tU >=ѿ1c;ׯ_8>KΞ;V>at:RLNF> 7&hOSƽ㩩)d3>ڒr…GWE3ָxŴ۷Zv%š]?&Yل_ҹJb% K, (bOnX оnÆܶSxpfjQgb_]hj;gS~f )XVXQ}Gy?w^~&tp6歛 oݚ@`fBjUҸ[vr/..M=1s?,Qx!ݸvZׯ][vmaZ;q):&OG9~y튤5r谟[wiwϛ7@; RK);w4N5vѽtu˳g%e]yדfd>7q©MuYo(wǫ:|N?~_y]@ɛC5餉Hu`U؟}ڟruFdy'UEHgjʔ)WCz(S(|Rsl#bƔ)9oɹ`EۈS-ߘpVN!vg9x Uwu׷ pϜ9]2W><4]1DSY[ }ԙ&E|8]%p<<]rzZZ>}N8QqЎ (G} _4q^-r2;yeSzUαLLֵlw/En޼ P:XV׭eTN"ͽUV@{oXg`yF+sF;^XY{;{*(Q5k֘zof H۵!#Neh+W\rY.=[()sC?n7)ƟQ>7W QLKV|'+]9>$0C Pcs[_oW~_"x9}Ʌ1G?oGQPZ R)XsxC~Yձۉɣd0;?o+W{DSG9W`q>7gΜF,s :Cv@ؿݾm)sH0:3BMNu^mMRkЧt}Fgs\=s e+Nfر}d.[t2ƽz$zm؋h,8q.DC; Q53tW|./o2Zn:޶{mr_MNA{U/O%``g|ryg\Ǐ/wn:zz>~f=,.]*ȑBQ(G/hnm߳gnL:ꍀ#< ?ֳGMrOP*;aZ=t/k"MdYGgHwS*HI{׮\!'%ij"zEvݬ?Bu~,?} _*SU;v]>;-mCx{KE}fNI=Jp GOC:Xgtx8΋DR(xJG;)p.ܷo.󞞑~;&~vE$6tq îITn߆G:=O?#>̔F][HY!H5RgI}fv5kzOׯ5Ў&'N&.94VZ]]|Ǥj{; *_< QxCb暅K"} !93fǿPT CT}<:«?5ꭕvZuw,&-4oN*~2YV:ٿQ5_iڽ>ov6I\7)mGtT|9Y˓]$YS] (܏qJNwڕY'kz_zzq;]MN{:ڻzK <3 IW9V8 %?9Ϙ*<j03xfI|>o],*4o$yzQ6N[v܁." 9h+**ѕwYZUfz :9WN*iȻg~Yu=gHL9MR~S㇍upc:|8ѣGL, Y0;10zbio.cw#g8q??εQC:yL0S\;UUՆ ̔Ti59M]3t;.H>X̀ 6T3_pu8Gxeiڇ քG?k׮ݺysovr8wZ_n1h;ǵ@`s;4N1H͏ Ӹ~u23+fF:=mJ޻ \B;wdu(ဇS0Ww+KJZt7"ܱ#%%o.'R2zꟷn5ï/xK.AvPqD=p޽^L,KЅyV$8xܙ3VwVF`"w:w̱Ưݻwg[,nZ3A'TGԬغiI!<4Z+3mfǷn8J4RS?~HҊg΀ᩮv+Wn\~Hͫhw w;d 6[` ,O^8?Vw=8\P6)==ܞ/N> ƍonX*7V}i)ɓ Aŋ) SfIYn/0Tf*%ǧTh.H>-H! 8o ';;;.w"!2)F>cp(+;1j~!B>\n׮KNzU.=ZP*E3]4o-bCVRu4>7_Kp!@ _E&|˗/;w4/?٧ϋlٲ.X6-T!jF+wu T}Ƙ`x_Qs/\~ipڦuҚիW+46yܝEE{!Eqٛl~R!}-Cx*kI n0"g Srt (}.i:QqjN4)<=B{7 I2aQT29ݫ~a*a<cōƩr00@R32H]R+:kڹ3 뎞ೌ^;;۶m!.1aK/1d/RZ'Qto ڟt 1zTI_j'Yyh3sNI$h쵂fY \M|2xš't?یemڌ?.UGGN J ^ҋ%.R:sm[NU. خ3ڣU<.KxK,9 F m֪J!}iVCW l2$)^w_ 6D} 7jK3SyÆ .]=5lر5w#G~Gc=zrm dըBq=F["&hOR5IbISY儁iW3SPfC;x> O|{I_}Qvf+31)).=Op _ M@(6PYZO}߄e Nx[<ԪJ=XfpG 'X, lpߠDe]CuF{}掠4t ox"jTNgK`s[y?/O=ܻwln֣VW_<'\ _%T<}E >٥X‚6\=fŧ1,FOk>r{;۝xGϞW>= x?TV*;#+;OmۋG8|3IJjR~!}h00UUwh'0$(ceih "`Sxnq\>%egcOMOs@{ߞ3g6m:vڵ8p p$(,lNa,֠CAVO+6'Mp{OƏS%*!OxFٳy8_]zcn=~„Uk<֭kz^d4bN ܋NVisCdUuO, |L+I!LjCLtmv'giJH~A$I:tԱc=t߾Ç듏uVy@Үj} /ZAy*5>b!0_!Za>F-\X,wy1-Zn֭[Mg{,Haĸx[zz/>)aw>`sv0Rn/z{m $jNJ:P7K衢Tw{.5Z'UƄц2F͞{9X OKc)-}Q,CDPv,_HaKQ`ItAej/DȢw~ ?pP}zloԍNW_P7 eU~yƠMzKh-IkanƓԕk&K\'8o{w@{GMVgkFCGb=MXfGD%]50XKktϤ@E&l4\':%'cӢXQ,C3GVu]VմhYS՟|*ubcUo&:Ih>mI)䯩3D?iZI7TWLH0ItBv\ mɺ'hL4${ZuO1,hu:EBsZuXt?MH{kձ? hD?M]QPԉWRf<]4Ş|#$%1!t?O^uJ_SMK4$]u/B{y~'hd(AZcczyJj}t/[gQtxӞi9'msݴy*5F֨3흴Nv2\|N/ۏ%o W_`'RFeh%׉H՜ז*:~f.Zf$9jxu~xy#g}k5%_'2IJDue֢K/ҕ2(wZ a^u̓!IXZ F?cL0#yjZiǨ.M |g0Eu&O6@#rjM8__cUP_:ւ .GS ZBα.ܻH|K3q6Δ3ZO76ކtQ7c^ 6 …Wh2pmαy?SG֥rFL{GW*09Ak~st?]u[# lcU>XBV+|Kމ;] f7ܕf{갧k$_#̮wÛ! hǢ0Ztqd319:icy0C5޴3jqS%'ΜfjO >)`u.(^0@۬/bwubN =iE^]JϡXWAL UQ/;1Ur.Pg'hi{Nퟦ(g B*txc^jKwӽ.ho?j`^mhA=ֈ} Z0f`?(Zµ>E't9yyLue뜏B0 #OS/ oKgov֭Q̓58D3#瞑 FC;Qtw2s8:c_EaI_Goml)gw'rڜ?hg )OR.Z=kC}ڧtx h`x$ aU p?!)yG hHja=fOƌ&tEoR0YvF{dQ~ Nas(w,nljpwݏ0퍣^ٔ0t1L?oG'#vF{i IQ;WK1]E)ZR*h'4!|C<~aT~Qca&5yvFw?B] FhfF;=&h'?che llllllllllllllllllllllllll@; endstream endobj 10 0 obj << /Type /XObject /Subtype /Image /Width 250 /Height 250 /BitsPerComponent 8 /ColorSpace /DeviceGray /Length 2402 /Filter /FlateDecode >> stream xTTeaE 4@m"KLW[H \:nXMvAuَ?:!ҖJ-uϱLOid8لG;huU@:³0̠sO>ϽokfP'g^8&/>Goa]]_GTsxLy쮚7H. ?ؖgɝ_+s #图:%OK9R~3Y)ՍޭB +/eXA݆ld;fX/"Eli[5}LiiO?jv5_mY Je6P@no|ۛ~T@rpۼ僚OhoZ¦<\%&{kԲxW"/QT~>\Ao&r9-vT;ٕo ]~eeIyr9/,Yy?Q.1+O$+W>d7:PCX-6\kOqxBHZ/T.B4 `B/a9ڕ' hY"@s M}˅Ff]/c{ t2KsU%9Å:/T{zlV&}ΞRE3'U\#N :E} _6a7SIu4 endstream endobj 13 0 obj << /Length 1205 /Filter /FlateDecode >> stream xڥVKs8 W( I=98u7Lۃb˱f_A9qv݋ G@{.ziOO{Ӛ%BxIX̅7_Pq{B1.#μe/tHE "-Y"PR1%N0a&7]zF0% VmVMe{.`Ԟ,QnbTk뼏&㉄I"ԏx $ڏ$ylőa26/[=ah=^$b&֮g](⑃[:("]*CEϚ&*-iadAZ;,0eO%`8qBs4 C~Bzg~Pz(?8 MGͼ"qklݸF}mWU(~N6Ծ01!b` uᇶ*oT_TL6o:$m \ ( Yv{ YiA}IY8ouJ4ǾlA QU/uT1OmЏwՖl$t`-YrqR$EܑL##);VPDVl!I j;Vu .RAfVCb3E9 $yU%\qCV7`%A]omO]?N[m4 ZC)-=ra;禮jP Sj\k,hGaUm22+ űl{d˭0wd8Mi1;[Q;zz*6pL4" r7EMT:-[N%T\ rAcY5hz}>@27c@[ s0QfƷ7sFl8T FӾ.(w}$e?v4/}p'[j7@e ybLԄ0,b76HVǵ+K KL?W ZTX,o:GPG~G'_V-NTծsPV4(;&܂i-qv-FZ~-p:,N KH; qMiմt,%/B.a6 [πWF,Y aJ<Ha_(&dr=C*GՍR[l__|ŧ4_qp /߱ݺ endstream endobj 19 0 obj << /Length 1262 /Filter /FlateDecode >> stream xWs6 _Iw&R{Kŗ^d˭-W$* $μݖAr謝Й G ~f xÜ<2Ɯ,J4dN̐qaI餳'j492=Uœ a/4/f_)"婳X9 xAI we0t/j(j5^9 K $ ޡaYYe?8|a_rwuH }aQh}Ad%{ֲ7G舕ATӘ4rU/J gyq}usyK 7$lطgasd$vfؠe) >F$[om=ud^I#KD̥?!4m ֯ cS2:\ГcRoUٵ}2${ʂˣ͠ Ny4]54z7ec# E+蹦?6>r n+I;6D#LήP!~1x)P2ji-QCp$Mg+oig˕2pcP"y8KqG/laF[#N#:"x^y |nC$`oO_22wv-NP\F JNfx:td?Iقu|zuf5omCb.fcxq,>nS~~BfXo B?鿈jY7Gz!>C, F޿]x9דyy}yur#߿~"xv~rO.+J"Mã\Ǝ endstream endobj 22 0 obj << /Length 712 /Filter /FlateDecode >> stream xWKs0+t" #QN6 bDZI~upW(y|Ҥ{Y@/@ ԮBPQתkwb 06-@ ]cm*mbl&DK ez^b"<cw?uUBQ'rQyq(ؘgXBEz1ӳMo[1veЮzd`ތ%!/}E,UT6?rƙ.d|/ˉ{{y)%_8EQJ1OG%ðiu}Ϙ\Mř.R g+x|GI(r,}b-kBj@%b4}ʲ49s͢P jCW&A#'^Y֦(s6_W5hRZ,Dδ"컃1PL%_Nf lHޏ9/d1`󧌋Vg}@]%uW{R~o|ӈq'ʡڇum/ӂ7r$c&wy Z_|b><,N^{aqgo>m` endstream endobj 25 0 obj << /Length 1358 /Filter /FlateDecode >> stream xڵWߓ6~38FdIyGa rf:(Z]y$6~]}u/"Z ~_^}04HSP$ 2AqIDe@)5M;bSo?FGV)wy7Q8v|wٸѥj'S&PUEs3jÃ6[-Uӝupz~HD]ms]en`HGz s"RL'/:VpB M>a .-JtՂm`Ѻw2^Oh,^meut Nl8aI VBj05.+T2"0<}0iBxTfrskp?@/2IT\ MtIm0tE+eHAvj !x3)< MEg] 'Y r| -sa]صq Plm)oAm9RڋS(4H9NM d=`,Qq$vjC@CBEh*s1m$rtO(x6A"Ph-^; *o fP8 ,HN@k*9^H"O/zc̮}:t:j@ueٖO1%;@1eH1!V.ܼɺ9 c{LOE}qs*e*_C7k68oӸgr|'uS:XjHQ4wQ8a4LRۀ j }C0Bo?ν@2m@| x?о9ب=PYܕ{F型p]\oLxu[]Kt3wG; JvNP&s\gw::v'A-ZHoK ܗeL6vl/_~Z` Km~vHo n&$NXܿˆ. "Ox\O6Dֳ`%FaTLY}{^Z]ݚq70?e endstream endobj 29 0 obj << /Length 1314 /Filter /FlateDecode >> stream xڵWYs6~LJ΄0N~ǓLLc'm'EB'<..YeO_$p .pptyQaV{y G$* L O aED Ly4h~'IJb{xAQNCQT A=ίON_2*Q,G%ASRB躉>,I 8~5(]u]qH>_ P| 2hrQZ! ĩ[pQ"9rO9G6=GgydRUUrI8JE,HD ZVe%xze؈J!XJ!ș[WA VI&DċuWMݍ#i:FvUB8㠗#;0 ˂p)oޟ*J!|l8^NR_xr~{pHMmԃL@zCݑ<=5tW5?$@bC`thQ/#WӦmtng;ah[#N8ד#lLZ9bF`1[jRgvgH!Z{Wj>mЍU~雜ܱ߂60r<;xw뺝RIJ8*u.aHد $8=xvŀ0p-߿yֶZKfcD@N1hBCZShqekg޽;dHi#M0bxWrPku&ؔs6#lݭy.z/7jj'm[QT~ }?S+H!.a+v!mg6°Wl-_g5CZ3FΫuAmMCX&gx&l0UiLi#6}vU(IspԀƮY;K(y1buڛ5ua[X0q0YKYQopb}U󹬵!icklckUKmXԳcAmpF-`.3 q\ߚI6ЮB(?-fnYhasW_]R v؅m3k)&ơJ1Ql;:eA5(Gۇ}q}E8EEfJ?㨁axcdk Nɔ#SB`L_WV i( CK+'>`bZ׶<{Dn_=Jʀ.";\V_Te@Ưha*D|A$ endstream endobj 32 0 obj << /Length 1638 /Filter /FlateDecode >> stream xڵXYoF~ >H.wy(Th Ij E$$WD(I^كs|ss6\y(:tasE( };iq&"f#ԩ>N,'_q{hDPH!+N-f/p(H,N0QĈX9'ŞM˺Ix8Qr}dclG.a$)WP{O O1\ٲJ@*%Q/~PΗ"ev;(RHQH閧wPrG4Z[fuXWI`t~~T,1yEVfE[ 0+0JQre jaLWj 8aq|(jWw=|TmBڛK@45n/ U5(?n߁`13HIbU ʔ@6B_7Ze( }Q>5^+Q6\9.I}1LmzoPLq"yϧgzCFNH!d^ZCpSFDՈ$'bØDDOxD!(MG>Tcm~8IfޙN6a. 1Pn@FP? NuUek2xQa+YIWQocɝ!To(K>M?`RB=9/>ڲU%!xT~nEhgTE͔,n~ C!y:Y,[4m9A&:lbHJA04c%_TxoD2E`aRTj&d10giœw/XqIVLcRK3RWh(hw5T;ulpK[Qjz'q0ո}&?m@^𱹫kcJǧl]l̏u&lX'0lYC Y*uie U|}LFqroWY@Er9@LLSie]h%POۆ?p"y#9AtPoy0$A&0D1aꇶ={ܤ@g}>  _,kFG1#c4'Ln1ekSЄ+dyͳyl-|bWK(L}҂ `dOk`2!!Զ@GR6S숵[wtoԔuW`owY <$DXhaml& $l%zf tƊ7?M"\me%x h {+q[wnMA`  endstream endobj 36 0 obj << /Length 1282 /Filter /FlateDecode >> stream xڥVs6) 3}p<$M>ȠćՊq9V[{wX|_xǽfx1 [Dd}7lꄄ[u 9 xIL >GQܛq~I;pp;t\UX[ڸk ;~^Î #?&Xg6B=!8q w'gZ3dh/i}&5t܋CP]kjP&S kQ5D+Z)g(q6vQgEf4|"]qIJxuBE&x80X <|' HP6f,Kw_wσ\Ly1W؀X=P+n,ܕ6f~J@/?|XpmkZaTƹVZg {z%@Fh;*{]6 >A/]LGЫr8LT_n|-հ?*ճWC Y{⧡1!<1fZOrNF¾0 a0115H]{W{d"&z(!AYA^㺩VOr=ꚦlOB\}> stream xڭَF}uOnHyHP@ "ȃӳcTu! eܻ!}yJ{K J /ҐqyB3.C59)I-8d/YIʹ_jB^HFूI.I-M 8볲7^[x:LBY(5KTIg}G7BlN{Ĺ,ZC@k>FmX$np[ҋ$8!7AlT)JfY E\Z&Ђl gA@QL1qzo ҙ!Pyuϊ屧C43+Zͬ?%!q4"͛M*+\L70mufFGSԚStD ēf׭rR)fII9kpG-^OnPwscA%-BǏol?7,vcQ0-k:k7FC7~+ERzZ*pX#(ђL<9v -# yxt& n)-FiFS%r1}\@Wj'?OmY*uk5U Dh;mc38@8z~ܐtUY #4Ky4 i*G߭ERAqp$smoVTT.=|7` MPrpC1Gt1)Q .)CTk(bzO϶[k8@ 6LzaIm횓$b볿Q\bh뎦  uy[zľ߯_YD3KHXӐ}thu $lВb6ngץ^gi,wpA*.kvt>acGC']ZvCk Ż915SS%- endstream endobj 42 0 obj << /Length 1318 /Filter /FlateDecode >> stream xڥn6С@ I`iŶq`$"S(o~}g8_Qo9r/{+{_p^L/r GE̸H=0^/3r,S, SVaGQx+0K,!0)Xޢ>Q0sNANA 0gYRX&1OX& N{ZB"A9Ko`,L .j̢8{Uvҕgsn٠`q0[vm j i?MY ͶW?&( I$ᖶ ֠#ȑA Hw|ybm"0xL:΍&LVJ@2SnE)f*苲m<ЫM[#p:RR>u ҥul,ƚZ%:kBwc3䣓y;M[lA +v*vxJ۶Гu3*myӱ)+Z2q)ǥǾM ;q%h"=)wg!@ӥKw<5zwð1vL'V0?n9 &{18J&\VM D;>[?az8\6mG-;Q׾/$f < .2d`OFtv[(3JSQp>\?))&ъK5R$f5t]{.dm+p76'5^lan5fשFu&=(kSQ"q8 j}L M[Fdֈ3*{"5Oz!O!& $=~JTO0aiWaʾ ۡ^7wBЭSSPKC> stream xڽXYoF~ׯC@ڋ<4I)`4pƊZIyO͟nG,8$^4juKKkCz ޲")Ja;=ZB]ch<+EM!Zg(䡳`p+S8\ ^7͡>_J2;Tf#$(} 0zJmY&4޾(rfGy`daIbxA@!87>cNM #(b7HzwDbSlCۥWUYcĢSirv Ht,ӯ&icD ꖿ-Dn \U}8m`QFgw7 $D+)mCY;m PKC-czo1pd.,D>86mntU*!=&dҔq4$7CfIJэM3j2g@#,~"u"lmӤ8EkIsJ٪+q9LN[ a\RQa`~/+袰P7n6 ]ۦ_zyɭjC1}~i~+nwKC5жL.KFc#\*3WK}ٮJ!@3ģu*TSA3-^^kի r [Fl\4ujkh(ώu AaB.x~k8X7o.>UfV,.yLƊ읧wպnd2DQJ M$znDj?k]Zh4݈FE-Séuk as3 kf(BZ֍yi3F4X#3K)+}a\i4lh͙nm^'ekǺb}] BoG璘|*q ԐJGGu޹Y}HH(ѝ(::ɾswf==q}l8z6d/ac7Zl2z_iW_!UI9Ol^/  endstream endobj 48 0 obj << /Length 1790 /Filter /FlateDecode >> stream xڕXK6С@W.A)im/MDDe#p(r夽ѐ3̓ˣCģ7H7x$=^QT>*\剌Xosnؙϧ<eI`Z+8ūK_H}J!(h{٪Dx~m{ZABĻ[MݚV ?<=LԾkOp _kz]7wb<]KݍV5[┮l,A#x\Oh5sk+Wjgz׳6*ẃz 6mב:>ݯ]౵g:CAʼ6"x]7$W5-.1x&顝EسmL36\3F$m<քvչ-'RㅜP,A |cHe@[>Jq$TBf9%">(9+6Тޒ|]7ʛM$%;/ۙBzf_SB륝 XUբq]~gc -r1)sr7,T2?[@n/ 90½Zfﶴ2[${:-M⯁S;fH+<~D!6IG-z GWUHC =viƙYlvZ!`KAHxj-m+k_S? $0lG .kLt"t!-&V~@BJ(iN1DL79Ry r'of#yq|>/*( ǡvWu cr,8zƮkRLgsĞNF( Z̗wmPp6/HW q[Lw/Ij49 )(ۜuX`޸{7q_ء|b(]P/J g_ m9VەݣXĸI!h2̢' RgX3~nA)8 Jdl@Ǻevحq@4P|Y9hbBœt\T'R8pr oݟTtgУmhY\&K\xޅq>H7]V]@1q..wfk0/6X(>SpBbmGYSǝ5 ,"XEV^TA^#f3&aU8_B}PS*CmCd6re=Y Epߟ\3Md@_SZZ5d)dLNfC/^V8:Juׅ"M.<0" :75_|En T+hfWOj>ɦzN^GR"찼 ;\3P"Z(gEGԥ-8&^$3&^< PL;u96;ݹ9m{r5$( Vb1d%-LV$I|y%4yZ#Ms؊\)ie']ͿR`AV X3@;F^< =_km?Po;i.8tvMe [ʦ7+|9Od*'چXUמϾ 8\ѼE|~Z4G<ww [y?Z#[ހqy Z]nK io86hvCnb۵/Zܐ6$Rx񻧇ʇ endstream endobj 52 0 obj << /Length 1547 /Filter /FlateDecode >> stream xڥˎ6_CKRܶ&H-% DH+Rٸ_!-" yq^ޣGWdǼ,#)c^$++Px,&G^/_3r -p)8Iydc3~o뫛,r'<[/gSLr[W[?ZRq ]n~ ?g$s'sE!H,ԓo3FzADaF0W*i׍]0Sw靣)Xq ںѢk,;U1g)evǂ@tŦ#Wba#`8#ANEWG~[|X1 B!vPCѐUC+DA 9Lk${{[d6B k=SY-P~ݺbunM_\ԝEӈ ,"$#vx v댾J9  LF#Nuij#I}%wDBI0SEt).8R)7cJٱ=C*w]uyYMv|fQ"qk%6aP;3YB*z?4XkeR(.!q箕وB9\ eK^WyC[a̿^űTfM95\A}rjˉo'Jwޢz09DYCOWF$Ji\ @oX2 g[lӠ?&,\`j'&pzU37  Km:G+M/ۑ)s jq &66t:0f<JQ띓^`,6l'>鹕DNg昄(e3ybN45٢}b /%҄'I1H1(!LϨqI#꜈,4q3^; `f3י4{G<6vLe?^LJUB/I),,jL GE1JUZ,Ng/^4ޣޔqh FHnlOM~Qzizs:vxaHZH2:etĈ7+ ʱM=/~{-Bk/b1h L_-BZ=Ab+AY¸[bS(iupAȎ,0v~J AٗPhѓ @tπ7K8JyZ9˳Լ߾^{̃;ϼ'Kz,I\x) S(Z,F9b_He<# ~!IXxM+{uA3-־ԢV\łl}8qNH endstream endobj 56 0 obj << /Length 1788 /Filter /FlateDecode >> stream xڝXK6C"II#>6}!MM+ӶYtIi7PQA.9΋3Ï>ѫJ﫛ox$dQJsUƸ#!Ohw;R/)IʄIq-*L܊*X'yt*2qZ yqt~{ $e$8+dUŲ,-^H=wsHVIԹi13D%I;.oM0,S1jl^[U*JX։>`nQu[9Ҩ6 m:}ܠzd,ٻU8LtM=Ӭ !8r{k0lnrfSR$vUG1GV"?ZYFPu"i_֒˸ #W愌U2qɛZm`vAU6knh \ (ǃi!)/yI:UO_%Dmª0ʸJhhfa Ժbm X@PgVe\8) zu\Xzh  q/P"u(s{GI?xA5K:mGy%$U7Ѥ4 \w2`@e38℣7\;\r5k /i%DVbjgWǚ')Gː?zE7.v('eQCuS<>Wa4lBB-G~}ia~֫|*@:Jm5Ձ(q0hM?pbA& /t`?38+3 zX A40P hIbKɬW2.ǦmCk -!ʼnr//l g+p@LV2Bh49b! C:s64ľ(eO򧗝;.d#bF1aP_O ٺ"IJbvKK̿)OKi',8KƷլ dJܮ2BG$Lo@/MPH oNp2~1߈p)l<(n,䂻,z l yu0@+,$|9 i}1OOnƗAW%DݾK`Pㅋ >st )Lp^*Vl-T*ӱdMl{vm~_8_ȱ-g0)GMX"+!3˩jL#c'|AHX|=@ )&x.q8x%'pyƒe7|6æXvst[;4.B"GeĦOC! tP2^F O-8u@t{=W=u@-iVN1kgK ijlE7& [}1#Yug"oNm ]-KkvRIrrT/.b`?;z8`-  `@@. F5[t > stream xڭXKs6WVj#43$N/I0 IPKR_]$JL/k]|" V .(pg1أ i,IBYPlp?, $= b)>$2NRNYqI$'8qsvAN'2d7e9QJOZכ7 s/2FI*s{;s"D E&,dy%JZLatL >;}^Ԧ]jBvHl:MsDެʲC*IKի[ڴs\$1˪E_- LӰjدFa/['ݝ.*NutuY+dB21lu.j IXG ]U׋(Pࠪ;wЛ99^>H~1I Fw y 7- tF݂݂l"2vz`4TۺG$!`|xjs nU7k'#n'e,JI[ NmE~].:ZO9EheN@o`9[9HgI6&)''=+2c b֑vk=!l '64)NenczbFAnF$<YBHh Ŷm!n/'I0sې<{O)  ڙJ7>` 8F7W׷vlXm$pxۮwKb _rllPՙ "ɽqgfue,a~"LTkxQ%m1%ː7<||}|WIj1(t2^aQ:̓06H5t똍 HtD>IĤ6.Jo̩=DJ\1 =3skm EFq kջ4krz{3L6ɺu53<K'+Tfey%`F+`̲GZxOMs%~ҺkN]j3[7K&cJH&8icT <~"OA\_^]xU|օ06ǮBЗS׫^{ߘ;\/i#sz廫'X|V7{ךU;jՔ#Fku?cFKf|x绅O%紟(!LHa|Jxvr߸TPޏ2R<&)*,<GL=]8j'?h)L endstream endobj 62 0 obj << /Length 1936 /Filter /FlateDecode >> stream xڽXYs6~ׯےUL\<\Tiі8Ѹd(DŽ #6 3,Dh41w޻$fߝqBzKS\(^^:O iQIB&Ny듟`eĭ$~ I$,>$="韫oi$X^J II"*|0 :SW3w% I,S)lJ=}}SRJs; ;TC#&&'a _6{wQ*F^u붫3;2JSٓ# v*1ND,Nxa*(&=&7QG q9IE@:]Lkjd eQ!R_mȡR^rPU8fRީ?P0{S|P7%dr$639|Mn$<0YΚz2<9Os;}dF#Z|]zI}&|Gy`F<>DwCIv'F5\);oTsNݠnp_]]y} T`¬+xP0lQ;9SO /$!K M Fu ĺ<q k$kq2bZlYjzX7ҝo>EhN0@g3ƬVHm)|dߔ.e@XrR@udXjܗ kBh瘌ED6K9g hoRoRQ )@hWl˶kր Q*à }KFOi-qTbA_lJ(I,WU~+!-E<:[Zoz,vIdM/+x,t}nFG'FҦ&c*ނLo;qHl gfFw r,譌;¥5Ʊ+FnK!~ @ :35S r,ƇA hK|Xvg f0ow+& iUמ/W/h1X;*t96xrz' Tom)[0@w_j5[w]X ԶC& V,0ʺǧ7*I!o8UjqS'1ĉKMۋ<s|gsj !7HM7F.{rCyhsCI_,4$2OUmAdULJRDHqƣms欽p}+ʥ)W25y{-4bƅyWnc˺Y/l>u=jxvn̻uX^ZED!6W,aȯTC۸P;曬S{*>\kr`dX˺n0 zbz/|ILMaÀ.秣l"Hm^a:jaWpHh(y0=?: ֙񝇶0ts 2:tͫa  o*0k.);.Z!ppf0P (I"SÓDٸe;c7( endstream endobj 66 0 obj << /Length 2442 /Filter /FlateDecode >> stream xڵYKs8WB#55Uj+ٱf[ܡH 8~ 9^Fh4Яp7Ȑ7]H 2JH#-P. Gy,B,]<^ 3^R$EIqDsQJ -+r,*T $V_^d<g>7Ye Tnw"#6ĭ/5XEI/V2״YFi``-WJAWӷG%s7Z3U I48_P.Xb>QWƹHT6m?UA% U7Վ90ylbgyeۙh -Cw^e[Ç^"1UgՏ2p9 |n!2ZsTu)v%hzӮK !Tp{U*Ab(0qHI|.Џ"6~=qi l y(~(v?[4\ƶGP8k{76v(9*:a2,ہ%$ *jHBcgX&iP i6{`Ŗf*쨪Vs=xPNiu3 ncc]ue]HLJ>ÒȄ_%Tcڣsz|X+nNK&pP"8 X8oI?˴41W]23nk  v vm!PTpdȞH* ?:v3&ն,#hUzVv)J(PC[c$p iFJ@\XC>=̫$otp}VXՉQ3사ۺ|X%g듥 !9бo,霵|L9ٙАZHRˡmvB|FŲ3CiMG>kZĊ!Bqpٌp%18` SFhTfR_/A;C $IC ; t\ZaDym$|2X A>kʅNKAH߰gJ=( @O!tI|d>xu5Bg_ c } ~McUf{ޔetܐÀ͞*eJE>ZRA%#4#U}ɂFmgF;ȧ2哵,|XW5hC9$ߒaD=sexLپ.P nP"X1 R_~;.T H;osjǙT|vcwg/k~lt&pHysf:qtYݙXLkgr}_ * endstream endobj 69 0 obj << /Length 2031 /Filter /FlateDecode >> stream xڽXKܶ`.J;7ٖdJ+ILz5.g)ˉ* F ;/^"~_Fx2Ja,@zesC0D O"PixwLB+)\H2%R^Rv7߾< w+ڡ0=Ъ,y`ZiVCeZU ;6LּЗE]ӷ@0Fu6 ~"/ԂCYC d(s@.KĹ#5,!}9zlI6mcHUd=U4@/b8HsK D!Y5{k**XUE ?gDC&$Y>E Ɓ2~?n4cx;k/W~"lSQRP YU{Rd6E6F}kVOY5>%2%hQH#w'%sV_'0ƍJ4zUq Dpt~ q"!"D p~8ָ:i:Vw.,,| A~[mC0WzΈWkS.׸%lE:+&xꪩr:o~xq V$.`j{nA,KX~*gNIwRpR\Ϻ 2֊[˞ Y+Np!t! <@TS=08d[?!ynQ-$6Pm 4@m'Pq0 j!Hz'u\5W!-0WאivTI}B0]u@{| ۾D![j]N4UAdRm'C_\ހiН;efs\x-\Hqn˲="v679(a&0cDc DGTMqeTH*P34m?)~&(!fU릲[?U A>`:`:Eְ(r4~(4uv[ a_<2@CyǾ:?\.$yJT=꜕0e2dhT0+MvL?}Y= 'vQEЎ3}_n اB endstream endobj 72 0 obj << /Length 1474 /Filter /FlateDecode >> stream xڵWm4".7v^6AԢ:$DQ*%nho_ό,{mz<gF֋WHՇ^q/نso,Wv+E"ydOT A]ho;vߴ-QjT ́/A։8444z2O_̇N>e˱)wdh,}|;DUbp 6N Oh]zk{Gk#Mf}D - %Ea(ǖz`v7_^6U9KTSF]3NX;hP) Yfe9 6`eMCJ 9A12̦VD=qdUT֦mz5ۭ/ 69dʮb%<>~ރ1)s:YyA/~>Y=k9Hz}ɼhoiR#v};_ey',Ke~}t u_SN|y^<\:Ƽ]cXk]u'v=Q=@t=KQlNrb'%v OˡOP1z2$x;N: H_sNQ5Ttl І[u-4%,Ɏ,>6x,ĽCu?2"; z(u} 6GNHm (73:0~%38؄]H<8Fnz2M?*CH9tyQs_wO};wq}[ƇIMNuT?e/jRkӹB)yR IZVvzh'>UrrQpp14ګT&G ql-~ރB4>X/;lYäS[⹧za@> stream xWo6_ Ｕu恖(,yxm֮}Dxϟ#oE޻HwW_qE{y,^B~\&,S\;jB\U\-/ȼ+9%%+R޽!s< wnwpXXt\,IbmJv_{%L qgLVH#:5Ȗ}Cߪx1ξFHփL? E=6thZ[Uj+"aDVِ3i[- $DVl30*aqY_}߄.4,[{[ܺ-sg2HpRUCGjZH%cˇi\`T׊D6eeAoekEiDڣ;*,tv$ܫ<;(/WHե/)p/|5n񊗣^ eXӜPbga۰xW8۱1Hk9*ژv4(D JN6 !04HfӶUWghH_@+eE[42[kw xjt][9H~OAfuP!Ҩ8 ]9VMޓS i,JF6ob;ƨ<:NXNb/D?iD?um/yKfE?FA˶ ô7Ev |'m}{&W{LFW?_Lj \U6F#pm {HIǽ4q8Ĭym/EC;}>Xک 6z cj4rx*~w-j?@Hh`C $F0͉7<DK1AeUq)gVF(+gތ'FQn/{=VcwǂdO= C2I!=RC=pr.{*ܱI):`Qt˙T4_pLrMEN *jsu2= ^>Nf 1py> i $cqOoxra/߲<ߓ3$ TX 0RKbpހdt!R&j"3k' 0TC@֏8,d;$k"'Q D<At3pQMH3Ÿ%A+w!"̈kΐ Ōd'"4i#}-@^ PdUc;?[9 ĐLLw].ⴛC rOȱo̓| hXvpAmnP4Z#NC˳+L*fBι>#ǴҜ~2_?8#pc (lKuLuM}M?]. endstream endobj 79 0 obj << /Length 1031 /Filter /FlateDecode >> stream xڵV[s8~Wxfm$$<B((mg7;cˎf-Bd. \>dEҦ?yHÚm!P7:5_w a"bh9G.iI?C2ldk3Ŏ@"憚!A86_=0B)v?=#[MαC9-0ttC)LiLz! mMiԟ3UKNVJ.cT4`ʧuvY,35?}.:ͰœOφ"<OjQ(K %IaZ%"94,riA˒%QCP)A󂥉 Jo\͋s++tʲ4/i Q&wb.h.fd$ْr5Z U+@, |hASL/2 ANO<*O~׆>f,i.m CӖ(ePMns`[H_^ҕ8iFgT'Z*vYRC~8Mh|>e<VP 6*)+![-ʤߧ{A`]>K.\mܱ je[qXKC%Յl1ݶ$w\( v[rkܟMi`@d@] \PX< I'E{^6ivrs:fy6.ReLM)';oAalF XZY`6:o{ v>FT  $h5bO^ ,)uop;!}7d+==QOm\I]'JӰN>eM+Y +C8tOcp(8#h^_݂ec}@Lۥ^S-=>X=8d%*s#/]X/j.T{N7 endstream endobj 82 0 obj << /Length 1374 /Filter /FlateDecode >> stream xڕWn8}WaUitmbAi[$z)9^wxlrEgș3gM0J~&Lp@4E !A1 Y&q@”Z_YbX)E MMQ,Of$ 24 #b F2 ̗PL#1?7ZNkxi, lۍXg_؝#cjvG1y(X |ܵ];jJEtUl a  (YYݦ 1P DGcV6p`ü,@)zWXjʭV11Z /EҴKkN8N-ΨZf.0uF BF䕡 A9SθBJwtv#DmBcE9ywMeu$ =MGv)@1/HAiʏN¯2s쁾͞f+H= 8 U*/mLQLfqxM"/DuuMP۲a$(qS?̝e_-ֈ3`ve2j*W^MaOAj7X4BGBc7 faIzSgF7oMs055ۨJ~ro;hLO LDsXnR^bp]\ܣb endstream endobj 85 0 obj << /Length 1265 /Filter /FlateDecode >> stream xڽWYo6~@Ő#oi ZMhtΐcyp8g[z;P"g' xc^1/ )ab ByWM>`)4‘($ɾ).` K?'GYe$y+/cSF2 OF)i#W'S __\zDdLe$Bpb,pnp+hec$&`e*^]oOO.фvG#Fp47mF$ASzpA}rٶuk.Ui)iǺ('֪۴A^bAxAbs]oeWRrY:M;nuY}rp4ݔ i_+(C&B4)ab1y QMpTMi.pWU:mI‡Y  T \݌Mg"r!x$}Gkк_h0SBԚC k4wS&pdkR":˪0UG,%_FwT]MNAK-J"8Xg=3?7ԋ^/vcaRb:xVNԗylJd{$N.O]ɺ7(evv2ių :Ug.hhӺnsԺkv"0ȄsDŽlU8L0V&L\Ha01L@6;9>#@`sU:(8S P$L{*C \@nX*VC"ye: "|3rB_..u5\1a?i+euCX(ÚM-nnjo?znn֪~Ǹ؜=6 %Ãe J,0v>J({A{\cD{l8 ˊFM lvqN+H0YES@2fs3)^-0g#KNl*uQm`ꁏjخq>FU;dU0ŸIvj%{Jlha x]/.wzG}cx{#{?b儾KnK]r(v=`R]c?=仗]v1w='-ߚe?)JB endstream endobj 88 0 obj << /Length 659 /Filter /FlateDecode >> stream xŖMs0 a:VԛnڸqcIf LBƞsA Zˇ`dI[:a^cHPBRsK_ʥ <22! tJQ[Jn]).z;EUH (gE $'\ڞ3Ƙ}^fQ>t@H-%ǨR52B)!MC;#V* 2pd[oKS$J3g%YR鬦G 8G/> stream xڽVKs6WVr&Bl)'R3&=@$h% 㺿lQ=fԋ~^.'冂< QFH)a"A"LA==Rl$((%7 T,AA@ 4TpM 8yڳi)u߂K@y@0E$#&c님"5&` JiB)R:L <&{u4)W+G|)v'^9fu \2Ba4A .˗/JpJ 9F-I<9HyrS)v+X޳vrdlryh>u,Ni4;jG@t3/s(:೛,wZ `̡lb+aޘ6y[+NWo^LP'U佯#ZJX[A7'oΛc1j/a 8Ò)XvexM?mɌr|FlKXDqMt̓=+.vL?]/v2hoXԎx)+070$M2 St#띙FŴG@&QmvRyofrt>zqoJz|HZ*n _#CX;\!]  *8Nw]670k44MUy%{XVoE~Z,êQs@xe p!T)}"ҐQGQ4 Ù7\zNɔ,kWr~8j7@6S;Y &Gy߇ndy(1mVhWms!;jΌ g@{GeiHёp˳GE kEط jY.a27qS> i_[vڃe3^vQZhNznyǍ]ϷZ(:~ K. endstream endobj 95 0 obj << /Length 1268 /Filter /FlateDecode >> stream xڵWn6}WC"- dS;"n}"ӶPYrI[;#J*f}1Cq.34uu&D( uE$d $eN^>,p$Vj tDcI ,'!MqI$OXz؉IYN9I$X:2J{=^cBy,ނ5+~`@:S`]'>x=bl؍>26j'@ou\sm3c(}v\dk'Ɋ!j[²"k8fbDi8< :t'{܇/ð(9 G,us08="$ FJ 80Gqy ]`MNCP)|i41|߇ C<8RYg]RmYEy~wxq6YyX\v3`&.QZK*l.$]%ƨAc5ewieTQ&A?R<(aI4:*jMhئV_ړ5v, VP 4xv8#NbX@uV_>V0BXOx(瀄/Nn 1<,a]iN$p4'&v퉀'rmƙdH "mϚqժ;e/m̊2Iօ  kTN:xpq_f'-usNd`US/ƈECg DN$ ^պm»ގ x_(Mm!>\ڎIQN].lLgd@dW/oUOhܪ12 *#=ww77VVvlTGaeXVmK|4;ʖy\~o_v8ǎbb/֚ endstream endobj 98 0 obj << /Length 1714 /Filter /FlateDecode >> stream xXo8 _{KEӇ%[7Cׯe(ޚ0lCJj{`wQcزL"#E{k{GzϋaxaBq$0͑gGp[ NpbN~HQ@>+' NGoΉ$ o$AS`"QȩH/12]dxJ5 #\6LJ T7!Hr-r| ̇ADr ؍Fu*5Q'Y%i֔F؛Q -YYVL)B3Uqye?bJ1MrNZ)xϿ|ԍǴ:&SA9þ>>qhawkWqvW:Y&isX [-pQ(an}v s}v\6nש|ʑُFlg;l*]*{l?AS<w 4⾳IW{M=G ^aŶԞn҃DYnZOfI"QƦN--,RuQ~ viC ,o61V Y`I6*8)DL4fDUP3b/1X#,2;oҮ\Ŧv@{r$Y =-FCߘ|w  `)o2^К([TY[W~DRb唄v3%Rm'St[ĎlCTU6 G[eqgvf xTdTf/>2Om}s"jH "l Pˊ9yYVdM: 8$:ηQU6 i 5vƞf\o&uh 9<` R{V!HĐ IK)HВi ` eNzE!6x# A<]r,ZW9 c?cQgtBFC\AQ)=?`` /߰\3!je T/jI)(=}7 $%F 4=7ӫŐu1ٍ}NWFDYU!/K*VaNIg[r|ChQ? .ChC7/~dx\ok}"Lr0?{4}{Fz螮hJhR@_}fDiBzׁ.HU+s񰟛"fII{#K衙uۯ5`| ڡ۩DЩaSuQ 0L;s&?3( (eF(^16<zu~>?KFLuz?^N%|~"wPU࣍}8ŀ'pfc&na\8S 4cK]u}yqvruz?;E3* z?@`O/lvws{rrv3x đ6GVcUUc) 8\9EՒf]^،[edj\qmg[a_==ױVmTu-4A7?wgǷ dۀt9W;섀E;uC t` ~mfMS(aOKӸغ6׹0*hTK٦G=ێH endstream endobj 101 0 obj << /Length 925 /Filter /FlateDecode >> stream xUߏ6~߿‰*RZݦyH ]$6cj/(ׇ>}#$1(E~aQ H+Y;C"ŧ;"=_-I,#IaDD0{/J^ei(?VA-(,AX>L(%<$}e^KaRmP1'' nkbxUcuieEzKeMiҭj߼NYMWe,%ެmQWn,ڥiӶҲu견3[>l iCdʒC.F\]./HۍV퇡ַ\ǹ4+] =nPVcW*MicjesֆyugͮJx0Z;'UY z0*=n[aI't(׸Iᇘp1}$^r6JƮe݆=u,eUc}o)I,G=YO~\դ۟vwNߌ;{ׅH~Xp$ ū7iE鉁[gH8rܔWf4O_9ɱyyvmX/W/-Ԗ endstream endobj 104 0 obj << /Length 1266 /Filter /FlateDecode >> stream xWY4~_d5m|9s+@hA#wtI!tI/BU;M;</IPL3"Li>KCI0 Vz{51-4 E1ת(G+8>^҈FޡR($E !Q'ce%¸c-?נ&(Q!#FM Srm! ܹzwcuwzD3ӄ=Ȫ,U,AR2e)P?XTR?[+I2Bb te\$*o(*):r2 o1|زU, Pd=ܿS8~€up |qY֊r^l@5t4Cͱ).Ʋ2RѴ= #(9xsT~%zqֆ5>gp^qFQhWe}ߴ5ghve fKhM2u!OjaL3? V]LR!iDؚS endstream endobj 107 0 obj << /Length 1787 /Filter /FlateDecode >> stream xڵXoF _M.}ѡm)]C[tʒٰ}e[vQI#yޫb'x^H/R\x* '42-O“AHSKXL 狓/E%, e-^"$,[{?ܿ(ntl&}\+0 E:jT P`j}1h,hz!HSV,?pͳ.[ʋ?RZpS=OtÓS`h.1tJSi~]z1c1l95*I`4oi/:׾P5I>);U1d M)IvJ뀅.7SZd*w"CE,AɔŔHHJD~Qee*'"ϋt,-jMXk㈪ܚҭmҮogO;(d* Vܿ5nE0˦8*u˪I 7d]?1ncBt9<:¥:mhvkBM_ᷢA%ٞ>^~D3\4-0R&.t70oLEm]@&jn,)hk 82nMV,ܭS2m11:Lc2CqLpջ뛫/Ο]L-%#9`@gǮPLxrP#<ywUWEJҭd۴ G dzi\2Pwh{0~ #&U89͠U$Xej1t0 ٚXPvƲkn:-.]PM0Y =%Q9'ӑڭ|TNk:]ov* ];;{q}=Ph1dnR4M3:7lT;a :40K{7 Ю/**%LJQݏ3 Qson-nK*6#d  4|)ݰۢZ&EiJ7thSB>(P>^&ڮ鳽ZXKnwv, 'Ӂc`v|d|gMu5cƞ 6$S ѷqT!ms7vVQN ݕtǁAt;Ţ/&\v'#{(7جf) S"CvYںMUmSdXBn.)X4 ~lphM:G(w.oFu0T1|wqqH&<< f>5,:sJZĿ+,JqR< g=B!.w:}wr'W@7o~yqv~}~u99^x /A%X8؉BY-6d 5iR%6O)"}"j2V/~L%CG5Qޝ1YKX[U}}rh$H)|dt՛LG,:?*#5xpXm"q-XK;nd 6.@͜ws"v vSN?f{ROR B A&4wT_{zݡ\I 9"&=]Gڛv|-SS om endstream endobj 110 0 obj << /Length 1450 /Filter /FlateDecode >> stream xYv8}W*!ҒҮ80I#K&6ʹΌ֐t7>::Gֽ#\Y߳aXB, dcbɑgGSnuw;HHNjij<ԶwG@< j-V֗qo-G ާ 3@E0rW0C3 F^`|ʈE򄤼HXN񄂸iלUq4Yr| ~c54ؚrU˴-E: ^u("ur-[3}ԕͥkI8b 7EP{QJ?ҺNOVUzdr2sfz]MD~8,О{k [RَkFxIxMlt~iY:*vr0^T*?kO(c3m}*z~e[=σu$;D)$~*љy)_bDr@bϔǓht1>w~sR+PUhj g0~ Gc洐Xcw!#ڊZËIg1N?zK.^0l1`qE-ZMɘRgrUxU-ҏ0 V]Is=Nnq)qOPQ^g[`aLXĪύ6&_@~ JU]BM˅@3r2A[բl\0 jY ӟla9Džyіؐv 6ihA9ܦNoݐZU <>5^Xv(,+qI@P@ݛAnnN $[xul{6Q Sfl3I,:~FhhǓSAD{;6bfn ElI*RM*o; (:޲aZ)raP2ԦKU},TBVTrWD?ԃwhk$uq+<ӹbVI|q91yS!O8*2X?Jx [_U~As3:sȩ&hkbq~y1|t~|p&N,wnˁœC7U} Z&b~~qu#5e6L m_+8Xwq[u~,=cgu'iԤH2XNFnfafy$yjjڲLPזբ,k4Ï}q櫘bf Jn10;}4ZSuQś7ͬw=N&Ӧ:[G΢'<\?_W:4&Rú[ endstream endobj 114 0 obj << /Length 1816 /Filter /FlateDecode >> stream xXmo6_ 1CR^6mv: P(2 Ӌ'Ma}w$خehė=w'S֢֫#JBWG1XY+OGF̷ {V%ϰjr&wOrPD0糣,"ܷf +bSJ" n;wRj7,·smoh( DԸQD<eJz,H$ra #xHh) d C3%7#sBCns8C? ҄>|Yqx?,ށJWpAEY^oi\Oc` 8k7IISB!3{!HlK=ا3Qڒӫ+f_IOZrJ"/|imI {=8g9Gc^,.'^ox::Bد BDp.s=a粮[Yz(Jo=yf5qc.ջ4˴P!8jJUZ$β k3 dDW;ȅ<0z&UYEZɤ)IIq&qhR FǼ}/}t}\~@B8>ruO˕^`M_ONQGI~d<_HsdeÁ@@KҺI"Ua٬_jHeHH 8M,,LΏa];]ոV褐@;ExW˴^-73: pZ0e]`}Lu} ً)WZ1 \ӸIpԵ'2iZt1~ЮcSSTm== Mm@d}Y뫺@fWuP;ґ5&kXYI(,Z-EqW\^;8AN۝?tj/NU~P..eZɪCwо[Xvs8@*ka|a3+]Z:-&Kq+G3&h8W`X b(Ce"is lUM0J,wat6'yCIo%TyB*Ap23 h;]t=\O矃2]Z:e *8'e1P M)= $52I֫TuDB_i':{iZIoMȼ͗ ~hoLI-u6JJBM6P`,V@ ~[@c&YWҊU 0<~feqۖ"Ft[mZ?^? endstream endobj 117 0 obj << /Length 1316 /Filter /FlateDecode >> stream xڝVK6WPZqIaɷn6 R$h[IDR#Jq~}/vtуg8o8.FHTUhIH Tb5gu0)#R Lhvpj.4EKVE TM+RG5KZFmTD1%5 }\&)odO Ɋ>{3߁נVhYVMV(30b5dJZt˜Fi#ˁ ԅwe E{٫DKRZeS6638J)NmbG5}ɁoO*3,)6 G}1[:'{5 4LJ[Ue’\`X%:^@o&otμ=LWC1R|: Sɸzڱy5ğfY"(V |r >f(OWO>w>F7#{* [LgU K &d6Lۺ:9}b'L5nW]o lX#66'72cltfVq \}>\xTzN(2`N0ʰ-.[as{ݮ6}G>9ncb0 3jRFszF=b<^$RGA]o=3ԭ|;u3̯tMx6ٱXֻFdUtS s ק rEItpk Q8;P^g^ܑ;N1k{8d,j\\Z@sjd|2MJ\/e endstream endobj 120 0 obj << /Length 678 /Filter /FlateDecode >> stream xڍv0xo#9(j}W%~Fao6vHLU4J]~2kMFWEu1vrw9io tB`6e Xow%z0k4 8/8y2IBU&޻7bOBބ0Aw 8xhj1M¢ e!F{Yv#'\J|6㹵^\ӧ*vIV3~k3MDY{2$i/6IO?5a}PqtBgͬL.#M+DTcUh%Y"] K-#5Jzsa`;ӱ@? bI"wZFc`p>fROGeP I endstream endobj 130 0 obj << /Length1 1420 /Length2 5888 /Length3 0 /Length 6851 /Filter /FlateDecode >> stream xڍwT6 "UJDPHWB $$"HoJM{ RR(|{=~<7׌La(; d`f o;"PH@b($Pd7e@ to #Tx `@} xUQho GoݺyW8PA@!H>w%TB\((G ~9G-#*)qŊ0 7#c<0O@+5/0EA ,g],aqs'?ϡ`?gRLR ` $;I00/EE(!HGa?-) E_{ T6ة&JSxeHl+P}J\biV3.}v;>˵\u\k\v|8'hX&\)tqFuP)Myi}TqS'ՠ$S&f>]r>>Zbέ+v[|pO(^]CMb&ҏbt;MFMXw@a5Ď#Nz J*&756EثpLCh+=59]7EmO0 x~/bmBy- C+o hbk| ȭ27wv2/qYp۝l.S(?y8@Ѱmx!+d{uWk'Xn6x^>r:+Nҥ/u`A%vm͙: m1v^z ڂZ&}`Lud5m #{ǀ>ٰL]$;kHvNRe 179.!xkPQoZJyǏso܏OhPHب/m01̜ G/~G2N2K#Hڼk[qYtJ7:^^fͺH/oģkvs2Y5$ i'%en,{0]>¿Lq;O R`<:٭q뱓Zh7(ߍɇo77}shǹefוǚ.֒pWPgTF`wlL܈GS>vf/[C?~- κ_p|~^A1qj,C꫉g jy MѲK%0ncDPiRSIW2ubNI[Zx;.>6j YQ-|ꊚ_ =AO_}qdPdVM n EA _PjWD_Drt7+sON]$.ׅ ?^0C r068.f$I3dIajd9> +(@ޏأ"! Q݊ {CJ˹wK%9%Gكg JɽGJ?PV ݱlAsM@͵zm OzS3a.fZ}ȑ3.yOl2Lf$*Dkך Xiʎo5KbK7+Շ"־VS`AT彽B.'7ӯh ]sB;(w N_SkL_@^QlɶX{z\kŌO`Hyo-8ke*O,>*i]۳C~{wE^h p`c9%* I:3|f973<,#:Ly6zFqW T+VM[4S I{\\..egچZvFȦ3)Yq6OCKr>,̮&nk:V,t$n$J~b>R?|azLX1zgBy{ۅޅ淸\$[ _?Qu*2Ě1݊Vo&.4tJxM[^e"My_pNtdjO8b<dVdw:"mYJ;Հ(pRXW'ŧ:&t[WjmO=rHLE} g"R׫kY rR8pK׬sH"MaNi;c6p:K8Bs7JQQݒt^zjoڕS#vq3E}ɴZSO~8̭ȜF<{;4K9X3GYEruG0IiKkA%+1d #<*ϨE#c?40'hg ݥ@X@@nozK5D|17Saz=΅'uVF*(nh 8똚IyLG [ŷj3 ʧҮɽO6Y46|~&VU͢K ruu)Ju(.9ɈR_![8̼WXއń8h4Sy@GϺg'.DQ2(y6c ¼{vNKS_+V4Q y?޵t1LI%{SW">)Ъ0CУpbB_p4qLm:CAixԟkhŸ _+'+͛ 2\x@^NUdn~7K+M6+3TvqJW4EB)i7Y BF}u\`2i}Gsf2]uO/p5 FU > \' xfuCm/6v~FX*)ŽW_<1l=[0+ho**3U.W?h$G8 )rOZ/cڟX>qJ)Zruiًlם`I9soT;~ˋ U95 푊-=｛,<Rq{}ڽkAT\2ٵK#"%03zQx0 Qib`Seib9COo{3X17ׯg" ue}̚%҅vz\l5F@漹[z.T^howѴ|~x%Cl:MaiFUU `<~ln@Kx#`/}zh,E7:~nxţN`t(ZZ [<,ylN8#kCLh+ $ʆ9ռ3'!i-n1>Tat$UҮ5ywJM59ZI#1,g^rCfHh؏٥㪏.FU1bbm2]Ŭg YkZϊ#hpw1ۗ.sΞ+gd DcQX@m~c-^6|zL]`.ۍDc/rѨ8)!veM⢑boC+'>_]katTm1:; .ٟ=̬eN,[(:񶀉\z,IȔcu5-֍IP1e3NťЦB7R>Goٺ3 Y;9B~wn6S3bO*6Z{N]x]t?SUEM#IgsvLs}uw3H0WTH޲.8-[|ǹuw/Ȉxִҥ%D9}ۯJh"쎒2s/rX…djN?xiAD8-QZ/JJt{kWjE^p5(?FUyw+tI8d|y–n)E6 tB)#VBYܣ^O{C&e9O )ÜTC?=!z뭖8NjYds=. r)@m@[މ@|!=":Yfhn>e%Uo_?>%'!HF? Q{Q' 2 lzksh,4]vL'k=9[oy^]'ɯNW<4ml<^zC g!yjv>V'Ŧ|M1wT 쎖b=/^92ե9],1arg6lfizTr({Be,&>xI+\գ# ޭ3#'}CRo0f# =.I.7pthr9i,zˑsn",fI1t\`,Z;]iq%gz00b] {_M d3@^4Oi8')F{`9#2SڦIݴpwe6Hu=l۵rA$_PpjsdcVK[cߟ68HdI_4II))hDCf3l|a~jIrF&4}dx7Qթt4t*/~rs0{~GyKƉK!ɰ шs c5 YWt<")ɔE S0AX2NzmR9^e&@[b7?H+[9DH=$9vr{jCA[ _ 5*)EPFVҒ&? pj"tǣV6:Oyx IYܯV8MZuup?l}Wvkp%K|,}^=;<)~N%;n|k$?~uY RQ~&̃gwJ*z)[8U(A1r_-c'MP9D,1c/*`X̣ 3O{,xȷDS*⦑ pp,2]cSYIZz} {|ػ|{k(HY;Bsi&S6CM endstream endobj 132 0 obj << /Length1 1453 /Length2 6337 /Length3 0 /Length 7325 /Filter /FlateDecode >> stream xڍx4}ۿU[Q;Ԟ {!Ԟ*(j֚ERZV)5i\&'T @ Re]cKD&04 ꅂ!RauDcd*h.@"H\ "*>0@WD@QDHO/+G7Pz#v`2hJ"]FP  s&H0qR#Ѿ^PFz0ƚ:}O(/c  @0ogG0!\08#C_p;:a ~PS48b{<(A Я06" H("U _pH_D'g S Tc[EDbb >v[[8c`@aPQ  @{yCSh wt3/ד-a$o#2TհR_J%% P@X )@ 1( qՁ8T5H_ 0fpY?3!1|M(yԼz  go4f7t A9օB`D;bvD _rJ `׿0090w0^@0v-(~g^U ¢bG//G" 0'Q@ oH4 pFz,H _"Co0 zA{c&Kj^^MLPL8KG=:oPd_YKEs}C>s_Rwg,`*zz>w|eArFKup]PxK(3I2)NqjD`k͕n>%'SUjJr(?%gb@'*b?de_EZڐ'QzYxhN^a?%)u%}_NU`QvX]4-±a:(,N%S62he%C"-.zannB-1o|"ӖߐͮQ:90zԝEVTY`kM x!biιCb^*H6S.1񉒘sݥL&@Gm{.' tv۫ѾC$>LXEwNsM7fbF^{B\ui+Ʌ)d3b&:[X9z7-CgI{X6M6S" / ٥8y iX:TqiZwS.,g痋MC*9'HurPdk Yj(1ԗn-?SC*Qua2xMkh!8S!G6Bέ'߉Ag6<[<TWRPq-DIrJǚ|$qj Gb:mєZ?lhP<) Wc QB_앿"q}pvX{+m%sK, TuoյW!52@~3tGvz:$z,LFyG{ɳ'?83s,j?ilBt(\AO MIme #}|Γw twX`X:Oo`#3I>uŵ=z\:לaohTLf(V 9íe (Ai+VխI73[&Qal~Q%M)E:QvlI?rhdž{kfrBn+鬂=0XY;%M3|KQ)w19 >?x@9P{jEE?nYU'euq6b\tJe$'cC|R؛\M+tOvW=y#}Hʾ7JDE2L6$;1<$@O3Q7#ՉK/ҌP;Pq]:( ]Sۙx1XvR>_^k~:T,ވAv=w}YڽyS@ZR2'w7q߱9x>=k {3aȖBR(em͎'ds ԑ{vqi&ۘX:y;8HQ(WLI}}:a]nrd[Y@Hp`ЈBlC<鍫*'bzǹjpWχz4f6&#zlOWrԟ>}F_7Ip X =nLa8k;z)]d;,NODӢ)M2vF*:4,P˺ݘ5.8Vfdy7<#Iw \ į_c{h=Ƣ.JtH%&_,&ǎ[&ku4th/|#_=?sp(+& Idiڸr "т;2"j]ϼŞڂ̶RpSg+F{&8ȁ؊W_<";&>Ã<"Tݣ3젮,D·AJi@j 8ͳE4ݡݷBuL4(K h^rg-6u`/$E-bEڔ |A[ fs_W+k drUsl> Zjj] 鷊 jS>Dn#Y܃W?/=Hn'Hl9nd+wH鬲jBt0y-/h83'=SHĽuۇB0Z)*ɻU憟9"gh=k_(/AkzލN[rWMxgoM/YBqbY2ዅԷ-<)e&gD~4N47i>@N`Mwi. ڼ;a}Z_+2㹉?4gҕAџ^gbTk賝 ʺP %hMeӘ|E"wMw]L2FI~`N L%bsT o)V#,J<.m8 %{%ۢÞqJsZ9 8Nc$Ywܶ4!z8P5zo"j. ;+=4ݝn=5!عSnTfzn֩=W5cpg y:./)-5ROK;Qo}R"Ԑj~xR ޲֩11ldg9GGO]Mtvme5!buצzm;ʄ&437nfe$\pVVkqu]~`w6ON.Ħ2bMOݹ%.(|gu$Dy`첈*#Rtҷ)|XRs,֤"XnUXP% jJo=G|95x&;m}*ME|W.Z_>w=II7zAѫz>Xyy|lhQ' {7 S&>Vvx:Y7&%̬>o{":Lr['|Kچ@:ٚiݰ{~H-շլ}/??, ERU5R={q$d {:_5俵9:N`R,zf?@.=9&;3!7Az|]n7ZtE d ^!k;Q  OoYN d~" Q-f!; yZ&7ʟFESYc֎u."RH(0q9q i9j,y~]G|z5 !)x5_ѹD Q'-KXM!\NnjmI3RM'Cnek/J,"3QɘV<{^B q{zK*B#G{k4"B-ɧ*xO I=Jh$Cwk+ya$2CKh|ˬk_'\\Gj;ndkGul/]ҕ%L .'H+&W|U%a9D^z%ŊCx$@٦n4P~LC f/8N7>wLg A3U7XO4i_W+rj/&A,GDз 9O隩QENkn K9gW=OcZk~vUGU4:O'*Չw-NnY@S\!H:Aգ4 eԴ)7b\+n[M݉_v50L&řкlTrcWoQ#Z*\_t`#ҷ~*NϪ,75f9$Yu[ړMzV0]7<S]Q ϴJM1Z,+e!߆G jF߰?5' tVi\Ab,MPx6lSzĕHCߜ703[z'Ѷ z\bGbϔ{U ^8s(:YtXˡk8lnGn]ѨC̈́g(duiT<´fKfMF@o_w<п6zW?G Qcy0IeGvW2Nn~EQĨZ|PU[G`е\'6)vJ#J] er$6^PK9 FY#4/[ΦW~SH$ .)_O UV2{ħ9 Si_kzXSwGkzVR ,: K+GƧC: js`0;[MέC*Wf-CB%.zG8M9^m<ٮ!P w}gwWb+z4 Bi7߷ԅF}!V-BU+Y*FߨPT()$qm$uXpOȺT2[pPʿ8|OCZLG´F󦋵bA {{/}K?_јS#\|@(:u+/sڛ # @bA;Qw~XUT_G m“vrhU,VyJ h.]B&> stream xڬcx&.;==m|b۶mLl۶3wu뮻ɈM쌀bvtL\9 #'Y;[:% ௑Lhlag+b M"@c33 lghaf TUR/?GF7@w :T@5 ,))'Sm#k c1 H0sX{054'XNC=oh`tprX8 m`aklbvSw{/3oVt67t'_7I;cJ/_O.# o`dak_ h@3CGk_to[{+_ g')=ߜsY13(v&M\Q33TIZ{Lp rvS(TA['j]?\ m 獱6t7?AuIH:m_Ampp(X8L v_vU[-j&?|*V.+ҿ3 JǛJ'7J 0(gGUv&k;ecfa`b?$ e -gd` O'Q[c;&F/?ncGǿ-5@;nuΘ;2-3ݹ+wxBD |8ؾAƮgZg{m0}gǁ^LkU> U_&y;a^)bz6^;T#3k:=qj},F'r#j]9yP-d.MN,,!oQC'+.b r8yRkogk!&/fKlYş9ʹ̣~KbMTSGFX2VGtm#H,3^>M½Kl{$\.9?{@ka܌2`˙eY A{%LOe⿚{r^6hdiaCެ~:& ƁwZ]!t6MdΎ}fBqTlsg9|?gh"-HݎiKo$ T027#?;̒!zkLxȌ/'9.{7 VƙWV=Ie8T}=<]G/lr<;7͵Q4ؗZyK!΀ʹZ8a[Ki騡 -@_S.|Ѡj>EA]Cߺչ2A`#=D63n8hHxm5x*|$]"#EђFVw'8S: m$*7NLr8a&qT[;Uu%̷f4*3i|kNN <>9#̊H B zT;lJImNFV_jOZ͖$P44..$NzL{mQ;kK`4O8CqBavC[~B& v=C2l/aPy*csb8T`G7&s#Reמt;uW 8O+k\f}nn3esDi/綘Yk%Z /!🉖BBYgō:t5$&5N ؓ#bpfkgpN{a5~M:pOo}ŸL1_1cށ nmn:!ʐ?@1鋖"5R\.Řٟ c\Bh$$Qjʅ=c]Svb!,﹟pk]lM<|ȱnh2m˞?wTq hp5J:; ~VO$ϯv?" Dao_d70!Z~һf$&3u\p ln'^btށ0Ϸߚu8iwX\#D PrݡO(BREV@!|ܤq w Tϡ-} Ws.ݢt涨=WՂ:Yb 3hH$f2zKeזE&܋Li> @aIrX \ɯ0_Y幠f3W-RߐLZ2UOLǷIƅ9,"#Og 5,ctv%cpY~Ic6tY@02x\rV;CNs. *ㆄcBem҅>ez]vkإ.~:4=ͮB2" h٥tOu73ފDmouX]}o#dK@7#쑾t-1K 𕯻B4&tmA^ Z,Q]YƗ3+_v%i_i:HūuVZo hhnj-|)?`}|S2 eQ~@YYRVvm'! ;d6VIYblv}IC=zKy5,81t6~O")  i!<1 L h/}%Vup3ى2ƨ7 e: +x喂rP zI2="Xv F7^Hr\4kP=2uw.i}'5­kܝp!C^>y?5>"L":$.#ϝi=_ 2f)v_F'4 _"$73Ҿۘ0-iFןa)3 05_=؎Ԫ{̂Dq ֌ 0 䭺Δ %Y^UBIRO ӭuw(KqvG͏gJ2&_&KukJl>`K̹ Xd?eIXJlbugfo:T\.ǓHӊ C\0mʵ{Dvi0//YiljoV4(H糵 \?k]K,91lm^BUW8MZ }(Sߴ2KcAHZFnD`G5S *R<ɼ/AoЇ2--ÚNo]98jjD-ޔC,_(#لv_m+E οg #.)/uI=F*iINMKIbk"=LTP->ޯAi-F?o EAH2w!α6ǿy&tR*+qb$s 1,Gy۪O'ۛ%?MCؐP6:[YUO H[Oiֳ@J&[@ؤ-AkMoBE{âc>,0Ksz$D? !tV\Zrc,i!-;D(5L-l}b)&O;@HIscS )@aWr<@yρv9ʥ;K^̗}8JTr_ 1X*7.rי@V~SI d aM@IR+ ͎֎Y%>I*X bAƈRVӨTpfN+g' u嬂ޮ2[`ZHw{2קue!e&ZwHrh|6)%8HJP'ROj@D`>>Jxy^SB RԪ{]݋ZR|+4f ieYyq|nSpf, $ \:}F+ώXC}JR1<ӫK=SKq'ڎ!HקH֛<%,zt*RN0 qW]MV#A6.z("`'f܈g<.;?T݌l &+)V<# J셠=(R(.9h4 &՗ొB n98) i/{4P4ާywZf]Sl]=0APLGTiZ"σ, 'd3ޅ߶a6T(A [;rʸ1l.Y)9r k J3m,MT`aqV*,`O)|+z PݻLj[,kg#гNʥ 2>~!d0eW*.IrgyiWEvx'c<ن-<_A%o{kإ֓ lm<4Xq r"6T쎀 7I6]Kdz͏~"o \Q3vV;.ܷ9u{P|/EV"ܘ驓d|ݏh5mA]-#ч M(}F⭨DLnL<q^||8%.zL\9٥S8{ އ XQOJ "nuX*Z-BݙtVafȮɊ_1ET+!v72' 8/}=YFիF&VCuL4m$:{J{ Ua8 ~@!{rUǓ?1ۦm M7M tݩh}6R40M֘Zdhݠ`L,qi+&ќ?6Vl$asM e C32iq=wˏ77*`/o Q8bGS*k#tm6W-}9 %?;iyjtE"}FQ& iSH6_JZ/kyXwtI|9ZrXKU:`usa.D?2QD$IסobMSm{#TRSTETuĦ*?ȱ{HD0 h%>nJ:EF$qF^UbdyϑIwB)?}ɾƳ3':Ɇ7$v.la_?b~p|d<ڲ 慄w0Aٛ r4=a` K !O:8n-H{i@X*9|#$QT j'P5]`b?BwG DŽ兑(oĆFvBB53}\(mvd۟mzyz~tkJ <$QhWC R=:Xxртq5/:V/`LKy^0 5cYcWꊮRN=Wvqx@CK,O!t>і{ud ~$aGy-627ߍ|^ :X(Xu# trƆE>e}s20絞׆ܿ5F1|7 i9+eP/{@$Oյ3:h'yU# N saݵ wK_Ş]:W:8,щ'>V~$y`I\GazᤷX8D\%5a]5S&}/mP|e9~PNqOSaQ{V)ƞ#XD` ˢZ#+WM&y塚sMoڐx'kgg| DfSZ 0ògQtFQQ/1'fkTp<pctCdb뀘wMD*WNh!?mt̚~Z.܅jyfx YL?߬t~qT+#,V[/Dc=|7,x_nCtE2?ΊA ǴɾH= jQS77SÄlVUxbhv_/;:Vg#\?F$8jzwA5l j75(jSDs,y {tweb˛"FLׯcݡ=L'H~CЀ E_WaӤ@M9kQYň9|>fClQKlHiؕ0\)$lvp0-*;xWԱpJZm&&7⇞s)&8a=!Iػ͕|.f~z+C-)Md@Ώ%]vq[ߝF(R]EWXC[kuZ%$A+C:X%b(RlwM$NjsƧxc:Ρb<'U@U7 Y'%}o'P z@WP8mS0{OXĬ@铬 E9SF̖՚fq~UtZVp7J5R+{rqV0-;HSy7Cb_{g=-z,< u9˨IƜTԒYBpߔ!EqSLZn! :8J Bˮ\:):z2"xrQHN󭕭 zpc?v i,XOS Yͨ <^IRSU^oWpdHrNsYe{g,JMLaq%{84Gb?EDVekrE٭9+i+YĢ|4,j1܀B?O[ӕ8d!b*L}6] *΢1ת0GqIœY]'fT߃h"54Ҁyyla(Ef^ˠZt˻C &&ݪ93#H rxV$`lɪivQ&"peCx^l*opĐZF99DoN|5L{h>ؔI>j-҈ F'D? "+x" Ɵf_H=XgtUJw;UڗElYcvN8Us-d4S8S+1=h>@>wʕJhL2& *!JįcFʀǮ;رu',[.n~ A[\EL06/JBy)`z&b9uk&qj_kѦ9e>Sv}\COإECjR;u|e v һ_0eqJ_0,NQ HvgI:0Fa$ɎfxU@2rZ7HSq!?fx촏":F3ҽSCa'lpdM8j<ᝀr"cwb>],+FlЉαHTR*4/gVӎ\mQ,AI9;D(#yr}8.xo$0gW.~"%j6|v-Oɒ2}]U#^ O8 ByvP,*$N/Xý;d< c*sM#%҄*˨VVE~V7k ;vn1Gz 3Gm,Z|>Yyd>AKKIO4r"Agd){^a=8jLjXsO+-=?I΄N6.5 Ws0`,~Ǭ`VӇ8#ewEC:Ɂp]7aƿIN^j&d@'g|#R^3Ofc(ݴYϜl%1~M=;O~71[#Аp!`27j u (t4V[1j_?S'˹ϕq}YEDAxLvס+y09ا!'s$@pw)ɞ?V/y<݀iKAv;bltI"'l]T<1a6%a,\iuZS5C 9l%Ey.ͦi>B&LF^iU{Eb:ݎzSwc|BiՋ@\G?ƒӊ-s%ʍ8ZJ&כl /3L;HWOoH4/,PyesX;l#+xgiNgd}jTF|R \pc䪛s7a" G2$2)2֚mۇ=j0L~[*dI{g|ӓ k_AlMH 7|F^ \6Y (ط7GTB \QA ]AH Z *spϻF1Gt*5"EPZo&6̄0t~'W*A𫸮yId:V*XJ@=stx'/'ɽQ"߲6e·5^F}'*㩵x.0~"bԨV*KO'^*_W9^w!Hm+8s5)Cj-p`۫:d RVHUf}FD`=|al( cr_M ;teDEէ ~ z{7(g0sq"6Pc7YGd`<{58Hep 4`tSXTsr Rl83}'(Ϳ*r?~@a&qf_Zl[&Vu=b9!DL㠝%\v8q+,fVgK)1L#|/3qBm|<{1?h Y_ݎ0VwwJB9b sk益l'ծҽ℅7hܵfOOBɤ t:=2C`81l͉ :&ɗ1mCVvkvZ*1S,=+LmhfJˬֵu҆]0˜P}.;<#F fXw߯ @*㌴i17Hbfsz+pZ$A=f)<驴!mXՈcߟk ?puit<( FRH@xL \Ќ-QfJUiȸWS1|zvU~.uaYX͡_қ(gW*WtCRQa=8^t j[_̗ (p2m3hsBd fЂ -0n 1Keq1g %;T9O^G0ؐڍIHY¡Hn Rf,9x髓:jz܈Q+T\qlSVH-U##6أ1<[ɱZewܯ{iL$+]+fչ&$fX+@Ad$!i(GvCr2j_lVq;c\'kapPb\d;&PVFGڪ ! ?ZFâJ#}/7X2\Z16NrKXNbiMI܄\&8bT_3(`#~^+n ߏoGVBKׅג+;9{%$(!=psW < n~OZ"5:yCqn#xMJ填*w޼sW:Dr\w/7ROMeMi$/`I O"x}H!NSa\F6@`Ojt栢r} W!,J6 cf2/DW<MҀ @"D`1JxZL"Qq6)T .q\pB4XêڎOD!AY!-7I@c*ءUrL/_Rg=uG T[C&]/]4kڞeWClٓE3BR @б27J_;ԣYjŤg'嫹qKu<# zqU-3B'#"Nh*C {# #[n /EvW;ݫee1فשԽmU܀Z'=b݅6*3ك!#\tvnt>BGg޵uU-3: ~> f.j`1V^KʇYH42~GT1v߂+e%רZК{L&(+D8'nPt|<' _f-u=;]9 ]H%u"ykNkFmo$y zQG & ccӕae/"*kiH`vS.ԯ1BBԍ!1ei0' ^#фlX53DN]H5̧;]C}w]G[70Ӳa51\ɻbb`u6P/cb&K|R; 5͛.p\vlνSfGRpNvS{<9d+%;ƠZW>@yfRHLAs"J^{( SԹuEi+tu.Ey_CosW]&B,&B;M!ڧ^4q,Z3M-`9"VqLh1Tp{&(R*H+W[^yHS xg!"O*G z"nvuxBnҫ#d4Ihcij3Gԯcn/u[2<5_HV,7_rU_.= `CAӻbfQLʏS֯OA0Ib m H׫lIF #FC 'P %u.1J]٬Ŏh+|2jcFN^8@Gv>$w[fL1>N6fSB\ u,Mto|ntY\R2 EQwE ^A#ζhR3mWM8 xXڝA&e嚕HP(Cwi/ @[` =#K}l5Ri;g)F(ٳ,`8;2W;*?ŧ<ͦ69PZTn2d2('%ի:Sݬ$hsX>*#w*Oja,WC? b>u/d՗Ttif Ex$X[w"=KoZ{8}/p$ޅN !/Q,]+-0"VVM[{LiMdeB X/x5q˱ c:Ԛfr6m}egYfnvwaa r5UH&[dȝ ČE=2 \jbIJXjCI׻) |kEJȲ`9h[-~grYZﺸ 2$+4{V}~:OJn2mr772*U|?3kmxT$$.e@U?o(EFV ڏQJ*LZRg 9fdJ[ JeRBz HOo;[m9\iϗ6: D"[bՄ%e豕fI&Kh#A.;j]. $cbؐ_K兒F0Fxό(=:= 6 F&`&BRh֪Pkq(W0׫~ &{C5U0vnqX![>:iʽ@k!;HdԚS7]_)ԁsE%1FB3Cb ~1bo2Ifʫ-vYlzhڎ]RϞ(m e) [uHV*=YuUD<=J[MM}oq^YMZ՘%͙3>Q>Y C-b9}Y[{ƹ\vH0eM/W#s |lU9yZ>"VaA4_CǒϦ9r32t]i:g, -o PqoWWgQB@W^;qc"TVd énmt^VB[=3oͰuތ€1X'h,[W26ÈMpE/1Pu#r\/R|}G׫-~iw{{)XGRǭojE2we"pEZUQ1𨈺P2s~/:eJ2$ƧpWy F0 At xҕ2y8h_tg2F8O|jkc٭_4@P%b~S֒--(SR،qMV(Ua)Z2߹HЋCi VŒViUF $d4c}Ld M*nM+cd5Kv5@7dF¦RAx$fu\Q k_;#H du au {iAf~hA*QMp?&$Fn} N$x?mƱP4?\y<bPA!#wu4NCd10U^ﰰuD~4pwF"y[Ёhy{cq,3 [=-q}J bFF >~k\D?lGݥ):5ddoPY{xTQ_zPU+&ZY3TxDa;#Kto늭7t5S%V&Hb;/s5\D۬Lt lG+Ο.X s֋yx ğ,9D@T6 Rs =u.pqx;[vv|?zƎbRν5Glpa@wYl"'Ff)RVs/̢+YE3q%/ ͪغXH (49i6>kF-vhw4g-mwXHiɃ, `lŸIcS, n<F^H!ڞgZe6VR+JAB$6>0꟧těR-ؽK_9k~-X1V% qj0V߈l{YGk4]4=f&&>[4;eܹܶ*tpFQ#h-Q >/)N=ǝD,lZc1Qoe\1-Ca7Mr3c+ŇغA*^[vPt5"(tɚMW/=QBB{'pd>2/tfM;{ka*;,fLj2c{hU2R>]tMe\Z$+a&4;dy̿e eWX%q䉜g,5Ey xFa'La)7ۗ%3}  =9*_rM6E!#GemH597:hW Qanr00J„F'MOHhʬ`nàu=kD|->r$ \NvqZx)gsk mN7߅\msy5'S.^~ -~ZCයH2Ej~RiҴ&l ð76eL~)|;pO>nVS#l$svRk!O"We2^t`"nw}"zÇi> stream xڭWgTݖREAIzM"U $! I E&H 5^ "Uz/&ͽw7]γ}Z04R HVH("ЇڻcA=!U$;%)PDP9PbbQYYY n卆9:a|FfwGsDxP8 E`P(8POKE@ 8``(8 _D@`[X*AA01 @AѮ0  ah !pwox!p`H FPX_ @:3!H0(C`Xw-{(à o|m< CC8]BCP = ݃P(?Ybp &CP^ *G3 ;Ï' po@!Ko*s"$'5{\ 0rA0{/D AሗB(фyA!0, go@pB8.C" goaGƏ2ī5Fw1TU^_!Qiq4d%dM?@h ߴ/`4`$cA~xEv|,9SLM !ΩiJauQPTaI^n`9= 5lYE(7"wiup_`&=՟3nYZp1Xئ:mָ,ȣŹF6gl#h#@.@;('ձ -p+_$ m!\`̊-b|ʑC׀=^&wO*Pv!^TaQfs|(> d\m}7BZuƪL#yE-GIJ8G37$VBjyfi4rL;+sX8%UGSr-J&_W[Ǯ%+Q ѪAzuWA _qU]u^7 $bޕuHJiW'H}R1>:63H%*UЋܐ!tb^RdBYqVܐ{_#S| }ucR XmcWL슺徶Df+,7w9<ފ?+ZͷAF|vQ 0r_6u)\GV( @4Y 艹} 1˯xRY,+&ƍS<"IL'wx)I2 &:)VUaMfլbF1Bǩ_Iq'ع,vzͭIAZ(J\Ua_&1\:6AcIfRu/|fc-bB0"# gn'b=;i`}F2V`_#!:tULjГm_$߫F&1,no  mp*׋i3j<Ch$?xZU|Qoɲ&d s׍5"˒p..46οDAk$V$)ģa0ݱǞ`a $S-X)﹉'$/SJ 1^ZIx)t > V ICHyу20A?o瘨Wa$u)=x!kZ'- c$rW "5Fdh̍Z}IwATwd A7S飠o~YeUVD.0fj>ٲSĢ|KQ_l\#+xw7k/PP:\^0]X^[lVoz~tfrl4j #K49AïQQq F +Զ#zsS:!7 OZ{,zT>cx""2d~u+~TBٜNrћ_r!'Хz~Dd6"I\TN"ҦHL 0!:5zN|˳Dlld[7QDeJOj67R2_&VxNDMISI(8eFUǥpf94O⡵RbfJ,Ӂ`R *}QzBhfKGYg|-;Y9tq^K?+l{4ENӬ1ҺISpں%L8C >7 ^kF]ę#%5H@f͖4N]1J䵈PNڝ;[YjTȖoL$,K_e!yݔ=4/4|.n[գ; xnGnV ghJ; 8ב,>A6d/2> QS;G:UQă.x i>kU٬[ru)0L\LDn 5cx^H+Z \&H(gR@NɭdU#+k±1 -E~S$kuXT,fvm@-R?\BqWd EA=^9 )'I|-4j,Ǯ ^?'$ڟs<iSt5. 1sLDqI/>%-2-q-;su־FЀ`,E@j8]%/<)]AOY}ߟ)!Y]{Y(jwV} XČZ豮9x:-RZȺw\Zq:X>ng]Wr*}:ƔoMcKm F$#ĝW0ŧ'Z~[?VHo4Y=!+f+jsI'J)ݿs^L6p_jyr]>Л o$s Xk٩'-V #A\Amo **^aWT_WQ%~ >_i>r"[Gf n ^]|6fW(fMpc#]N*^sq<=g!C}75  CIHhZ.C.Bv7y@[H$/#.R5>Qd޽Wqmo Ev<u&3tҼH5_4rqhNM~lY]O0Y؊Em 'vkPS};rk,4O|GY8n0ܛq& lgKU(҂ vnpt6$}rRPq &MK_n,q:=l'n7r;Zr(Rg偦)quj ^ةsCN3S/!δp=!f;%2Oiϼz"7Vo|;^ؐ߅R%BjmL*lq}{HBΓSh 1s,'RNm[Ճ]R݃9F> $QQ|R.Wwm;{r)3TYT b6Cf{IVLbxcFni4DTF[ۥ@tl==vzk.9i,(D&>Bmw!:OgfIjU1|te笨!'yQ[R\=@>Hr2P63t=BzV]]8OIb[lo"dN8lP~q6pX\߻~~A &q|uM K5wR}bN_quQ <;'2fNWмu 6 HT~vSg4%T1%0sjZY8$L;doΘñ(pwxc.{n`U%Ԉg-EBF C{^ ؂xޘz`-Y[{gRV N:_}5-+A(_Ijiw -E&,ŴlMˏׄF= %7'!;cʹ|jݍy\#aaouIcTz)+ G |Zd%g i*;J)LHX :ǤnZ|bZ^< Sx01;yc?fOcKM>S~t.$dO khjl*Serg11vr^[EdI7`r Ke dI`TP9izM?uy{೰PQ`IU+C5vymA*"1-h*J? 1ƄDz9d?^uM#rBx1`nۇ"L&IY~.{̧="-ؘh(Є ME;~C$)Vc{{F,j79A>{Lބ Rp&.,bů`H @Е4CeѾՍ Sg]҄%Qq?\0nyRA"0DQz8vb mnIK9 r*u{:Wu@rk' t;A[UE"H-..<2^v<둦E攬d-_|+>YaW<^+ŒYvAtq}@βHQ?*+PىBKRAZ='iIeN+wהn[ w8kMT5]ة E ki^sn޹_uB)mNMazl|G<7%|*S H.=I~-9u]K PkM*&>yͳdk4gR L 4 u Dk7¢3 +ZC8͏= J豅3wC^`"oyj ~\Q=f{|agDNg<';b\D/םھ~ǡ ,sYqxS,Imaԋ*}h]LZ|.:_42̔c}f(DXt1!g^f]t锢jjƮ{,mӸomOL_>ȬV;%vk32nK9djMfY=yD>逯eZ9 endstream endobj 138 0 obj << /Length1 1626 /Length2 16434 /Length3 0 /Length 17280 /Filter /FlateDecode >> stream xڬc]%\m۶mۺ˶.۶.uvmKΙ3q̜Wĵ+sΈMNJ/l`pwgf`!R3qsQqSpYÐ:]Ō]:؛YS X.DD.SnOS?*:"G"+" gc{׿=pu 7u3_ÿ9:;LѕoV%1t4v'_5_K3SJoZWc+{"W?LDfV.^s l/n.V`alf pqouo;:z_V ֜oNS׿-ai{s"fCpW m0 SQ߱G-FpU0;1D==C$GϢqYz9WkMъ8ؚWߖ[B+ +O%~Knop_-%gfb/:5K+S` `o__TDi_JU/Y:FDȇ _,olIn&U?<0fI_Ԧn [5'fm7:#;ӵ3dJLwt$̱Y(Ρ7 .wG}C W X-eoϏy(Ѡ>B3fInLIhoJYŠ:Խ(4)"rh|td6/?8 ;#̚(CYkgyM@6 mr}|F~s[BX2>PsBq%VWg9N&vp֚T}g@`l ,쩳%A& &YGр3`p+0,߷Ac&ZU|Pw-]nXӔyVRW[ sR^C ! ֋fb8 ҆Fz NOC6 ]r]λ{֖Owt[}sw9%a'wJ-i {k&[ﶮYUq^&:)Lk}qC׍ LyE+ISۨodYWCd߫$Q9ѕ"f1 P]JCPh7^^֙lܹ9N-hZVw}ϸwEkI; ݥ 6%>qw7w/s;=e׸aί2~~mnȱ EQ~S{izq܅3K=r4ihX;1ײy3dDlo5>hy1kټkYȺO<.&xy9]! *>7o 5JWIxWwUj{0;}Nߟ)ksT,olE^E@VtwN=>n7*j349ǰޮy!%,8VG 6էSr =Uu1}0 eⲠhQWɃvCl!_̓ȏ(욜؝QY% 9N#&ݧդzzk<\ s*6`u RqCdzQv- aAzd|KBm,uTy2u}U ޕ1WzQE5X8Bvl[M{8?Y^ Zsk;?V3PZ)B x/Es#+5BbW#hB 8nqՕVݟu XPq4{[@oN(\r86tVy5ML-L.,X `ùSByWf׺CZLa8~6$8ڴm1~`rS`w{!“ bNڍ.av"M?LWhJSX!Uiqnc88 KSg|" đ,ӵg5d󍬾tm;Yr-bDwQHzLz@\a()h-EBYPp>>kds!F &^LUiy'LbV*R޶'ֲݙ(RY%[}خEd߄?ehk,InF^<LRe1#_67_vov3Ojwc#8AC_D1 Nt%eal]q`ɓVG D45O'g"GNq' )|{ޛʖ[,A@- 땓kN?K7o1oU[|EaXϜ29>Yg$|"*uÊ,$XjܞSο$[9;yagH@wl0~x+6ަwduEdMq ݆;W[_y-K6q4ψ&GUSGMunH 3OԐvD'J&vzeNڑ CM4 4r\ d!ĚQiECb+LASg-0?A ]^Б/]!"MwŞAk80bDL= 'Kž^d30z~[6CV`I'z.3m~DEUٱoyHE lYĿ}娶W 55,lw!@ 'MDOO&׍$Z>imlQhzBIYLU9C@'Ka'H3K%fHٻ d8*X݌ TN<^wH}~H(>sm83pO ^.utC[[ !TErP}4,ז)S* 5T0вkMhPztΤ1cn[ħ!; 3|tȶTZ^$[DA+L4 h$la;'ViPg+HrZDD\CpGf{p,& M߻PlS9,JXyXpɁ /xZ܈gf{E8`y}~AM ͸F&G}A,z{"G6}`[gUt(Э9y*~TG?R݉ kBߝYN +˫ B#U0k ~Mn0jSq䮐Y=PKCs2̗ 5Tgpk{_Xh2O>)Cn@ 5(FOΐQT+{? }h$D'O6ہ<`A/K 9,X.d*c{L>𕠦rI*>u$8Wo8DB:u9k;` ;^-u|ޫ_JK@?0uKiAG W|JLK'g,u7QW6l4/Y)rǹםSBބb-P.]>e?^EL 'm ÞǙQ'WkK90J#l}~!El7Z?v\~b_N47e4s w`qџ\!=J*M)Wţ:=woK54[tN!t0~P%ϳ9耼@ִI@\1餑yhq(_F̟ׯulw5 !W#bN6__ Zz$Ȏk)P2xbR iYv˃[J׎mV^ pGK>rb4[?ٸ6sTqĤȉ^~inpj2^ ГI  (ZTXTݭVۦ@/vиq<<;\k0jA&z![dTv @Wi(-. bgʹ@ MK\)uў2]R>B^ &[B.I% v\^/V"$RK|U _s?4Q|):֭ 86 _q̃WqKS;<)e>Q4U꦳Džp\w.K$+0W7))BS uu⇆37F18"@UnJr(QSD:6JB4{@ >)FB~\EETVQ%߷su1zrRԡzxfl lg OZfYwڱ3Vv.j茏!U.FY5'Q%dОKO*"u<0RQyk=PQE;P_eX=9%t!&Yb\Ju;n+bȿJ?R Ek޲܍%_ É>8]:j!)$4aiqt^8f/]DqrOV' }8"~j@K oYINuk,hP~Ʀ*9oy䬞h.L0A8 v+_. և(O<=ߙ >;dQnV3I'L$L??X{c38YYI8ǙOV !5ox{gɗdYV4aSYzT BxQ^rTsǿwtL/}F( {UiJ9N΄[ri-6l "#p5(d^IٲE$1G%;t''o's-᧝P΍HM sOhSoGsOXDd t[c (@ll׻Eh"Xyze*e&Ϛ<Ɔ`No 2ti^Y;SS==U'ԫԀ(q#av+ilm2 5>C]my31~dV4"=&r/aK_ ltΜsy?Y?!!NE2נmɴ588¥β0!6~?z!k$7\:2LSnX>XDa̰4H(->/ZKP  L'lb RZ]9H>^0G)T].ˬs?{b&M!6ko.àxj(Z:A\1G)ajGv^a dזHvrbE)Y{0=>,禗հ8ugMe5Z"v+hk1.iNw~A+YD-]u*ԑ:>YO%f7sٜQ bq7(Z/ A?rM˥TM``:ygjeĬ)齛յQp%cfSNwNehmq+rC_/ryGKҖQ8ؘ4'{VsXs|mOi1~sG{V=[ ^qix%?_"n申C>tK$ˍZqA֏~v-n-⯤XFd=9؅lj_QZL$>2 =h m8(q+ IϖOpG*Tt.];R0 |8!izR JC`&;Y k_BD5vx[TU}噩Si %REQΟ;G_@nWD0I Xl:VOSSRd(bۂ_;,7S}6V9{xa6=|(͔eR*sfDeɬS_v~Gy// 0;)X(s&9`je%g,={ԟrwI0W䦷ƚW.ROt*, INׄ0L͵6Yuމ2`m5?$u}:4a 2m9-5f9K&h'j?bBzKQu"-JU^.߼%j':\}+5zd?]Y_#~Lou{ܺ L݌ϴk8 *1zcL3,{2ЮRcQCfcS/92z9>NbcNO.COB8i<."aS[8cdc0=H4C VНa{"T=w%Y)*zt)W bUJ滏F vVڷ\Nc) XAu0omsP$KRTF'-v6kʭ%sF "i^DgZGN=0~b̝h@Wg:~0MfkDnPϚIJ=.򅭹.O;!O :6x٬;6^}MH&77cr@pzφpD6Ifm)vL:e (e R[ƀԣ" `H&ͯY! Ϙ!ZV{΄q&j'P[fD43ӳ\GevKyk]k5MetvӖ 0{(g{{h1Ø'GiNh<~oq@wOOR$*~U"}S zЉ:ӺWӪplpq #4O'Ξs_c6̻Xf: 7趍?QC~8$jiTQ=|us/a7k%O"D%)!j~]V؎9#Cx]~a` s*H()(\pX+7iἀgY)?tُWң_P%ܘ>%(8J 5&#󛈆=MӃ").j8#&Hsj)S&X0 (t%)˅xonܵD`~}}ď pxk}q $nwpxˠOq=*B LZMh!jձL"AMfc4([I WFА+ɻ SN6IcoFu0wS+i҄F-K: nͿe5]"aF7w_32&˜jz| YLi/IG6ǔaJZ=R*j:Ium[SwEEVmD,x܉K\8WYtkoCYTY C $U/+n~eH1I%F= `[騵n'b=\7 L <*潡^Տ8Ĭ~[kbE,tFPp>+%P(Q}s}A_(\؈4P+Ψz`fnʄ[WG ,QhŴ0asMKpL0n]>LjK.:TÁLrP~B(0AKNRUH&&rӒ}-4ޑAIOKia7ƴ>-mGP?.a.(?la8R)s) ?EQy С!ĸ8_ 4d>{ڵ]`!+M F3~Rs)H~4Kp_IrFESHӶ]6Df}H/hC#c tD7:in{׍1@;F9 lo|k0dutuU[Űh:=X:HTOG 6׎NڗlUW7A\B}DJ2fن^w5\->ш6>GH74#r!,.ic* ŠZe5i p7"'&BC vOM<RoO/39-T4xXI[/hvGq@Yz6,5gJ Mh2p-yk;XVRujT=bZ4Kg+eWB#;Kr,>r$Vʬl{ 7]V&LU2lClZ}hmCWqrZv >όlPɻv]!Iо#0KUnRR+uޯPU O;zcM=H tXnj#7|m#,ғ%O>Xp0nb7][/O'l-?8*yx **]3<K}n'lWx~bnCb5 "`/藺!^0g Xsj(\CŰx]2WQ3HXU|6Pׄ_n$Um),9 H#"IyYp;7 d}5My]"R`}a^!)uȡsaD9,d+3!P?!x =Oo%U_t^RfSS\Fy1x2tEzI}Ґoґ ݖ-ryK!ؐsl;/授fɴou4RZI҅EFH-S;)p0ލY-I">do[ mAQݟ1e;@E eaC^dP>q_W(zQ|,$@T6kOŖJ4QS !Vx7Ӧ,JE:RobDHl{x7TktPc72j{s7oOo,ۓ a6:S߻4ⰂmRғaMǗa7.cH3Dݳ4 YfNs@Bu9. eua%,X sjShSjE"sT$\n"JM2'+vK{֔勴ճ/@M!$X(JD7\[Kn=(! |tKg(u#jpP#;5Ie^zN,o$n0E A>?*$ դ7L8P~D*.qI!ΞwhHj.0Q|H)BV*LQ Deuu}ΠF?)F /U¢<+u^N3bi#rips՘N0V)PpZ;r5 ~.1꟫t.>W4$obK-5*ɔDx0HPvg;GtAG (2RI6LgҐeߊ Ay+TjAx}p@D24r .*HYPOy1< PbR? @Nf̹9Ǣ'kE=:U%uiz6'NdWDQW Urw\py"h!t=~N 3vJgbb9y%.x(+k*Zjuӄܾ^ lb潔#ĈֱG`w%8,̖uK?êKj"sVS!C |$CcnjKRCOQ"<5cǂ~sb4̨fQn%* a:Kbom{ bi,Ns*\oCJ="J5]:S雀}r{m4>fbv$BŤdo]pmkϓ &7czl7;ƍF`۟kp%KD%8"OE8irA5E4 RyPJEF1^ʶ3eg>$E =0)aHw2ZڲagugGˁw|lA0ˏewAs"vQ@(R+q@Ik7'Cc,jGWWYJlۡj"+]n[xg:$O8n|JINUO~$#m r5RU]L"ϫ5姛L.6)-܈˞,6 +O>B;:/t {4wkL:sjI)ڧqVkԌr3 gP;GYe0@Ї}"1fQv"s~մɐ H/4V1SvPsiX֎zj/淭8O 1O_JM¥RHfyQ{ 9F䡶nbV߁R7A+hdL̫Fn5''E*>hoyrX+#V+ɡP>̗l zNJٔ,5}mWlLI4([ ኜ73 ' X3@1Vm~£+$_u vou,fO"qEQ Pc &\O܇ :kx '?3-yݩp=0 _@ҽ|A(x Pm;C0,L Y<*L bjO7i۝>:1XB=Țn Yakˋ"GYRIہvNqT33eceC7:|`b"3ur=(Rdaj l;/^Ԫ\(!7o7kv嚀"l&s1QZa/^x%zOBTV!bO/g%X~TZ-M讪:\4=6gF-Nm{ \\cn%IIw$[=`윙Gc[j_,VFo >8 >//_]Ypt-o7;?|{eWMY%/~pd?w+20~y?8PBI4"UjMP4#ݬa hme댿o:yͶ]d=Ԅ ZB8|%-`Ad IX\MyrҚYb{xSb8s(Q$¤-tv8@Ty4{}g%sMIBoVDG (*njH<2sMz/' jP_6^>>zdfk 7]##Ix|Ƶ)# c0(I:(}vDObzg/2sp@lL ?dӗUb5Jgrp"-=Pٝ}isÌƕ"G(b97\DϗKJvef2+ˀ5.0ZE _ቶ2ӨDc9KhxOLր5]OgǝapF]hfNb:HYHLdrbŚHsGgU>tM:Ǻ & C[amOe%p ZuM}vU턵~u8JS[9 endstream endobj 140 0 obj << /Length1 1642 /Length2 4961 /Length3 0 /Length 5795 /Filter /FlateDecode >> stream xڭWgTA iA{QEIH ! %4RDziA M:*Uzoл>k{${yf}曵>V}>y0wF JN(=6\JO m`@&PDBlP " 4JPX($%%*$ 63hE@N܃G8A88P @;( T|c V6B!H\:0( AQ@;8}`Ek(~< hD! (.  . ^ tPg G8qw + pa828 !4UGIwhEnv8O0z/ GC6Pg @_䲅PfƑ!_eU DBm`/n>ҽ (q9Ah\n{3@b^Ԝ@!v+ uA3sW  ;6K TD$GGFߩU\a0m'3@ܢqv Pxl\ ?6NPh8 w7=N>!1~f(J@  wq`uu AaPb!3 4U<Ͽٴup6 dyRP{qāR>O_%6!`D~2xYb`~ lQһ6Wk"d#ч66  |UÚ3fFKs}zVyW߈ csfGn4QQU\Y~ٺuEq׆7a5FV/I W GBvY o\MieUl3gJ ǏU,,{A>G¼rC?fI/GI?If]ݼ<)εʀ>Ǯo]1a OdžiK{ d7=?$ݞddWr~Ғiz~H"NXGL0BAi*n1 oT7Zog0UgК-:1hUY?h˵XW߂v5 nwɧLmu'9͖50fIYIԩL@9H} \{]QPE+q)JYN-&/ś:uz,,z\SR@.}?0KF|CnoYEPY&W3\S7]헮O5m=Yw#.Rhreec@{7N ]ۿňh-P*h,q\BҮdxxo-+uj6N;bBx|GQ dPx1Tlx̡V:k gE_C Ãau.G%"w3+'RwJ(/BXl=C\ݎQ/TyfKSW4}z0SwQV,5z vh6G%H,(f{?+|-w~zWqZ):P\@c6J3X2@A0j۹ǣH䑇yˌޕI7Dq3EfY)bNfy\mDj8r D=]>='9[rrJ`&Z)W2oNkE'"6{@-sEw֖6L_g oqG6y~#z<ўfd =D , _x(QqR+Aװ~v3v(B3U)֮K?Cr;\%b) Wz ?Ui0*,?;LؕwGt,@<|֡_f W:jJ@Mi.|[ڴz@Y hUT}Y4s]Sj:mu͓\ۢ۞&F޺$ AÝRl3w`nC:<ȗT͋*+y7M, icLY sHlz0I(`*Sx-W|Jpj&-iBcVY4 3&*#ʖưq2~i |rO|XF; rRu '"~9aU)݌Ԩ;q[nFfYJK>]y5z?tKg|zZJ^=V0;4U~UwZ7O}[5E_%)pîD1ej{quG4Yw%#BEhɫ/(ŠAAh>jNd菀BwwC뇝CH]a6eyyrloLzӳ2%q&T)ߠbEXn!,XBJT[ D)-=Ƹ =z0g ^!2{vx/'}f1_M̿=:{F;j??+F/[]3қ(RNxz) -&̖c0"rHc}Fܷ/gKI\o;w3nlC 2#7S : >}Z߇7\CF(L3E p𻏉0!tN[܋ _,4-tkw{z5A%D!NQW^NHBo^z U~etQ"Oǝ Rb~MbӶv@dUT8XnnP}3N Q5U(6?YiS}KlO֡Bs$Nlx%eyn[Aey_x3(/ks/EJPlRz"z 2l mO߿񓐢]{zt0 5` ۻ~ i8_)gLLBS*EB^\н2ӧNP5IS ~" 6%>X"gؑDX2k-48Fx.ZWNsVlc#|C0("xv(Ԙ2\=G1c=Iqstۧc矀*` Ɲvc⛯),yn32f!p(I0C~%VCNS& C Ǥl rWcւNlJ~}!&"OVî*{SgkCֺYK)^#wh˥U93rrDk7{cPL(u{jcun,@_.YeZ zmm*_`eE_ hc.*=eR LR_VWR͂~<<{/!w ~~:;2;Ѥ:&kԲa蜇ꞲU"nj(OV)oqnpAܗ9>JK&KªZ1 FL˴뤣+e,M/{8fcB!,1q;JT~Iq;:e)gj3JuP7M694ZeS*],yHJold=XGLm~Dh;QRQ ]b꒣tF?X>})aS]e Y0)=M_E)Xv?a^sR6)'x rl$9x͝`m^ݻۇp>%-+ㄗ(1)*7DqT5A nōwSjNzsRN"WHxo=7xy fJarV92=Q5zϚU5#]U#^p3%i/Z?ͨRMDȱ;Otr^We|GCP/h uS O {{#Df6y3n$Sw'qUU9#*Fz$B(l%)&y؜::qQmxI9A7jǵ1!g] yCEbiMcjܲyG# 5&Cqhyv> stream xڬUT]&w(NpkpwwNw}oxהg3׬(HDLL%XyF.N< .r 1GS8ٔej75Xxxx(b GKs g I1y毧=/)`fic SR֑QPK)jLL6e#Kc) `Ҝb8'_7SwcS?*z7 `sg{? +!_ ۿ`NNƎ gߨOl'˿j_K{cJ/_3 lO,#S7_0pq3 @GS'0 @6`djcƈ7vL̊=r\M fo@{;ߐ3ߑ'?totQ%3y?Zx߀8E/5̌Z:IZ([:[̀6{/_nV 3ө[X[CǿUv&t+&m%%5IEłApVT`o`DE^ ,VnoB<>bo,Hۛ3:j@;.I[5+|Vi589CzX B@ ·x ߪCx?Z=N@{#=6T)y>d4h\tLO.7t95'TT`.i\1@(ƩuqX_k NN)F{)8'Iw/\N ZUhn.$[,l"‹Fqrna $cb2˜gui< QRid>43tCHk2sIWьbD-K.ow!TO:Ufda9psgֱ =~}Q-eLJHh-ZJkDvإ`{ Cްm ፖɡMoٕ&<'d8} W Q?#uV"/˞{2oT=@-Ho M4%;s'(pɎC*2i2;X.; ~odls,[ _k׍fV)a g'6+ T {f,Tbv/4z%.է֧]a2R- GR1';Ue Js\խ=X>De_ f4g9Tw^F egO7#v]? e?2}Al5r's=Y&o]ᤥZS@X_N܌U`bE~IoQݗz:,,Od`˿Zo{~{q:h$!qbbY[? 1aEH?6SAaL֚ p"P8(,S@ Kl  h6FJݙQYNtں|6J|_QOb M9ʏw#H,0f6/S).Oe\:H<_9(( R74yx&ƨH/7"r}P9iHl9c?""6ݓܣ1q+<ĕCD>BCpc@- 6"ّ`o4oE V>+T!-0 o7w[E0ul[z{07;OG}d}?uJb{U>bQÔv~[A,N"f\:utF{Z0mG(LmalUAJaa\TP(QĊL\, xtX/o tQLT 5 Ar^ Ē+ ON{~mT+i;,GW`w>?٭!NUә~+c=e`%\ \b(ܩvq!Q+dWg{=30= 6 }FlJ *rO^Hlxޱ=:xGoo!JȢf~QnU'Ihǻg#SU92Q} [$ pjMBgwZVND_.3Wy!5(E+.;fȬ Y>ypժ,eCO@8vDr9tbǝ73 1 ԧʭUaXPA=cGp2F)' P[[v|?Id…ræEcWNZ$ {āż?IErsy~[W_eP$PQ近Z2O{vʢ:f_U^DI6(B. 8й+&&w%a"4 Pkw Tmn+MCz:%ZG0^1?;IbA{Ц5a#\'@"‚|mD $x('p 4 $%m2rFrT3g=_rZ9/l9=Іw ྦzo _Xh?Bt0̄9%.B:cY7x]O + %JG.R+T&\KB*eSo\\Sw?HνU]E,Xޟ+sz9 Bt_DQDŽm"2/ՀRm +m$R( ^;Xry ZhPۈ҂MXjpKB߻0 )fdƹem/ Ԙ8ldǰ"j՟ˋW֖J<.T/5b;Æ_-B2 ,WFP\/Ÿ|,,iǽS{;n`Mzl=c[-mT%~!4L4|Z[ɧEGct/L7js;0@s7fx%"-& 6{^!둢 ҃J @3I}pNRW}3+sZI-%,8v5HhȰE=^OMܜ l>ѰM4nCh)Ogn"@XTwGه(;4҅ShfҧPrd[5瑤Y?&Z*~M?% {Q3<>< 7D7 %Ia<OލwiuCn̲97~i3P7v!E"ԁT!NI&-oTFd}ڑ-rB =oўeCYƘoxϓ<]-JNج Fr'\weʱde&BRIyxôᣐ.P [ۅp_=z$/a'j2={>h n[PY8A.^xB.M{$neC}?\ކ6jR֒+3 gf!/ŋeZ\Z!U Y-4u nt0Xm҅I1r+@TQVm=/NS-;jNP"K}Tڥv8S!Fv[UC"<` eE~~K8c9.'Z+GIZKZ:%Xe֘d2=R"5^ l~-EoG!FڦlB1d'7d֛"{f2-awfz` YJ"A߮K`wF((čų鈷_wng&{Iρt#Q?} nSĄ2WNOG49UAM菻\ū8nX^Zb/EGO1 ^ y3c$oJ&YǑ|څ:\]=ح-ۣO9gC7wI4 aD4.guvYXBϾ|G5ܬ0_<̽)JE]|49$,$1W⡪ǩx|)a`+0{,]9#(Gx`&'pUN 4P.#76tN|IVpݔy2&,w&ǣ&_bk,]1iм~IAHW:}jƀDɿTBDh7N+4Mc@"d6bحxfvB/Pko?Y{Ϭ?Wt"zO`F amC(52>d~h_tpγ[sb75pX-  &pu blJGQOSk /;v&1(7IL\Q)D 8kr͜;/HOb]LHuzAE0Sz1]Yb؉1b{A0HqoaM%GQ6ܖ vn'=~aVBLM` +~uU|hCL4J>r(w0R m.aL؏NRx\O?; QA&!81?HC|:h>V2_~[AW5?)& OT:{1-#~STCb*1M-j <4Ɩ? {%qa&:mV7lш6Hm/wQvKWPl@`.kd h,rJ|禑\CcZ?0ܷ݇k{=҈A]ͅ\U1PRE(Yb1N@E[ ů̚3-w"B×1b$% N{!ɡ8.\d6*ս3SI|NHE~XձQf4ýёS j&!Iu0Wv/Yݒ=/^)&~~̽.jɊ$H֤m:Ԧ`v>y%Ef--%d U2#~Ew;ʹ:M5oh*4Q{&eFfyf:^2t/IuNjR!Oo+^blה 4tyF8w%W"qXTSIԣ]`mxCr3bN-)}ŻBFGUzDHzyYnvOjG97Ry<?f"əsB8kruV|X2#saO]3 7 r8xe"g\{8B=2svOXIlɂSx& O :?^l`4/wb ]|ѫX".KFzY5= ͽljKjBbG #e|U2F[OUyp;\ښMKCy1T _Ђl]Ey Y>5!*-A[b81,Jq ~} |W=Aτsx]0n8E)y,Y;1wt{vP*XqFO'*SpJguK-ϔh:Vƙzv Su;$',A]63f*;7\TÖEd /܄{9/y`F0b  *VF66ieHdy{`@&j hx@J#7bq=^OswOk|lNQ?3+b9DY5<|_tfOź HrΛ( [ !ZPU?yTn\=yduzBjW%7N/ z+ʇZ28W3:*,6hc|9|Snj!vfYfIMOԧQRw="B(nK}-V$$SLJWx)yQ@Yi`෣,yw|nۡnqcm6\\H gܸ)n^~X櫝&ue$ѮM|Wq6ŗ-#$LGlѶkL-|ٖkP!ȃ1emZ1ʡ."rNh ̀H<<ؼLT ҍ-BN-oHí A&FH^ˍMC‰ HWZ.#lV 1xEe$6mK>d-HC)uH#/?mgZVŨH y8GC2giNm 5!mC.^FBLYm*H[+M`ɊhwݘhF:]9^ѓO@ ` 2`HA>3k74fh[`δ,0|5Z)j6\,6vە +w OR_ڿXvNpqNē W|*&☗fa%@bZ[La38c?޶& n\lʨ!Lbe4M‡H,IZ6J"&O!<"si.9>?= C>IHb_hx_^ (aϷ &|m@'tjAE{#,ǘlEGdU(\R(&Уp)\`&&\(zķl yJ#=<:dMv\D@҄w oZ/Hѡ om„ְ`6V7քCDttb(Y%X;sppsRW{,]Nuqi0%8GǷJ46̮U=] uD?Ӧ&(jȦlsNS,$pX0>pGt?T:|˫ u "mlP.D1e-e:*Y.ac @-ɕ^{m`Z s~vpvIXDu*C"Gg{oʱk*Xс4(eItxإOYF!@ݑ}s{3$pglaUʹ֑iT+ѮŤ O]Idh+eUQ\jRaS9W$lQpR%h$:IoBIWZ$G+zxH3V{V['?B:՘9HnތPfKGv>]`905,cs>hw2.A7p!ѫ9) QꝚDneyA|:OE[IY. A\c\ඵZe'*F3[D~P\7I`Je݀1˝hK_e _Hj쪶^79X5Er>OKhX)DX.FPGg7>VH怐TpҚkqvPA5Ɵ-ťmDǓ2T!PC%ƃ¤Ni!5Ԓ-!.рPG7P5`KIR LjCN vѷv{{=p:OLp.Mܼ&}hNE6A$`jU?0i1ttSPkTĐ#k] #E9f,)f@ck7->r]ܜv@Q:?87n>|뎪m~:V&r$yQI,9~YkWl<mSc議^s*Ġ᥀|}fwĽYY'ww~}*¹H/skgG1#{qέbDtU,QsњX׭qL$_0#';IᮌT2rv C eal oV}X;<_p%\E* 1, .ƒ[4]*G;[1CJˡoj2ˮS})*HB XjחT򫱪G1+D-m>°eIj8Z!՜v]kQ3B 4 -#pi+z16EW7M> Z'z]Xehna K+( ;16QRݟIFCdx ;Tx`zWP.\:7\b;jrwRtsFDH/<0cL5<Ý,"?q ҀK}i4Inwitk`>۟&PaZ\OwGUtymLLOѓK'Q V^UfEW̿Hɢ>B. h `Fh> X]~YRˊᱏMˆ7~Dd<rб >I{G0>&1`P~e#J026}1 BxHA7-|rBΎ S\#WvAH:srnKCVR) $A&ʜʞ_q7݌SQT~P)c(>(= iT}Ebة -Jp*)3%9ҔH`f!ptί4i@ep -sV6W940'x/Qy8IK6ֆ**O {b0 ^A\|4b=1D^1E[Dwm{G 3J DYy[z/G@.iOS-&}-N$K>-TbXɰCkd  6{S?oA )c3UTam([8_jfu 5RA^[>4"/H aZ܏FpaϝQhE-̛uhFF˸H:'JsF2{ǵW, [oq^s\)쇊ZwF &m|^eTLp B+pN^7S&=kP-ޡJ;׳m0K,ŏm"w&(ЩEO~%k'iZ [k\?,k I}40(>r,SF[I&1)u]}1# >5xͦ\2(C̯=T'5>:ۅI,\Љ5gT%$6&ǙCRA/ttKr-.Y&l='^ea+%Qy򬓱p[XR@Wr k׹1@,^c"tEy -h1ji,Ǫ4{(0.q[qS{b`.4l|EI/TXR9uC|mg3R쥱qi&),(PnKkaaNavX5T8m m絥5ܥVvHBQR̃YhuH"mč($ /MYɕ*O{5`4.ߦ4S@pX%^=Ku$({+T{ޝܯuA䇸!} 'C2#*bq=$@OG.>I2ԠEzJ z+H+DyȴL?@ѕ\fodA"],VYX@*~vX1bА_,N5̔zh)'5ND<6#TZǍɹ_n|;3{E9\b85(`ܖٞpz=M_]K Q9,D=ҳ~]g@.ےGZd@ 6lv46 )H y,|A_ni9:/&)O]UalFCo: yGufPB7/<@YMt;8e-x /Sg{6 KWn.}ocbvY.]sT󽄼Yx&ג鉾 nkǚF̛+o0&49)G+d_2K]ҞP 2Xf.tSƌ*<&8t}f(tQ+"fEOܔXCqnٽuw%UD ߦmhP e"ef~%mQ`da@J|%1}<ȼZ*zk5TB;XT_%B@f]߭m4iuR3W1#WT7޸" RR,P@ŧ[ubVghTz2W۪Ӧ).*Ds'^V+(X?ً~.q-xo%a){ZW$wRt^iꪶC" oȃ[ݾ` KUt~)B[Uf"EB5½ʣ\E2?>QqN,E?dI#p8 Lf ,zSڜ,Yrg)&CzW7e-A-Ks}la\0X7gn+޲ݢ縄sqt/!)b_9|^Ʈ(jYaTe;3ؒ%}.y:~ӊl u[7  4;.]ޗ+/Ucxo 1I9C>{ {9>~۵|u]og ?@x"=į9]7_*SfA[r˻iXhz?Adm1DK?tl4f3eh%D `֦I[lr|ep n7wf&"q ZLeDQ++]Jw*rXan ӟg24+ݘ:f/V&"br: ^xg۔$t=?%|p'a`W`bcgiOxA WdJ}'+n}."hq&2Z+3i08Mr9Ngܩ,ie*akdU+0cg&-gΫ̑QKݳܹ&HfGYt0 OFTv*D[@uIݑ`)FZbqsiYVg#Ew?8BJC÷e'Qk--8SX]"a?`6_g}>8CS>_, /e%n/I-8yXYސSБζKsF 1ל[p)Y[ hK_`tLi>'9© 3C_"7Hxcf酘j)y 4x¡"S"8` .IDq7#=x@s-$4O`{o%0ط|UZ?`Ofߚ~n1i FEU~HO5F ?*Rp81҅)EۂLR"龻40O qwgp?4!LmgGJ2oWX٬e'wec2R&o_.xHʨ0p᫵lNт l47qNk¿tDMu;$Yi #sr%:0Hhi6^<61+#!1pj#>+_pޛ l-g4$8LA|* tF% %uYwW݇P#'5^xN [}[! =y}|xTyZt:ٻXB,n#aL:_G?4DZˬ[s˄Gg`^NZA]bAҋ+YŚб=Y:~a wr9STdf%BeA b4ݐZR-gt? $׌X+jhb'FUe8DZE.4dUn)m7!ŽK"6R0]+tĵR{(R]lG_y[qwIŹ9f037_o M3c&ueQsuhDv]]? e<Xt`e9Pˤ{Qw4؍oawS_0Щv6"?|c]ʵ_/4D!ܱ]u(NLYg@ GH:߆5+fy[WN1LTڶ SB$D~i7j_^w%?٢JIhͩ\t-bwwԇ&DAHY:|O.\("FLza`vcǽ}Am[VvYts*',-oZe]90:;2(%>Sj Wd2qSNW,lC%2xJf|xHIqX='y>7`o,E#1J1{FMMa;;KP/{[ 99{0+zR0J>`ZKUkk~\20!k21ϩ}SPZaB*f-ȯha\`R7^'%tY,tJyŲ{ĸ2B%_@3 SŀHxmV~ɕHvC#b#|jf endstream endobj 144 0 obj << /Length1 1647 /Length2 12173 /Length3 0 /Length 13021 /Filter /FlateDecode >> stream xڭxeXݒ-w'-l{ ]$3mެ. DR/*QQ{7#+/2_G^6GؿXV0qq0޿h$fH |o4:9+4x/2C\^7NR34. =P\^_e[nR0suWnoǖ;tGCNۛFMlXD+|^~FEsok\Eհx ֟-,. U`%l.!}v,% o1iM'7nW$woo`4{ZG6I}TeK1Ar@QK:Ы >ۏ,Dn?SPH2Ӱ22lEBv'tG2>7N,A?~(]EaX}6+>j9qJ>KQrԕK%*Vf欏LKf֦|qN_\!\Pgt*7{G0Z1UE[h xooBE/Lb-BSKAeD@:T8˯*(#mHҭPds֐#X~8zx:ďB|5xf2'ZzX[Y(HU%dg?:UeSH2q E tf!%;oz!#ԋ#'zz}n$=/ 1<Qx i^ʔ&Χ0~hG&P{=&' )>D\ڢRG}߳lԈM@ߝ? uWLPMbuim%/kPXuUayVV0rCJ33tߖ"rԗp)n'7i6;BcCxOv ECVh8~NjT(ŬXr./#Mn Q }czX6ѽ"IfM+r6n0[tu̳I+e7ƹ:›\spuEk寠>^lcr>0 6qne4-L xUq8xDLPxUlקko4T" 3Rz/7 ' ;GU>| x^K]S;7$q|-o;I`zx_zau\s!3RYV+"!(7Kq\u,􃅅c(AĵyFsx:D;a)rfm JZ{?m8W,=oT'ұ:ɳ/2<LeHLجa ˫wof ?.<חއ7#~ ^tɤ&="캠!̤;R̅ 7/qdy5͍K`€Zv ĕ< wf,f(bC-iz42`ewlP&SAjo l-dʄjz=X_Ѥ]/2 ^`kg$]6 C\hV4˶F/O *H SԳ}&[QD Nv0ybˇM$lxU/aCڲuup%N?쁟/eU*~]tJ 8<) ~ѵK8#*n`BףN@~@hX^*`Ψ 79qZ_eT[2]Ie3KO%W]MgP{ ˱B`,^72=n?\$Ox*uyc|3T/|3ٚQ u|B6vTe! ]pY@Y.*nN @36>DݹPo$V(Ztޔ_%_(bgL:¥vX(N0 aUPsI*O_y$H~/GsIt`D9ڏ@%.LnIVLdU) ˃hl'Ez9Aww'gqa$JbG(@W s04d E"UY4g 4_ԯ|*VGd%ĺ:a?:ںI ˔bWmΘd-m!AL%{#eF!<{HHw1so"b!5_d ˒7|w5720kL,wO݁O&ԓ9 .J,Μ={rl?Sh!f聪 8B殡 9KʩhzT&Kcs#U/AXo8!FGBR:Un.Pֱ*0<%|-?4)@尦Y t:H1_qkٮ"ukJu)WAdD-(jKݐH&#r$-},qM;.{jt*C60`}R9[~\]U:40$#ZR[E]Nz~x#("=K:)5N؉#[i|/wǫo?9j[8*W28]:Mh% }E)-;- 攷p<;)(VYTLu]6,waf;KW5 D* ¥=/T'ynQ:D 7\2w^ Flzl2I-䍃ydu6)o8m\ʎIO_ݣM19Rolw4X2|XUn/ӖNg7[Sa~+*H}(<##mq,dSXcz6&)D)6 qD)sP[$Vt[ﱴ !ǫ WF6n2]j"^ևPvE y+RT>2Z\YЬM)MrT>O *U\߾-2e+(~ "ylh[IwU_>#26pf/L!'1yhX7PIz)/47i S=$Ŏ?cwqlK6C+)tL$}:z*yhLoɽ)%Oҳ%:4=jNJ8I-]/D\'"H r;bS"Y;ӢG BӈN[ݢ7^KI2ѪsjCxYo[4/a[^CY䯊ZI/n[N|**+Yݱ2\0ǡC 'xzh &ƴN6=?!퐊N}*?_p YV/w3KiNℭ11 P 8A+'wiwucy\7;\K5A{ĝĸ Ibچc&w&մ堔Ó8zOH*ET`תN@Z^jt/Jf-Y~퀮>#ClF0VHev͛H*q)d8s75y>!$7?vNÚ:X!+Q7M?izkV{Yˠ" { gB.){1i WPA0n# /އ'B(_J} Z&_=ڦU`K?eJhw!o+.}[Pe| o?A uZ5tA G1_҈` O k[3ckyS#ȵI gU,S,|+SqD*TcGg|̓qnAPNAsGk |awߛ,:܇FOȁNdJ! h3{h`Xgy68%@yM)K0 |&a(%OjMkBG85SR9#L ;<ټ⩬ ҢB>ęOvg?K_G[e[?ХS*`c-:8bAj%7Ps.[%Ï,iJ4! +HSvZGkvjfgٌ3|?3-K}{7 Ǭ%e}L3F?X4mҶr!~lcPiZG<~.3\DZr<;7v┙Kϑwu6%D;u1*(b}Q :Y^j7S?MaæG钺WѐC]ڲ,-ݥ8pDIVzFwTeFk~EvIi\"^6ѓV^SϤrP6|Tݤ1 R"0I9U)=3/5d/쇝?$Q+Iܫ$ᝇHR _\lM^v$R-k/}UZuyLSs!/<(iNp|XyGE LxU1<0?au$sxZydS <}Qآk f:H*. ktuHK%,kW0ѽz+pBU\Z!{MjT `- U ƞʩD{VU4]ޯ#y/(Jd04aOG?H?LҲEb0c$ADdY_Pw&r| %pl;!c.gdк MӪAvS>8=IM]5'td+0qK1`.#;8:X>H PlEzþe!DZt2O3Vdid0Eƃw-4l"47E֨?F񭢊mX͕lzn-^*Wݹ Ln%6LjƭFKޤ833sQ>IGdeI=I泉G|NgQê7bä0ƨJθ0[CB d)Ct;Z/xxї/@e6>n<߽@ѹ4$ۼ[7RrEp$.hmbZݯbA{1B=}u*xH0>?ֹ) ˳\F^^&4h.iFBޅ(}k a\D땐TXї*ۇD} Z8j*M\H2e#En1&5CV᮪}юnA>GDs&xeD5:TU;:xmqTg:Ch 'Wʲ0ϫʢˀQ h7eZήj~)U-Ѩ#9uDg-!LHe7A|D>وk`=Tg57=6Kwubɟ_k5`/8k|!8ϑɁf2^y3#6pm}( ʛӃs.f0Oz^i4Tv8 i\ ^{Cw0P >U:]Qf3}ԅyMT%uA u3=\|jL]qE,*C.ҏdfܥ3i㭄  9?s^A|M7q\_Afi:_zuʫM]HvJd 71@]!*S\?@ kZ˙{zV.tXԒ΍Zs} =5?hnQ>~qTk2tA+\c E?LܵKA}it'2Kf !q]e;:#E6CM;`8,AӺ>:oPuH7;YOs?2{zK|.ԈlRW>,>%EWa\/07P_I 43ļ͝k퓆6JR ?g*4w0cXjۃ棽 ?VO,]]gLd g0= P=[<}})I0F=7J8i&OCEẑmm8 Vaք̥ilԈOlrF#{'AX#in"A_b5N)<ԮƫfEbIZ^,y`RyOP+*DX5-E_j;nɨD4ޗ\ ?ݜ܌Vz6 L&a_漦RAiwp+;67G*IN&m%'ܾ#LH99&M^ צ$RЍ]5n8&lp YH WK!oJ?t_ÍQ˗K)^Be})ߢN0ƫSWWad|AsƸU'ւPA Co=("/0c[Y^VF? rhtrϑua[Q&lpbPk ic "t]*S8&sW!Su?gV`/ 8b 4J5P8„[ u> g$B:A{=HZPf cc={2%eN]qb0zbG=R0˱NG#Op =*ETm$$Ӭ#1Qӯ;|NBF.iw.MLop8`e"<;tvfLc6cJ$o5|ilָ|AG_T*ƺ~ 3ٜض|8C ~by66x^$*{(XrDpP;˕LG|*rjΡM2\L:߹-jYd0> ~ 5~90֠C6d \`}V9'{IJ ~03s1o4 Z4dau4[ÎT#Ǣr%G!'|d+vg}3VJG؊&ڥaT6w !q#3?՘>)#oeԹ,3TATkgG s9PKV ,;,)Wf&4;BV۲^;n.C2mVZU%e-öUx`f" #@RTb8#O9 (C gCe`Ual=4Mעdk^GkΛ1fx?{s5zX~#lrHTUMLB)&[uu-jJߎ#z?2umJyA A+ ʨ*7Mp#ݍ[5[d;Ae~Px /mo֘@ayB6ڞ'Ϭ "E9D*S?L譾E'ebYP.IuA@%CnbK`n-y VW L)dHϭiqȱt ah;2=D4f,6|ɠ+n$O DSN CnoX 0ǬËƪ>m@~ ᇜȌ+z(6t}s#mp@XOPaG0 |YYA80r%HIw|Re[ۨcFkrDf!L$kGtӆ1ȣhxSW§©ʓ/?ƍ*M%Wg\ZezOyWMiCkC:5"na"Ss gĢq8\e?dBD+(-mqV@:A*2`.>}W/60'e;DgMrKDBRN)P4oySG,ZOU6XUxcZ6?KQL%ymo+Ï0BdґW-F[xe^!toXײoJ{F0jr!4#~22'I^yXh):]jBLJ*QGCʪ]:A]@ 9($ï^gPLi~Ș*3좌!}iA mvu&Zr;)z<7&)kշܚ@#{KlH"6l#Yuj`W9'D(EfNŔ~𼡥:/aPf gX݆W] }()x쩥UGZ /rOm `e~z֩l=u42g8#\YMP9SکBWx)N6 nG?+UCj2!@9яK/z唷 u'؝%sIҿx-8\t:~X0֡>$?j`*l-DV'_gawYLH0ݰ5&1Ck$v:|.JEފRz- +\FQ!CaxĄ”qwE0LS-r$^ՕZل@L/g+1N\jkÏ fH3$ot\Vx]O5b} #%ha]OV{=E]kTghxYsʕ)6*znQnbȋв7P E{\dˣQM6ISh۳P3 q/ӷx)&hkNj IcMӄ{s 0Ҽssp)vd{nxB'|N,@F5SO 1gq!HSØm7s5vfYˆ/ke7J$1Eܥ: !P%"zd *6ӋͪcMDlѹN fNv{1,3hvz ؅8w=ZHMϧ_uPỰ]!Cnh> _Hدw{ q~z-]bx$c}9|#P=q8=ߟϛ5ݯWm);)Wl&#{S#ɟ-Z+s廿;Ŏ`1UG7%{3=}X֖C LrK*NIIF SťNwRWJNiZ UhN'Asq¾i˺Cv$֞'!K&մ֔]e1kP`(`>^vVJtv~j͆1$;_ uʋC5̛<n:!)U譂'gU_3nkЈ+]My>X|lrq/|IONAFJ>eT+zpَe]h̶vv%%y בc>Z)Ptkױ~]$ endstream endobj 8 0 obj << /Type /ObjStm /N 100 /First 832 /Length 2939 /Filter /FlateDecode >> stream x[ko_p~A؉qi6.dimJ_rwݕHU0Krᙙ3CC0"gH  DjO#J9-FD(I<Š04!]2%5 puo -N=30-$ &bNeaz u S)aj4рK{8D;tG8$&F QDJq *T[CEB[`;Nd"d$q`TPzq(9`ά'Lα* sƈAG8s+` cZ; nނWA%h#EtXE@p`@~1lHo[hd A PWA%`xŰAE%;N&Q' Sr$` P@J@/<NyBY;c\t@9D*Y:i=;K4.B] f @-.D` Vo9 QEaA5dHr#"I˱miQ2B}D5RZ=JE%m{*ޛzA$ (ݭQOh7~@d?4u++iϮ6*2FlR%ba{RH3rWδXhXkQؽgжxh73mq̪GľS݋ݷZ"G-x'=vL;]8S'L [mzO_~ pm/@+6?]c[M$D&7_qZG4:I݂{B搰c :kM1x(Q*1*s2qL+s>2Rz齰{g %TH 88!YJr|i$~IJV18h+T+Wb$v^* H-"TF5ˈA=Du"'( .B<7:Z)]Q.Wc0kT2W$|Tz5ۧ6 xVᜐ{SI]XL@ܽ%d ~1S΃FRmᡬBX󖹼Z+zI̽+BVp^9~^XxVWnZQdYV2_ⵯMNI$ΰ'dV'e7WsU*L=ZS骿',J`ZFzӃ O:KNvYd#rO/^=30^DaWy/aӧy7Cϣlp}U';k/̺AzA 4\̲[0E+F)AMwl:`/6ȫ5?F6¯ɬ @4RlF0`f^O,fa]WG`t9O'6 9zTBWCNڦ꣸T}V)ʳTg9=?D/)}Ekz_[}G.펀ywܧL4?Kz}̇JSz9av5)NY xL?] ;ڛ 'c?ui'!hN;hvvG^ >g u0zCodc:ҏtHY`|t c:h{*"&PZ9D?'9sJsgAga|pG5ftv32: ziF?ӿBgIhj=}yA.p2`@ג U> /!R~j/ ~`Zbs W7*Li[lbG +OF&0q`U(nRL-s V`~!4c&K-~H[WUDH$$jQDBq9tfm}qmӟ8oW,GXa ~8Թ9riRQsi̓ྋcwMeUCe\2X"ռfN^+.f=\B?7u#k6'\:M6Ir%ב3U#{O ~|Kp3SwEau;/Y&{`| Z2={ ao^ZϓmA(7NlU )/ UOCMhis1K* [*=e@pZ ^. Xus!NGg~Xs]3,Q:6!J`w[(Ў/r>Yx޺c5Ix`<3d>/IAv^7{9le2zٿNH7x!T*C/fc+wMdL_vk{_$q^ ,yЇ+vI|H4>l#<=-:,!qu_Kn+]GA:JQ&6(FA6JwEn{>?4gY}U* ^*^k ~ endstream endobj 149 0 obj << /Producer (pdfTeX-1.40.14) /Creator (TeX) /CreationDate (D:20180918171914-07'00') /ModDate (D:20180918171914-07'00') /Trapped /False /PTEX.Fullbanner (This is pdfTeX, Version 3.1415926-2.5-1.40.14 (TeX Live 2013/Debian) kpathsea version 6.1.1) >> endobj 147 0 obj << /Type /ObjStm /N 2 /First 13 /Length 99 /Filter /FlateDecode >> stream x341S0P04P0䲱,HUHLO-w/+Q06L)V R06SBY)CCCegdsbIbN~:\u K@j endstream endobj 150 0 obj << /Type /XRef /Index [0 151] /Size 151 /W [1 3 1] /Root 148 0 R /Info 149 0 R /ID [<033FA4F434EB3ADB5AF1F9F8CD52DB45> <033FA4F434EB3ADB5AF1F9F8CD52DB45>] /Length 417 /Filter /FlateDecode >> stream x%9LT*, , (+(04haL,6ha PPQY$4 -4!ha32e}yI} $r}JIDg}#"ӐH%%vC{"]|-2'"Sg+Yp3"\C|yW;b( K }_F%bķ1<*5·T#blj/[&N wU!ʉ g8E,9iۼQGog[yq35:qؘs^dqq %Fq ?w6&2WUqM\7MȼE -j%۫_^俟^d'{u2& ו'J endstream endobj startxref 171221 %%EOF usr/doc/clamav-0.100.2/COPYING.regex0100644000000000000000000000334213350521603015336 0ustar rootrootThe code in libclamav/regex/ is derived from OpenBSD's libc/regex, original license follows: Copyright (c) 1992, 1993, 1994 Henry Spencer. Copyright (c) 1992, 1993, 1994 The Regents of the University of California. All rights reserved. This code is derived from software contributed to Berkeley by Henry Spencer. Redistribution and use in source and binary forms, with or without modification, are permitted provided that the following conditions are met: 1. Redistributions of source code must retain the above copyright notice, this list of conditions and the following disclaimer. 2. Redistributions in binary form must reproduce the above copyright notice, this list of conditions and the following disclaimer in the documentation and/or other materials provided with the distribution. 3. Neither the name of the University nor the names of its contributors may be used to endorse or promote products derived from this software without specific prior written permission. THIS SOFTWARE IS PROVIDED BY THE REGENTS AND CONTRIBUTORS ``AS IS'' AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE REGENTS OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. usr/doc/clamav-0.100.2/COPYING.LGPL0100644000000000000000000006363713350521603014777 0ustar rootroot GNU LESSER GENERAL PUBLIC LICENSE Version 2.1, February 1999 Copyright (C) 1991, 1999 Free Software Foundation, Inc. 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA Everyone is permitted to copy and distribute verbatim copies of this license document, but changing it is not allowed. [This is the first released version of the Lesser GPL. It also counts as the successor of the GNU Library Public License, version 2, hence the version number 2.1.] Preamble The licenses for most software are designed to take away your freedom to share and change it. By contrast, the GNU General Public Licenses are intended to guarantee your freedom to share and change free software--to make sure the software is free for all its users. This license, the Lesser General Public License, applies to some specially designated software packages--typically libraries--of the Free Software Foundation and other authors who decide to use it. You can use it too, but we suggest you first think carefully about whether this license or the ordinary General Public License is the better strategy to use in any particular case, based on the explanations below. When we speak of free software, we are referring to freedom of use, not price. Our General Public Licenses are designed to make sure that you have the freedom to distribute copies of free software (and charge for this service if you wish); that you receive source code or can get it if you want it; that you can change the software and use pieces of it in new free programs; and that you are informed that you can do these things. To protect your rights, we need to make restrictions that forbid distributors to deny you these rights or to ask you to surrender these rights. These restrictions translate to certain responsibilities for you if you distribute copies of the library or if you modify it. For example, if you distribute copies of the library, whether gratis or for a fee, you must give the recipients all the rights that we gave you. You must make sure that they, too, receive or can get the source code. If you link other code with the library, you must provide complete object files to the recipients, so that they can relink them with the library after making changes to the library and recompiling it. And you must show them these terms so they know their rights. We protect your rights with a two-step method: (1) we copyright the library, and (2) we offer you this license, which gives you legal permission to copy, distribute and/or modify the library. To protect each distributor, we want to make it very clear that there is no warranty for the free library. Also, if the library is modified by someone else and passed on, the recipients should know that what they have is not the original version, so that the original author's reputation will not be affected by problems that might be introduced by others. Finally, software patents pose a constant threat to the existence of any free program. We wish to make sure that a company cannot effectively restrict the users of a free program by obtaining a restrictive license from a patent holder. Therefore, we insist that any patent license obtained for a version of the library must be consistent with the full freedom of use specified in this license. Most GNU software, including some libraries, is covered by the ordinary GNU General Public License. This license, the GNU Lesser General Public License, applies to certain designated libraries, and is quite different from the ordinary General Public License. We use this license for certain libraries in order to permit linking those libraries into non-free programs. When a program is linked with a library, whether statically or using a shared library, the combination of the two is legally speaking a combined work, a derivative of the original library. The ordinary General Public License therefore permits such linking only if the entire combination fits its criteria of freedom. The Lesser General Public License permits more lax criteria for linking other code with the library. We call this license the "Lesser" General Public License because it does Less to protect the user's freedom than the ordinary General Public License. It also provides other free software developers Less of an advantage over competing non-free programs. These disadvantages are the reason we use the ordinary General Public License for many libraries. However, the Lesser license provides advantages in certain special circumstances. For example, on rare occasions, there may be a special need to encourage the widest possible use of a certain library, so that it becomes a de-facto standard. To achieve this, non-free programs must be allowed to use the library. A more frequent case is that a free library does the same job as widely used non-free libraries. In this case, there is little to gain by limiting the free library to free software only, so we use the Lesser General Public License. In other cases, permission to use a particular library in non-free programs enables a greater number of people to use a large body of free software. For example, permission to use the GNU C Library in non-free programs enables many more people to use the whole GNU operating system, as well as its variant, the GNU/Linux operating system. Although the Lesser General Public License is Less protective of the users' freedom, it does ensure that the user of a program that is linked with the Library has the freedom and the wherewithal to run that program using a modified version of the Library. The precise terms and conditions for copying, distribution and modification follow. Pay close attention to the difference between a "work based on the library" and a "work that uses the library". The former contains code derived from the library, whereas the latter must be combined with the library in order to run. GNU LESSER GENERAL PUBLIC LICENSE TERMS AND CONDITIONS FOR COPYING, DISTRIBUTION AND MODIFICATION 0. This License Agreement applies to any software library or other program which contains a notice placed by the copyright holder or other authorized party saying it may be distributed under the terms of this Lesser General Public License (also called "this License"). Each licensee is addressed as "you". A "library" means a collection of software functions and/or data prepared so as to be conveniently linked with application programs (which use some of those functions and data) to form executables. The "Library", below, refers to any such software library or work which has been distributed under these terms. A "work based on the Library" means either the Library or any derivative work under copyright law: that is to say, a work containing the Library or a portion of it, either verbatim or with modifications and/or translated straightforwardly into another language. (Hereinafter, translation is included without limitation in the term "modification".) "Source code" for a work means the preferred form of the work for making modifications to it. For a library, complete source code means all the source code for all modules it contains, plus any associated interface definition files, plus the scripts used to control compilation and installation of the library. Activities other than copying, distribution and modification are not covered by this License; they are outside its scope. The act of running a program using the Library is not restricted, and output from such a program is covered only if its contents constitute a work based on the Library (independent of the use of the Library in a tool for writing it). Whether that is true depends on what the Library does and what the program that uses the Library does. 1. You may copy and distribute verbatim copies of the Library's complete source code as you receive it, in any medium, provided that you conspicuously and appropriately publish on each copy an appropriate copyright notice and disclaimer of warranty; keep intact all the notices that refer to this License and to the absence of any warranty; and distribute a copy of this License along with the Library. You may charge a fee for the physical act of transferring a copy, and you may at your option offer warranty protection in exchange for a fee. 2. You may modify your copy or copies of the Library or any portion of it, thus forming a work based on the Library, and copy and distribute such modifications or work under the terms of Section 1 above, provided that you also meet all of these conditions: a) The modified work must itself be a software library. b) You must cause the files modified to carry prominent notices stating that you changed the files and the date of any change. c) You must cause the whole of the work to be licensed at no charge to all third parties under the terms of this License. d) If a facility in the modified Library refers to a function or a table of data to be supplied by an application program that uses the facility, other than as an argument passed when the facility is invoked, then you must make a good faith effort to ensure that, in the event an application does not supply such function or table, the facility still operates, and performs whatever part of its purpose remains meaningful. (For example, a function in a library to compute square roots has a purpose that is entirely well-defined independent of the application. Therefore, Subsection 2d requires that any application-supplied function or table used by this function must be optional: if the application does not supply it, the square root function must still compute square roots.) These requirements apply to the modified work as a whole. If identifiable sections of that work are not derived from the Library, and can be reasonably considered independent and separate works in themselves, then this License, and its terms, do not apply to those sections when you distribute them as separate works. But when you distribute the same sections as part of a whole which is a work based on the Library, the distribution of the whole must be on the terms of this License, whose permissions for other licensees extend to the entire whole, and thus to each and every part regardless of who wrote it. Thus, it is not the intent of this section to claim rights or contest your rights to work written entirely by you; rather, the intent is to exercise the right to control the distribution of derivative or collective works based on the Library. In addition, mere aggregation of another work not based on the Library with the Library (or with a work based on the Library) on a volume of a storage or distribution medium does not bring the other work under the scope of this License. 3. You may opt to apply the terms of the ordinary GNU General Public License instead of this License to a given copy of the Library. To do this, you must alter all the notices that refer to this License, so that they refer to the ordinary GNU General Public License, version 2, instead of to this License. (If a newer version than version 2 of the ordinary GNU General Public License has appeared, then you can specify that version instead if you wish.) Do not make any other change in these notices. Once this change is made in a given copy, it is irreversible for that copy, so the ordinary GNU General Public License applies to all subsequent copies and derivative works made from that copy. This option is useful when you wish to copy part of the code of the Library into a program that is not a library. 4. You may copy and distribute the Library (or a portion or derivative of it, under Section 2) in object code or executable form under the terms of Sections 1 and 2 above provided that you accompany it with the complete corresponding machine-readable source code, which must be distributed under the terms of Sections 1 and 2 above on a medium customarily used for software interchange. If distribution of object code is made by offering access to copy from a designated place, then offering equivalent access to copy the source code from the same place satisfies the requirement to distribute the source code, even though third parties are not compelled to copy the source along with the object code. 5. A program that contains no derivative of any portion of the Library, but is designed to work with the Library by being compiled or linked with it, is called a "work that uses the Library". Such a work, in isolation, is not a derivative work of the Library, and therefore falls outside the scope of this License. However, linking a "work that uses the Library" with the Library creates an executable that is a derivative of the Library (because it contains portions of the Library), rather than a "work that uses the library". The executable is therefore covered by this License. Section 6 states terms for distribution of such executables. When a "work that uses the Library" uses material from a header file that is part of the Library, the object code for the work may be a derivative work of the Library even though the source code is not. Whether this is true is especially significant if the work can be linked without the Library, or if the work is itself a library. The threshold for this to be true is not precisely defined by law. If such an object file uses only numerical parameters, data structure layouts and accessors, and small macros and small inline functions (ten lines or less in length), then the use of the object file is unrestricted, regardless of whether it is legally a derivative work. (Executables containing this object code plus portions of the Library will still fall under Section 6.) Otherwise, if the work is a derivative of the Library, you may distribute the object code for the work under the terms of Section 6. Any executables containing that work also fall under Section 6, whether or not they are linked directly with the Library itself. 6. As an exception to the Sections above, you may also combine or link a "work that uses the Library" with the Library to produce a work containing portions of the Library, and distribute that work under terms of your choice, provided that the terms permit modification of the work for the customer's own use and reverse engineering for debugging such modifications. You must give prominent notice with each copy of the work that the Library is used in it and that the Library and its use are covered by this License. You must supply a copy of this License. If the work during execution displays copyright notices, you must include the copyright notice for the Library among them, as well as a reference directing the user to the copy of this License. Also, you must do one of these things: a) Accompany the work with the complete corresponding machine-readable source code for the Library including whatever changes were used in the work (which must be distributed under Sections 1 and 2 above); and, if the work is an executable linked with the Library, with the complete machine-readable "work that uses the Library", as object code and/or source code, so that the user can modify the Library and then relink to produce a modified executable containing the modified Library. (It is understood that the user who changes the contents of definitions files in the Library will not necessarily be able to recompile the application to use the modified definitions.) b) Use a suitable shared library mechanism for linking with the Library. A suitable mechanism is one that (1) uses at run time a copy of the library already present on the user's computer system, rather than copying library functions into the executable, and (2) will operate properly with a modified version of the library, if the user installs one, as long as the modified version is interface-compatible with the version that the work was made with. c) Accompany the work with a written offer, valid for at least three years, to give the same user the materials specified in Subsection 6a, above, for a charge no more than the cost of performing this distribution. d) If distribution of the work is made by offering access to copy from a designated place, offer equivalent access to copy the above specified materials from the same place. e) Verify that the user has already received a copy of these materials or that you have already sent this user a copy. For an executable, the required form of the "work that uses the Library" must include any data and utility programs needed for reproducing the executable from it. However, as a special exception, the materials to be distributed need not include anything that is normally distributed (in either source or binary form) with the major components (compiler, kernel, and so on) of the operating system on which the executable runs, unless that component itself accompanies the executable. It may happen that this requirement contradicts the license restrictions of other proprietary libraries that do not normally accompany the operating system. Such a contradiction means you cannot use both them and the Library together in an executable that you distribute. 7. You may place library facilities that are a work based on the Library side-by-side in a single library together with other library facilities not covered by this License, and distribute such a combined library, provided that the separate distribution of the work based on the Library and of the other library facilities is otherwise permitted, and provided that you do these two things: a) Accompany the combined library with a copy of the same work based on the Library, uncombined with any other library facilities. This must be distributed under the terms of the Sections above. b) Give prominent notice with the combined library of the fact that part of it is a work based on the Library, and explaining where to find the accompanying uncombined form of the same work. 8. You may not copy, modify, sublicense, link with, or distribute the Library except as expressly provided under this License. Any attempt otherwise to copy, modify, sublicense, link with, or distribute the Library is void, and will automatically terminate your rights under this License. However, parties who have received copies, or rights, from you under this License will not have their licenses terminated so long as such parties remain in full compliance. 9. You are not required to accept this License, since you have not signed it. However, nothing else grants you permission to modify or distribute the Library or its derivative works. These actions are prohibited by law if you do not accept this License. Therefore, by modifying or distributing the Library (or any work based on the Library), you indicate your acceptance of this License to do so, and all its terms and conditions for copying, distributing or modifying the Library or works based on it. 10. Each time you redistribute the Library (or any work based on the Library), the recipient automatically receives a license from the original licensor to copy, distribute, link with or modify the Library subject to these terms and conditions. You may not impose any further restrictions on the recipients' exercise of the rights granted herein. You are not responsible for enforcing compliance by third parties with this License. 11. If, as a consequence of a court judgment or allegation of patent infringement or for any other reason (not limited to patent issues), conditions are imposed on you (whether by court order, agreement or otherwise) that contradict the conditions of this License, they do not excuse you from the conditions of this License. If you cannot distribute so as to satisfy simultaneously your obligations under this License and any other pertinent obligations, then as a consequence you may not distribute the Library at all. For example, if a patent license would not permit royalty-free redistribution of the Library by all those who receive copies directly or indirectly through you, then the only way you could satisfy both it and this License would be to refrain entirely from distribution of the Library. If any portion of this section is held invalid or unenforceable under any particular circumstance, the balance of the section is intended to apply, and the section as a whole is intended to apply in other circumstances. It is not the purpose of this section to induce you to infringe any patents or other property right claims or to contest validity of any such claims; this section has the sole purpose of protecting the integrity of the free software distribution system which is implemented by public license practices. Many people have made generous contributions to the wide range of software distributed through that system in reliance on consistent application of that system; it is up to the author/donor to decide if he or she is willing to distribute software through any other system and a licensee cannot impose that choice. This section is intended to make thoroughly clear what is believed to be a consequence of the rest of this License. 12. If the distribution and/or use of the Library is restricted in certain countries either by patents or by copyrighted interfaces, the original copyright holder who places the Library under this License may add an explicit geographical distribution limitation excluding those countries, so that distribution is permitted only in or among countries not thus excluded. In such case, this License incorporates the limitation as if written in the body of this License. 13. The Free Software Foundation may publish revised and/or new versions of the Lesser General Public License from time to time. Such new versions will be similar in spirit to the present version, but may differ in detail to address new problems or concerns. Each version is given a distinguishing version number. If the Library specifies a version number of this License which applies to it and "any later version", you have the option of following the terms and conditions either of that version or of any later version published by the Free Software Foundation. If the Library does not specify a license version number, you may choose any version ever published by the Free Software Foundation. 14. If you wish to incorporate parts of the Library into other free programs whose distribution conditions are incompatible with these, write to the author to ask for permission. For software which is copyrighted by the Free Software Foundation, write to the Free Software Foundation; we sometimes make exceptions for this. Our decision will be guided by the two goals of preserving the free status of all derivatives of our free software and of promoting the sharing and reuse of software generally. NO WARRANTY 15. BECAUSE THE LIBRARY IS LICENSED FREE OF CHARGE, THERE IS NO WARRANTY FOR THE LIBRARY, TO THE EXTENT PERMITTED BY APPLICABLE LAW. EXCEPT WHEN OTHERWISE STATED IN WRITING THE COPYRIGHT HOLDERS AND/OR OTHER PARTIES PROVIDE THE LIBRARY "AS IS" WITHOUT WARRANTY OF ANY KIND, EITHER EXPRESSED OR IMPLIED, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. THE ENTIRE RISK AS TO THE QUALITY AND PERFORMANCE OF THE LIBRARY IS WITH YOU. SHOULD THE LIBRARY PROVE DEFECTIVE, YOU ASSUME THE COST OF ALL NECESSARY SERVICING, REPAIR OR CORRECTION. 16. IN NO EVENT UNLESS REQUIRED BY APPLICABLE LAW OR AGREED TO IN WRITING WILL ANY COPYRIGHT HOLDER, OR ANY OTHER PARTY WHO MAY MODIFY AND/OR REDISTRIBUTE THE LIBRARY AS PERMITTED ABOVE, BE LIABLE TO YOU FOR DAMAGES, INCLUDING ANY GENERAL, SPECIAL, INCIDENTAL OR CONSEQUENTIAL DAMAGES ARISING OUT OF THE USE OR INABILITY TO USE THE LIBRARY (INCLUDING BUT NOT LIMITED TO LOSS OF DATA OR DATA BEING RENDERED INACCURATE OR LOSSES SUSTAINED BY YOU OR THIRD PARTIES OR A FAILURE OF THE LIBRARY TO OPERATE WITH ANY OTHER SOFTWARE), EVEN IF SUCH HOLDER OR OTHER PARTY HAS BEEN ADVISED OF THE POSSIBILITY OF SUCH DAMAGES. END OF TERMS AND CONDITIONS How to Apply These Terms to Your New Libraries If you develop a new library, and you want it to be of the greatest possible use to the public, we recommend making it free software that everyone can redistribute and change. You can do so by permitting redistribution under these terms (or, alternatively, under the terms of the ordinary General Public License). To apply these terms, attach the following notices to the library. It is safest to attach them to the start of each source file to most effectively convey the exclusion of warranty; and each file should have at least the "copyright" line and a pointer to where the full notice is found. Copyright (C) This library is free software; you can redistribute it and/or modify it under the terms of the GNU Lesser General Public License as published by the Free Software Foundation; either version 2.1 of the License, or (at your option) any later version. This library is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Lesser General Public License for more details. You should have received a copy of the GNU Lesser General Public License along with this library; if not, write to the Free Software Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA Also add information on how to contact you by electronic and paper mail. You should also get your employer (if you work as a programmer) or your school, if any, to sign a "copyright disclaimer" for the library, if necessary. Here is a sample; alter the names: Yoyodyne, Inc., hereby disclaims all copyright interest in the library `Frob' (a library for tweaking knobs) written by James Random Hacker. , 1 April 1990 Ty Coon, President of Vice That's all there is to it! usr/doc/clamav-0.100.2/html/0040755000000000000000000000000013350521603014137 5ustar rootrootusr/doc/clamav-0.100.2/html/node43.html0100644000000000000000000000516513350521603016125 0ustar rootroot Archives and compressed files

Archives and compressed files

The following archive and compression formats are supported by internal handlers:
  • Zip (+ SFX)
  • RAR (+ SFX)
  • 7Zip
  • Tar
  • CPIO
  • Gzip
  • Bzip2
  • DMG
  • IMG
  • ISO 9660
  • PKG
  • HFS+ partition
  • HFSX partition
  • APM disk image
  • GPT disk image
  • MBR disk image
  • XAR
  • XZ
  • MS OLE2
  • MS Cabinet Files (+ SFX)
  • MS CHM (Compiled HTML)
  • MS SZDD compression format
  • BinHex
  • SIS (SymbianOS packages)
  • AutoIt
  • NSIS
  • InstallShield


Cisco 2018-09-18
usr/doc/clamav-0.100.2/html/node56.html0100644000000000000000000000406413350521603016126 0ustar rootroot Memory
next up previous contents
Next: Forking daemons Up: API Previous: Data scan functions   Contents

Memory

Because the engine structure occupies a few megabytes of system memory, you should release it with cl_engine_free() if you no longer need to scan files.


Cisco 2018-09-18
usr/doc/clamav-0.100.2/html/node4.html0100644000000000000000000000566513350521603016047 0ustar rootroot Mailing lists and IRC channel
next up previous contents
Next: Virus submitting Up: Introduction Previous: Features   Contents

Mailing lists and IRC channel

If you have a trouble installing or using ClamAV try asking on our mailing lists. There are four lists available:
  • clamav-announce*lists.clamav.net - info about new versions, moderated1.
  • clamav-users*lists.clamav.net - user questions
  • clamav-devel*lists.clamav.net - technical discussions
  • clamav-virusdb*lists.clamav.net - database update announcements, moderated
You can subscribe and search the mailing list archives at: https://www.clamav.net/contact.html#ml
Alternatively you can try asking on the #clamav IRC channel - launch your favourite irc client and type: 
	/server irc.freenode.net
	/join #clamav


Cisco 2018-09-18
usr/doc/clamav-0.100.2/html/node9.html0100644000000000000000000000540613350521603016045 0ustar rootroot Installation
next up previous contents
Next: Requirements Up: clamdoc Previous: Binary packages   Contents

Installation


Subsections
Cisco 2018-09-18
usr/doc/clamav-0.100.2/html/img3.png0100644000000000000000000000441113350521603015501 0ustar rootrootPNG  IHDR,K$3PLTEOLMħA=># ♗^[\{yz2./mjkIDAThZ1ko^ 쾧LuƱ!E_B ;_C_͵/\"SH0zַgZc'#Ԝ#zkt8C?C ҔJ#E7! x9HKiGEI3-o[ԼKR8u+>h;BH bXrO+"sTQ8m"n ˿HCß{D{"sq/5=6 g/HqGN}a,T5Y`6lvAսlMK\2jD7k'%$tp&]p',nեWz10Fbw- ?*vоHܒ) roVF < y3ʿ>ϴsCΆBf9Էm<[P1p@yQ6 x(E8dLJ8 J˚n&@<,kZܚxPd:iL1RϑTtIiP+n6Ӹ؞= ,ۈ}w۸zi1A-rn9 [seƍ$:݉%ɬT*S3NƒH&1ئ(&@ʠ3Ԙ&2WyK==Di)bX].J\RN á$EPr)m9uYM(?(t(2L;Pu߻>[{WD?)9q%[$5e$fR2=,\ssQÍqVs C云AFL1N ~dS1n-ugl))4&$ih1)ĸ;pJ+fr)rhN}MeɆ%T*{I8&ܑYTb,9- KqBCRU9BZi֘64r)r*Ln\:-ȓU-̺nwZDՠe,[zhܢw(,NB*SiEB!i&o VTe<]k 9R.-1jM[ᜰ%ReF>ņ8hͮ=<.!HRbR:$M!O#,.+6I h*zMFg.jpR !wlҵRR-Vn$,|.}C qa^<DzYN`o7T[;AX}^BqUu-~&+Fl g~5Hk浝V݆*ۛ/qK5_5=%U2# ˂vbg|zTW$_ȵC0ecXh[dką֡sD1y 9BGRD{wЌ6$2&a `DH嘠j%`l&\'q5^rqiӎ($KgFG;'[΀e AZluB0IŇt|ڣ5k5V64ۅUDN6wb'W` veqfwJ8lfܦE.rSOrST8`̘>xsUuv@`1%O83bK/,ඃSHh[voϼVЪdG1T'mqgl7-I 3UN.W%.$Xϖ zte+fvT `PβɖX:I恵&bN,lA#Kc$`3 j58m;`QWSS~ ]6ݲrrtHЀ4C ٌ1{;ʇN. -+7 qҴ Ŗ1ѪuF(|zB+tOZ03*Nc֫#l$&YʭN1B0#Xx NǾjo}2X>!'XsO|6}C ?~67]<tIENDB`usr/doc/clamav-0.100.2/html/node29.html0100644000000000000000000001177713350521603016137 0ustar rootroot On-access Scanning
next up previous contents
Next: Clamdtop Up: Usage Previous: Clamdscan   Contents


On-access Scanning

There is a special thread in clamd that performs on-access scanning under Linux and shares internal virus database with the daemon. By default, this thread will only notify you when potential threats are discovered. If you turn on prevention via clamd.conf then you must follow some important rules when using it:
  • Always stop the daemon cleanly - using the SHUTDOWN command or the
    SIGTERM signal. In other case you can lose access to protected files until the system is restarted.
  • Never protect the directory your mail-scanner software uses for attachment unpacking. Access to all infected files will be automatically blocked and the scanner (including clamd!) will not be able to detect any viruses. In the result all infected mails may be delivered.
  • Watch your entire filesystem only using the clamd.conf OnAccessMountPath option. While this will disable on-access prevention, it will avoid potential system lockups caused by fanotify's blocking functionality.
  • Using the On-Access Scanner to watch a virtual filesystem will result in undefined behaviour.
The default configuration utilizes inotify to recursively keep track of directories. If you need to protect more than 8192 directories it will be necessary to change inotify's max_user_watches value.

This can be done temporarily with: 
    $ sysctl fs.inotify.max_user_watches=<n>
Where <n> is the new maximum desired.

To watch your entire filesystem add the following lines to clamd.conf: 
	ScanOnAccess yes
	OnAccessMountPath /
Similarly, to protect your home directory add the following lines to clamd.conf: 
	ScanOnAccess yes
	OnAccessIncludePath /home
	OnAccessExcludePath /home/user/temp/dir/of/your/mail/scanning/software
	OnAccessPrevention yes
For more configuration options, type 'man clamd.conf' or reference the example clamd.conf.

next up previous contents
Next: Clamdtop Up: Usage Previous: Clamdscan   Contents
Cisco 2018-09-18
usr/doc/clamav-0.100.2/html/next.png0100644000000000000000000000036513350521603015624 0ustar rootrootPNG  IHDR%wu PLTEooo[tRNS@fIDATxm1 0 EQF >k>B>N3=k?d M53kARM9Nl :C5tl]oD/ܡ_\lE6tU{Ccs=@uwz clamscan
next up previous contents
Next: clamd Up: Output format Previous: Output format   Contents

clamscan

clamscan writes all regular program messages to stdout and errors/warnings to stderr. You can use the option --stdout to redirect all program messages to stdout. Warnings and error messages from libclamav are always printed to stderr. A typical output from clamscan looks like this: 
	/tmp/test/removal-tool.exe: Worm.Sober FOUND
	/tmp/test/md5.o: OK
	/tmp/test/blob.c: OK
	/tmp/test/message.c: OK
	/tmp/test/error.hta: VBS.Inor.D FOUND
When a virus is found its name is printed between the filename: and FOUND strings. In case of archives the scanner depends on libclamav and only prints the first virus found within an archive: 
	$ clamscan malware.zip 
	malware.zip: Worm.Mydoom.U FOUND
When using the -allmatch(-z) flag, clamscan may print multiple virus FOUND lines for archives and files.


Cisco 2018-09-18
usr/doc/clamav-0.100.2/html/node32.html0100644000000000000000000000406113350521603016115 0ustar rootroot ClamBC
next up previous contents
Next: Freshclam Up: Usage Previous: Clamscan   Contents

ClamBC

clambc is Clam Anti-Virus' bytecode testing tool. It can be used to test files which contain bytecode. For more detailed help, type 'man clambc' or 'clambc -help'.


Cisco 2018-09-18
usr/doc/clamav-0.100.2/html/node30.html0100644000000000000000000000454613350521603016123 0ustar rootroot Clamdtop
next up previous contents
Next: Clamscan Up: Usage Previous: On-access Scanning   Contents

Clamdtop

clamdtop is a tool to monitor one or multiple instances of clamd. It has a (color) ncurses interface, that shows the jobs in clamd's queue, memory usage, and information about the loaded signature database. You can specify on the command-line to which clamd(s) it should connect to. By default it will attempt to connect to the local clamd as defined in clamd.conf.

For more detailed help, type 'man clamdtop' or 'clamdtop -help'.


Cisco 2018-09-18
usr/doc/clamav-0.100.2/html/crossref.png0100644000000000000000000000021713350521603016470 0ustar rootrootPNG  IHDR x Configuration
next up previous contents
Next: clamd Up: clamdoc Previous: Obtain Latest ClamAV anti-virus   Contents

Configuration

Before proceeding with the steps below, you should run the 'clamconf' command, which gives important information about your ClamAV configuration. See section [*] for more details.


Subsections
Cisco 2018-09-18
usr/doc/clamav-0.100.2/html/img4.png0100644000000000000000000000074113350521603015504 0ustar rootrootPNG  IHDR:#@K40PLTEOLMħA=># ♗^[\{yz2./mjkxlIDAT8RJP\p(.,M EtrҗiZ% Tt ]LΙ率 NMB@uKK`/յ&ěK\'0MM fRjg`WC ٛ yξcJKnnh EMZF fa_X @Μہ= X\p6t[/^2.꘬~C%{'?d5ЮTE@`+`K<;R 2^fV*YLWbCi[SU7{S<Ӿk4:F9U'Se?z}?֞`IENDB`usr/doc/clamav-0.100.2/html/node28.html0100644000000000000000000000506613350521603016130 0ustar rootroot Clamdscan
next up previous contents
Next: On-access Scanning Up: Usage Previous: Clam daemon   Contents

Clamdscan

clamdscan is a simple clamd client. In many cases you can use it as a clamscan replacement however you must remember that:
  • it only depends on clamd
  • although it accepts the same command line options as clamscan most of them are ignored because they must be enabled directly in clamd, i.e. clamd.conf
  • in TCP mode scanned files must be accessible for clamd, if you enabled LocalSocket in clamd.conf then clamdscan will try to workaround this limitation by using FILDES


Cisco 2018-09-18
usr/doc/clamav-0.100.2/html/up.png0100644000000000000000000000032313350521603015264 0ustar rootrootPNG  IHDR5 PLTEooo[tRNS@fuIDATx]10 Ed&Cwr,'k7n)IT xOm'<Q1A BP+ :׊pۭYh/iO.c7Np_/11Ab$}IENDB`usr/doc/clamav-0.100.2/html/up_g.png0100644000000000000000000000032413350521603015573 0ustar rootrootPNG  IHDR5 PLTEooo+tRNS@fvIDAT] 0  "jI2*e 2@F;w$Qf6x ,~8⒱@BP+ :[󦽌=;ݤ?;~=^W~;LFIENDB`usr/doc/clamav-0.100.2/html/node24.html0100644000000000000000000001230113350521603016112 0ustar rootroot Setting up auto-updating
next up previous contents
Next: Closest mirrors Up: Configuration Previous: Testing   Contents


Setting up auto-updating

freshclam is the automatic database update tool for Clam AntiVirus. It can work in two modes:
  • interactive - on demand from command line
  • daemon - silently in the background
freshclam is advanced tool: it supports scripted updates (instead of transferring the whole CVD file at each update it only transfers the differences between the latest and the current database via a special script), database version checks through DNS, proxy servers (with authentication), digital signatures and various error scenarios. Quick test: run freshclam (as superuser) with no parameters and check the output. If everything is OK you may create the log file in /var/log (owned by clamav or another user freshclam will be running as): 
	# touch /var/log/freshclam.log
	# chmod 600 /var/log/freshclam.log
	# chown clamav /var/log/freshclam.log
Now you should edit the configuration file freshclam.conf and point the UpdateLogFile directive to the log file. Finally, to run freshclam in the daemon mode, execute: 
	# freshclam -d
The other way is to use the cron daemon. You have to add the following line to the crontab of root or clamav user: 
N * * * *	/usr/local/bin/freshclam --quiet
to check for a new database every hour. N should be a number between 3 and 57 of your choice. Please don't choose any multiple of 10, because there are already too many clients using those time slots. Proxy settings are only configurable via the configuration file and freshclam will require strict permission settings for the config file when HTTPProxyPassword is turned on. 
	HTTPProxyServer myproxyserver.com
	HTTPProxyPort 1234
	HTTPProxyUsername myusername
	HTTPProxyPassword mypass


Subsections
next up previous contents
Next: Closest mirrors Up: Configuration Previous: Testing   Contents
Cisco 2018-09-18
usr/doc/clamav-0.100.2/html/node57.html0100644000000000000000000000434413350521603016130 0ustar rootroot Forking daemons
next up previous contents
Next: clamav-config Up: API Previous: Memory   Contents

Forking daemons

If you're using libclamav with a forking daemon you should call srand() inside a forked child before making any calls to the libclamav functions. This will avoid possible collisions with temporary filenames created by other processes of the daemon. This procedure is not required for multi-threaded daemons.


Cisco 2018-09-18
usr/doc/clamav-0.100.2/html/node35.html0100644000000000000000000000416513350521603016125 0ustar rootroot Output format
next up previous contents
Next: clamscan Up: Usage Previous: Clamconf   Contents

Output format


Subsections
Cisco 2018-09-18
usr/doc/clamav-0.100.2/html/node39.html0100644000000000000000000000416713350521603016133 0ustar rootroot License
next up previous contents
Next: Supported formats and features Up: LibClamAV Previous: LibClamAV   Contents

License

Libclamav is licensed under the GNU GPL v2 license. This means you are not allowed to link commercial, closed-source software against it. All software using libclamav must be GPL compliant.


Cisco 2018-09-18
usr/doc/clamav-0.100.2/html/node59.html0100644000000000000000000000407313350521603016131 0ustar rootroot Example
next up previous contents
Next: CVD format Up: API Previous: clamav-config   Contents

Example

You will find an example scanner application in the clamav source package (/example). Provided you have ClamAV already installed, execute the following to compile it: 
	gcc -Wall ex1.c -o ex1 -lclamav


Cisco 2018-09-18
usr/doc/clamav-0.100.2/html/node12.html0100644000000000000000000000462413350521603016120 0ustar rootroot Adding new system user and group
next up previous contents
Next: Compilation of base package Up: Installation Previous: Installing on shell account   Contents

Adding new system user and group

If you are installing ClamAV for the first time, you have to add a new user and group to your system: 
	# groupadd clamav
	# useradd -g clamav -s /bin/false -c "Clam AntiVirus" clamav
Consult a system manual if your OS has not groupadd and useradd utilities. Don't forget to lock access to the account!


Cisco 2018-09-18
usr/doc/clamav-0.100.2/html/node31.html0100644000000000000000000000445313350521603016121 0ustar rootroot Clamscan
next up previous contents
Next: ClamBC Up: Usage Previous: Clamdtop   Contents

Clamscan

clamscan is ClamAV's command line virus scanner. It can be used to scan files and/or directories for viruses. In order for clamscan to work proper, the ClamAV virus database files must be installed on the system you are using clamscan on.

The general usage of clamscan is: clamscan [options] [file/directory/-]

For more detailed help, type 'man clamscan' or 'clamscan -help'.


Cisco 2018-09-18
usr/doc/clamav-0.100.2/html/node16.html0100644000000000000000000001176713350521603016132 0ustar rootroot Running unit tests
next up previous contents
Next: Reporting a unit test Up: Installation Previous: Using the system LLVM   Contents


Running unit tests

ClamAV includes unit tests that allow you to test that the compiled binaries work correctly on your platform.

The first step is to use your OS's package manager to install the check package. If your OS doesn't have that package, you can download it from http://check.sourceforge.net/, build it and install it.

To help clamav's configure script locate check, it is recommended that you install pkg-config, preferably using your OS's package manager, or from http://pkg-config.freedesktop.org.

The recommended way to run unit-tests is the following, which ensures you will get an error if unit tests cannot be built: 6 
	 $ ./configure --enable-check
	 $ make
	 $ make check
When make check is finished, you should get a message similar to this: 
==================
All 8 tests passed
==================
If a unit test fails, you get a message similar to the following. Note that in older versions of make check may report failures due to the absence of optional packages. Please make sure you have the latest versions of the components noted in section /refsec:components. See the next section on how to report a bug when a unit test fails. 
========================================
1 of 8 tests failed
Please report to https://bugzilla.clamav.net/
========================================
If unit tests are disabled (and you didn't use -enable-check), you will get this message: 
*** Unit tests disabled in this build
*** Use ./configure --enable-check to enable them

SKIP: check_clamav
PASS: check_clamd.sh
PASS: check_freshclam.sh
PASS: check_sigtool.sh
PASS: check_clamscan.sh
======================
All 4 tests passed
(1 tests were not run)
======================
Running ./configure --enable-check should tell you why.

next up previous contents
Next: Reporting a unit test Up: Installation Previous: Using the system LLVM   Contents
Cisco 2018-09-18
usr/doc/clamav-0.100.2/html/node1.html0100644000000000000000000001166013350521603016034 0ustar rootroot Contents
next up previous
Next: Introduction Up: clamdoc Previous: clamdoc


Contents





\begin{boxedminipage}[b]{\textwidth} ClamAV User Manual, 87d 88d 89d \copyrigh... ... Franklin Street, Fifth Floor, Boston, MA 02110-1301, USA. \end{boxedminipage}




\begin{boxedminipage}[b]{\textwidth} ClamAV and Clam AntiVirus are trademarks of Cisco Systems, Inc. \end{boxedminipage}


Cisco 2018-09-18
usr/doc/clamav-0.100.2/html/clamdoc.css0100644000000000000000000000210513350521603016246 0ustar rootroot/* Century Schoolbook font is very similar to Computer Modern Math: cmmi */ .MATH { font-family: "Century Schoolbook", serif; } .MATH I { font-family: "Century Schoolbook", serif; font-style: italic } .BOLDMATH { font-family: "Century Schoolbook", serif; font-weight: bold } /* implement both fixed-size and relative sizes */ SMALL.XTINY { font-size : xx-small } SMALL.TINY { font-size : x-small } SMALL.SCRIPTSIZE { font-size : smaller } SMALL.FOOTNOTESIZE { font-size : small } SMALL.SMALL { } BIG.LARGE { } BIG.XLARGE { font-size : large } BIG.XXLARGE { font-size : x-large } BIG.HUGE { font-size : larger } BIG.XHUGE { font-size : xx-large } /* heading styles */ H1 { } H2 { } H3 { } H4 { } H5 { } /* mathematics styles */ DIV.displaymath { } /* math displays */ TD.eqno { } /* equation-number cells */ /* document-specific styles come next */ PRE.preform { } DIV.center { } DIV.flushright { } DIV.navigation { } SPAN.textbf { font-weight: bold } SPAN.arabic { } SPAN.textit { font-style: italic } #hue36 { color: #ffffff; } usr/doc/clamav-0.100.2/html/node27.html0100644000000000000000000002330313350521603016121 0ustar rootroot Clam daemon
next up previous contents
Next: Clamdscan Up: Usage Previous: Usage   Contents


Clam daemon

clamd is a multi-threaded daemon that uses libclamav to scan files for viruses. It may work in one or both modes listening on:
  • Unix (local) socket
  • TCP socket
The daemon is fully configurable via the clamd.conf file 8. clamd recognizes the following commands:
  • PING
    Check the daemon's state (should reply with "PONG").
  • VERSION
    Print program and database versions.
  • RELOAD
    Reload the databases.
  • SHUTDOWN
    Perform a clean exit.
  • SCAN file/directory
    Scan file or directory (recursively) with archive support enabled (a full path is required).
  • RAWSCAN file/directory
    Scan file or directory (recursively) with archive and special file support disabled (a full path is required).
  • CONTSCAN file/directory
    Scan file or directory (recursively) with archive support enabled and don't stop the scanning when a virus is found.
  • MULTISCAN file/directory
    Scan file in a standard way or scan directory (recursively) using multiple threads (to make the scanning faster on SMP machines).
  • ALLMATCHSCAN file/directory
    ALLMATCHSCAN works just like SCAN except that it sets a mode where, after finding a virus within a file, continues scanning for additional viruses.
  • INSTREAM
    It is mandatory to prefix this command with n or z.
    Scan a stream of data. The stream is sent to clamd in chunks, after INSTREAM, on the same socket on which the command was sent. This avoids the overhead of establishing new TCP connections and problems with NAT. The format of the chunk is: <length><data> where <length> is the size of the following data in bytes expressed as a 4 byte unsigned integer in network byte order and <data> is the actual chunk. Streaming is terminated by sending a zero-length chunk. Note: do not exceed StreamMaxLength as defined in clamd.conf, otherwise clamd will reply with INSTREAM size limit exceeded and close the connection.
  • FILDES
    It is mandatory to newline terminate this command, or prefix with n or z. This command only works on UNIX domain sockets.
    Scan a file descriptor. After issuing a FILDES command a subsequent rfc2292/bsd4.4 style packet (with at least one dummy character) is sent to clamd carrying the file descriptor to be scanned inside the ancillary data. Alternatively the file descriptor may be sent in the same packet, including the extra character.
  • STATS
    It is mandatory to newline terminate this command, or prefix with n or z, it is recommended to only use the z prefix.
    On this command clamd provides statistics about the scan queue, contents of scan queue, and memory usage. The exact reply format is subject to changes in future releases.
  • IDSESSION, END
    It is mandatory to prefix this command with n or z, also all commands inside IDSESSION must be prefixed.
    Start/end a clamd session. Within a session multiple SCAN, INSTREAM, FILDES, VERSION, STATS commands can be sent on the same socket without opening new connections. Replies from clamd will be in the form <id>: <response> where <id> is the request number (in ASCII, starting from 1) and <response> is the usual clamd reply. The reply lines have the same delimiter as the corresponding command had. Clamd will process the commands asynchronously, and reply as soon as it has finished processing. Clamd requires clients to read all the replies it sent, before sending more commands to prevent send() deadlocks. The recommended way to implement a client that uses IDSESSION is with non-blocking sockets, and a select()/poll() loop: whenever send would block, sleep in select/poll until either you can write more data, or read more replies. Note that using non-blocking sockets without the select/poll loop and alternating recv()/send() doesn't comply with clamd's requirements. If clamd detects that a client has deadlocked, it will close the connection. Note that clamd may close an IDSESSION connection too if the client doesn't follow the protocol's requirements.
  • STREAM (deprecated, use INSTREAM instead)
    Scan stream: clamd will return a new port number you should connect to and send data to scan.
It's recommended to prefix clamd commands with the letter z (eg. zSCAN) to indicate that the command will be delimited by a NULL character and that clamd should continue reading command data until a NULL character is read. The null delimiter assures that the complete command and its entire argument will be processed as a single command. Alternatively commands may be prefixed with the letter n (e.g. nSCAN) to use a newline character as the delimiter. Clamd replies will honour the requested terminator in turn. If clamd doesn't recognize the command, or the command doesn't follow the requirements specified below, it will reply with an error message, and close the connection. Clamd can handle the following signals:
  • SIGTERM - perform a clean exit
  • SIGHUP - reopen the log file
  • SIGUSR2 - reload the database
Clamd should not be started in the background using the shell operator & or external tools. Instead, you should run and wait for clamd to load the database and daemonize itself. After that, clamd is instantly ready to accept connections and perform file scanning.

next up previous contents
Next: Clamdscan Up: Usage Previous: Usage   Contents
Cisco 2018-09-18
usr/doc/clamav-0.100.2/html/node62.html0100644000000000000000000000361113350521603016120 0ustar rootroot OpenAntiVirus
next up previous contents
Up: LibClamAV Previous: Graphics   Contents

OpenAntiVirus

Our database includes the virus database (about 7000 signatures) from OpenAntiVirus (http://OpenAntiVirus.org).


Cisco 2018-09-18
usr/doc/clamav-0.100.2/html/node34.html0100644000000000000000000000736113350521603016125 0ustar rootroot Clamconf
next up previous contents
Next: Output format Up: Usage Previous: Freshclam   Contents


Clamconf

clamconf is the Clam Anti-Virus configuration utility. It is used for displaying values of configurations options in ClamAV, which will show the contents of clamd.conf (or tell you if it is not properly configured), the contents of freshclam.conf, and display information about software settings, database, platform, and build information. Here is a sample clamconf output: 
$ clamconf

Checking configuration files in /etc/clamav

Config file: clamd.conf
-----------------------
ERROR: Please edit the example config file /etc/clamav/clamd.conf

Config file: freshclam.conf
---------------------------
ERROR: Please edit the example config file /etc/clamav/freshclam.conf

clamav-milter.conf not found

Software settings
-----------------
Version: 0.98.2
Optional features supported: MEMPOOL IPv6 AUTOIT_EA06 BZIP2 RAR JIT

Database information
--------------------
Database directory: /xclam/gcc/release/share/clamav
WARNING: freshclam.conf and clamd.conf point to different database directories
print_dbs: Can't open directory /xclam/gcc/release/share/clamav

Platform information
--------------------
uname: Linux 3.5.0-44-generic #67~precise1-Ubuntu SMP Wed Nov 13 16:20:03 UTC 2013 i686
OS: linux-gnu, ARCH: i386, CPU: i686
Full OS version: Ubuntu 12.04.3 LTS
zlib version: 1.2.3.4 (1.2.3.4), compile flags: 55
Triple: i386-pc-linux-gnu
CPU: i686, Little-endian
platform id: 0x0a114d4d0404060401040604

Build information
-----------------
GNU C: 4.6.4 (4.6.4)
GNU C++: 4.6.4 (4.6.4)
CPPFLAGS:
CFLAGS: -g -O0 -D_LARGEFILE_SOURCE -D_LARGEFILE64_SOURCE
CXXFLAGS:
LDFLAGS:
Configure: '--prefix=/xclam/gcc/release/' '--disable-clamav' '--enable-debug' 'CFLAGS=-g -O0'
sizeof(void*) = 4
Engine flevel: 77, dconf: 77
For more detailed help, type 'man clamconf' or 'clamconf -help'.


Cisco 2018-09-18
usr/doc/clamav-0.100.2/html/node50.html0100644000000000000000000000765113350521603016125 0ustar rootroot Database loading
next up previous contents
Next: Error handling Up: API Previous: Initialization   Contents

Database loading

The following set of functions provides an interface for loading the virus database: 
	const char *cl_retdbdir(void);

	int cl_load(const char *path, struct cl_engine *engine,
		    unsigned int *signo, unsigned int options);
cl_retdbdir() returns the default (hardcoded) path to the directory with ClamAV databases. cl_load() loads a single database file or all databases from a given directory (when path points to a directory). The second argument is used for passing in the pointer to the engine that should be previously allocated with cl_engine_new(). A number of loaded signatures will be added to signo 9. The last argument can pass the following flags:
  • CL_DB_STDOPT
    This is an alias for a recommended set of scan options.
  • CL_DB_PHISHING
    Load phishing signatures.
  • CL_DB_PHISHING_URLS
    Initialize the phishing detection module and load .wdb and .pdb files.
  • CL_DB_PUA
    Load signatures for Potentially Unwanted Applications.
  • CL_DB_OFFICIAL_ONLY
    Only load official signatures from digitally signed databases.
  • CL_DB_BYTECODE
    Load bytecode.
cl_load() returns CL_SUCCESS on success and another code on failure. 
	    ...
	    struct cl_engine *engine;
	    unsigned int sigs = 0;
	    int ret;

	if((ret = cl_init(CL_INIT_DEFAULT)) != CL_SUCCESS) {
	    printf("cl_init() error: %s\n", cl_strerror(ret));
	    return 1;
	}

	if(!(engine = cl_engine_new())) {
	    printf("Can't create new engine\n");
	    return 1;
	}

	ret = cl_load(cl_retdbdir(), engine, &sigs, CL_DB_STDOPT);


Cisco 2018-09-18
usr/doc/clamav-0.100.2/html/node3.html0100644000000000000000000001142113350521603016031 0ustar rootroot Features
next up previous contents
Next: Mailing lists and IRC Up: Introduction Previous: Introduction   Contents

Features

  • Licensed under the GNU General Public License, Version 2
  • POSIX compliant, portable
  • Fast scanning
  • Supports on-access scanning (Linux only)
  • Detects over 1 million viruses, worms and trojans, including Microsoft Office macro viruses, mobile malware, and other threats
  • Built-in bytecode interpreter allows the ClamAV signature writers to create and distribute very complex detection routines and remotely enhance the scanner's functionality
  • Scans within archives and compressed files (also protects against archive bombs), built-in support includes:
    • Zip (including SFX)
    • RAR (including SFX)
    • 7Zip
    • ARJ (including SFX)
    • Tar
    • CPIO
    • Gzip
    • Bzip2
    • DMG
    • IMG
    • ISO 9660
    • PKG
    • HFS+ partition
    • HFSX partition
    • APM disk image
    • GPT disk image
    • MBR disk image
    • XAR
    • XZ
    • MS OLE2
    • MS Cabinet Files (including SFX)
    • MS CHM (Compiled HTML)
    • MS SZDD compression format
    • BinHex
    • SIS (SymbianOS packages)
    • AutoIt
    • InstallShield
  • Supports Portable Executable (32/64-bit) files compressed or obfuscated with:
    • AsPack
    • UPX
    • FSG
    • Petite
    • PeSpin
    • NsPack
    • wwpack32
    • MEW
    • Upack
    • Y0da Cryptor
  • Supports ELF and Mach-O files (both 32- and 64-bit)
  • Supports almost all mail file formats
  • Support for other special files/formats includes:
    • HTML
    • RTF
    • PDF
    • Files encrypted with CryptFF and ScrEnc
    • uuencode
    • TNEF (winmail.dat)
  • Advanced database updater with support for scripted updates, digital signatures and DNS based database version queries

next up previous contents
Next: Mailing lists and IRC Up: Introduction Previous: Introduction   Contents
Cisco 2018-09-18
usr/doc/clamav-0.100.2/html/img2.png0100644000000000000000000006512313350521603015507 0ustar rootrootPNG  IHDR,OTPLTEOLMİA=># ♗^[\{yz2./ȼmjk[[ IDATx}:`ahkl)jIRE}r* M%p.&->~q6> X= }< NXcq| Kd>Lam#naj?'㿾sK~օ[f7D,8!tޒ >fc3.(ƍ<l.:?*S=f_7(D'"xD} 67\9xc؄O"ȇb_&g0oN~ 'HCaH/MCzLq2_2ٸ˝7g& uۜ5ĴAܺ>X]UF@Z1rR3_0؍fRDWBzcqkkp'vMC -Zdw? +i.=x}ݠ6l> GƷ-WVi]h!OmD>Ufko)sO9 *~Hmn*/YA<"%>Kwc?/s4׮22Pù̵]|aW6d3qeC;9^Hw>avGU]dDdIڢeVh''hh̀ACPV5`43//1cLMt /i-|};v+N`ЌnhnzGszँSW~_qb% @|w_~nVJ#[E}|?. z9j+-iIi#$CT<>srmn@ BKC]U# bm%|#m >J]ĈG$7 f|>7۸4pa0+ic-`D#:tr;yafAw]@_P"3/]?'z=iȓAҶ2YHA{q?>\>c+f[ZU\7l/Ȅ.uK\; 3(Wn2Jrªrt|-6q.IoV<ܓƟn쿌.M;y޵xqfhd61~c3d[!nь0U[nn3R® 0VH0Cv{q,!hLxЙ6pXT0Ğ8qf| .i+49^)idV`YkM:D8!z_^zxA5ױ, &e5/.-vDfswq]I{]iڅB|ѷA \d=V{-.Sp |!6ޑFb^.t8)4&jL0w[1x'5&- l%S\{lhoRO>CfEy )G:o]?-pe>\TD)0q֐(Yvrɏdzx^GCr[: t&&THaчI5[܉L!泾.GT/Q +q6Ro7{*-fLƓ1\ wCY^80ϵfA3&̆U q}>ve7{G#^SX"y SmV:!hü9VYqqp1!,P5jIe;dj"蠩[Z txFG6oM{nK >LbGeDazF9=T K s8 5ϱ@l O1M4 6n6Qx0 ny0m3t@N+5""yxaocՉ.VlmX˶s_hZ"Vkd yJ~g6E;& }f3 2'L< u 'W\𵷾eAU_Ppe/g@o:tSMӵ B"%]p3K9s*\NMWa3t=݇]qe֐Z ts>ܣϨ0jNeB| (Áy̯eF;PkɇGk?؇A'j@=f{^DZ-ª9ŋ^ؐzx}HJ~-JڵC}Gz+~M㖣 &JE3|.S,tꭥHe⿮%\;Vd@;l*6q?bS+6WfKP<:88/ҚrP8%+*gp=~E{CfhBe7 {O~aY{5C/6 _h3o3 Jx yx>x޾+A.@Iwcq&c]X:g|ؙ'RYji,^ql0C.$Ʒ;8YcRI NέbGZ{2PH/[ߴ%o'˓Η'/ NOQwSRjEZ?Ld=os/|G[o& x1 p&piNPإCXqSl S͈tiaر|̅‚bfp'#<= @rvX<>_DO!nVpQxYGz{HZ +Pǧ Y w1m5d9%+PU^Niс =,c۰*py$|ub7wylӍN˗w]Y`Ϫɇ=L*}&R 7Ҡ6#%?h:rgյe܄ >^MjdB(J| Q+{t,^g6tېٓ49єny-Q?qAN$:L-ⲣ$3p !wP[lmṔE8Sb;NrAۺd2TѨAL٠ޓPVky $h?& mmi\A).nYYDID: sד| ?XN m)}yM -ى'iІy3ZvZz"ך[앴O&01m$i׳]' v_P x$~dnw '=y \~Q…wBOh AsKװcDVV{q}By#.Xr㍽'|Q0eR:|/\ -KKNvOɎ7$y ]aՅ/wZHijqgr{|Ӥt`7;LNҏv1)$O0}9zeQl_5A#1B]勒{PI7rd0M`ۭଃ7@vBX49qJ^ zy7Z0w{7=L2-baoӍP6TWJ.m}ϡAWIXΌRz]`AD`U5&TTK+ qkP#7(wđ:[;dw h|cmA}Qui-eq3i-r#rD.~@.v]hKY[Tj>u>zEljZIN>r]D ؃e܎ gG&7~qJ^6:jS7Lqa-UMAխljuQR=^fvR"7g*{e@Nحaǻ)1b!:b[Jҵzo.u\&uq~,g])Z>B8v>9:7C Sr7\N];8_3vtN$&lK.5{vӷ=`:gce@x'(q(@i¼gG~3.HW(6Z1n].uxpC36ϓ,gp[OI'q$=ԛɝj@v ĸX# C,4#u'HA2E8/$WK"kA<𪋍R-ykiwFS\xl^N]{."l}:ް(kX9hE<ܱ[Yi:Z9|)Gvn<`@{G2.q'fB'n}|w/|<*YoS;DS:ށ4stwD/AVz$VT&$)>trtv[uI1Q{79W35fdHY؃@g:! $?;rH y[)nUKU[~تK43w]x f&=L'68%3$ԛ9kx1O]sъ(Oz&%{C+ Rç3i +…?Nļ v҂"JR`B_#s.1$8Z'~zoߊw^70g{ėL<Ҵi5AI$%uS]d \@ÑA+fP{aۙW+ RHk8/;S$Q=z 5iº6=l_& 0 I8usZH ŗڇՖE%~{rD}覝/s>%q;*PB RQur9YdZAgd] ~80XBO,?SedpSYbC80"oÜ,,37ddQgvrrG~.?+EZZϞUP]{[25 +G{_KQhMn%,+yAvc]@BVV0(r$ma%U؏f-B{n緉ogV0|8ꂔ ]e@h>t^֐,W=K1uDadγ$ݣ`u|K*# !$=E_ j{ 3Ϙ͋\$ Drg~rsSm>L?@.hC>\;)f_ ˷KǗ ɴXW"_2빟) +(~럢L l4_E"m!0^g pkv' 5)DHkSha7VxNLcKM,jdujh , t&NDty#`yWUJMD~eotAb>QAb.CahedQn d(xR[2FQjIs0W_gaάn `h\"G7$ ]hLn`a9'B}`No$vԂy Pu .0cA꺤d/Ja"œ36`%m Y6 OǀuOq5ͦ݃p-jB26ڃ_SJɱy5U/:\ s8$&p`pܹbg,Y^-2xcoGcCm 1),h88vln-7F|vn(+k#["w662u!ģӉYS4,;qel9:qn=@.\fn7[w?bw4a}iGqFSkݖ5 Yy^;? Y Y Y /-D Jbir+Uy H¤4C76/d&um!X 6ʋ ݊qUY1ѱEoAA8{69TR_≕g,uRљ.,jǒ%(GًKn2h`2!:N!9YZ/|"!(qjU`Ed(Cq\ɢv,ܒ1/NïZ) YdLq&m"gAmn1p*,7(N؍i$yɚ@>[~,-cdpdq?|*ZS[{B"$iQ.Hl]`2iY-GG2u(ۭZ eZKCdw>t@ &6yt IDATA~^`y1gƑAֶcĥQ5Yϸډ'Hg`x3Jp ["  GhpKGceG]pԭ K@-?+qLwDv0s%W]ke,-NJ-7z@kGfgO,`M#w~*ȂEc; J ^iqb7l~؊|aE(IˆsKBE m޵ ɯu#) ?pSٜ3j<!4T\4/c@Pn[0#vrʾqY/j6X[guh6< !H;߁ؽḐy [bǺ7_0a՛*7d\XrFEmcKB[c MK7CA𓰣|VHf!!fpk\'U*iEwţY3Y8@T;E>ҕ"K+ck`\TWpH1 _yI^&ԝ pu';v0'G6Uk*1gAy,-*="cܞd x`r&)ɀO`s0$; 8`p !Yra*ECO\ا˶VJH--Eie ?vdۃ0$HqIo*o QS6-@29ԒI6Y{\HK$6 ҄um!˲›ꃵGHRRoXq ,N X&Myk<,8Pe'$˺s ΰ?ћ&˶⹖൉,Sdet$2d3*EY{3ΔQBUP.b.#L#FrluxIGlБhو@,P^4孿;2 taU:lx5> }KT!KT!KT!KT!KT!KT!KT!KT|%!3yix$٫_Gln"Fߕk=yk34迲FՌnk k2c9.9UBnkJg/]hj>:@&JbSxGDɋp,0-6r"Z>+? `{0'!s{}]vAy*F% ` '6f ϳJdGȁ []@vXz~U;|jZD{ząMrW7dzEbuwJx1RWSC2c-HkN۵,`O߃, TRs6^>6+= 1@*PS=)k}g-COb5_I(-/^@SuH:lQ5/:|$1C>B_4Iz{% ZX^7؈0Pc,>#pEQ4Cv܆w⼖hB6A; Nlĺh*r Y5S1YdS :uc-/6"1xBjp"|BțQ\ m Q0[FqE g[ vnKs cWH, j,l'U%Y8>^[0Lcsb͡iFC0'FT{Aq(y{-ZDɿ,ZkxR,U`dN4L)Z+F϶SNjrEXE "a|3!YʘC5 :}%ڨgP+ =Q6L Y 0wIN0 }+ I (=wIMNI ELW@e@ϛ% cA,؜ºx\bB#5 EZ`Tz T6@bbL^I!V'tzu$^l|}-vsb(-! CVv~:6l$<`&_ gD:qɒ|h8-H"b.?JPZUiy9DB ~~^(THH|<:`Fye1|t) 0Vԫ[H,- JV"#ABЫ88C7d6;c`-9XKpmmUqɳC*gF @!.ÇrNR™:`F_!^8FSVƲ@겇s{St#: "B"[ a֨p F.A wI2ZC&(A4sDl[.&ocF"fq`4;KU 9ZpZc,=:VAሆidd"k 9mDLW:PZ-kFYF:)bc4DhR!%6>Đ%DŽ)8„ndhXY"YЕd k^;"ǦO'H'5t:%1$$K-|%p$E &حS!r I,c^;"7+%Y1D;JJVs(cG.‡=A ?B>4@cZkh ݺ#E-m h !烵{)ڈ ݸ~u6N^[<ކ"w]V&K. wM_ . Y dp/OK. ie@ԊfQ f74gSSᖹHyd#T ạ-;scܫcb%r9`j8o([^~]X~z .$?,°PHH%l h`C,u'klNښwc`G"N-oX"Q&yJqZ2+e?AծƲ~w-r~WH6'A"zCɂCv$.[p۲(I5vb|\f,EɐdQ_Za1FhWF+SJ9Id % ّdI-YL@D̸IY,Ez6dw?dI.X*p# 9YdJD`Ez}a!`رV`G"d)[,3fur㖀+D-wu鄈}iRvBj+R4A dHW--QC][=-?K#'22ė&mS4Rci8k*Ze4XC|MT ӦȲSpJi7 9Y R ` B{Q>YvviB]RjӦmt:6-ȲҴ,XΣcX RALH;$I`=v_Ѡz)J;R=5! =^oFւ(Hɭٖ,!'K^0S."eM7)0y7rCOD0{* xPx9!jd1Ld"˪,z9'>iKO'>]Ow'HamyhnFe STE ,ť~4$ī^dHX=R$Pr=QȈQlg1$E5UAG^Ge^,azXF[>$?)`Pcr?pC n0JXsJ$ȈYS(qC9b52!UT5(YvOMaTQdOdyvN$~*|%(5lr1 ŇjXDGѸjLnɂ^S cJKUbt^;Wd,ݼW+Y[Z\G8 uJ^Sp@30PGH r^ñ&1D-)uLY 96vߤEXߺoy7"p ,h³˭C*i}XSTB>ފ΀JZTF3 jGs7ܢ?KT툏t_t2E-*[UtaNh_-j_PB,tYLG8bᝌ5<s>Hݰ;`4"|bGi EGD'3W,H@d[ڱ[de0AJfc^Ae}O[j Ρ'kxT; 6EG/Gy~kBG3MiǞ*ˀi/TNյ"o"d?^ d}iM= v2'--|A۔~Ql%#1-ZMz!\fxnoy<*=Y[ӱ3 hMdHvҎ3U}޷J؞\TT=$x`;icoA(6aOnDE7wPZ:ښ1lv7ߕ쮯2^8-X*7mێSP<4QaѨ"]+o^.#.D~ɀ2˰+n86;$f@KX lr.B% SK~%tӲf㌍tW@2vt3үRV)5uAWg^AR cgKB05oްNj\y EnzffqWĻH:4'R*R uF(FUFJnM f~Eۙd]}_u{Q VSzQR k30XDWRĢO7c9M U&74/ߡ:ѯ5d##fiy*ڸ%%40}sɧcg( {1Y0 d,&A2 񿕫k-\HX# EYE!kR~%f1"t>&Oȍp! TҍW\+6OR~)f"Y]'LU!3K*\ X“*O>53 @')d" fI f%_Jxצ=Lk!~f)D>*J ƃ'DBξqBO¥dB$<\yG"41I,e;bcY,,@G0fy6kwA fy>l Y*WY5.m(,}>)cݶvJ}諞|xYSN*&T ]gX_.n!&^0Ug1Aӭ_b_IaL)^0ުonߗZtd0 8qY.{/e*%-fILA)(+9"(!&bZg4rfqUί|JYT61 {apKd絍?$Iao&=eTd6{,#vRI(JMvA fyLFaG;؛dUί$lvar {6=Vu]*^LPQ{ѓ?=NvꈦB'd(86i~,jOԾk[RynxY w,Pt#+ Vʏ QY\L|}׫M-a"[lwrf 3GWYK͂YOLU>yʎ7ҏY QRyq &̒y-Pszzۂ޳uДr䵊*+5&E.;2NC4jޛJ*.ȸxܫ(b< "jq*Ą$di-"6u~?$Ɣ$T шS[ Ch!Ȗx&)꺶gb3bRFg((vtD$*IM+`p0H3fhLFP,^ScwDD >4ņo9(2y?Yr,G2gn$)ڗ!z#Y`Yu=gփ~je>]!ĄQ+WlD$7I!HR ӫ ,7Z\Ʃx2^ɨxl FS$\_X H q傆)ܣ!4BfH,l(6H*d22^2HƙY> #kcC֡ 'rDS bkK& ))XrE,uZQA\/ta6%U>Pr%Yd.57+E,2EÉ2^F=Vƫ^ɨ1'd@s.vixS _Ymi<'XT"ea;A+hXMIRdz;E)BXA:xX/{x$#2BxW2L)jqɶ4 bË 91˔36Yа *GJ"gb"uh 4Bfh ,/XdA:֫xXdQ z)0Ih#}mh*r6&H6NE R\,\L"lJ"C.6ū/XA:˨Ĵx+NƋ  C"'yE!W|Z+4j{.}rMbYxo,܆Y+#3y;:M $$»[Ë'%^d4 jYc z H+B{w; %iEO27PR"%B6p6qDf ڡ(7A yF(3NϦCm9*0HD|rK dgUJoi+7̒[p%*9i~4sLeNefI1B,ÍK#?yh%gWe5ӌd6 ڜgR^h[K$2[ =~K[j"IOV, *J#x4sWɉod*ANfP7X@e,}fytZ38K!Rs,5D{~kόYO^#b[ֆ?9Y0\F0w4Sbbɉuf9J$2kS^0Y}ƛi4C6 9e,gY>E5dRfG<Ɋ%QA$?ɩH%J,RDbmL 1eJ'!p Y%])")dyx4_t!V ގqg㱼h_>735_vY ȖY6/=3e?Â@ "ib()#cp<IL4sBE !M?Zl0an,܆ X{xhp3Oƽśa'}8am^v^}.o m(ͯ ) )Y]tNvfupseZ{(PȌ<V=SO&g=RrrH9j-@,/8t?q15|>qz'dQڟpRʤ}1휛1eE),[\ÐǀNtT.#w~y^oU[]4RE]%sx-ske[Zm.GdxWBzqzBfW&̒WO+SeQMxS[m&G.#ҧg~-M6n'4w3:eE9'+fn,%IE!s'6L,#3K^2 Ds̒Bf=f)+fٱ6BuӶ*q7f6Qr0 :esfqwEE%QOb9Jfprf!A$-|k>Y:jp%e-~͙%/wާwj;2Kqwe(o&GNh yyjQU$F\? ylENYYrr{v b[29N̲|xZQZ[H`ٲPۭm= ?۱UZ R`*f2X1;E韌<(/2ڊ"lzŬJQ'}W @#*-C"2?GOi^lgy6AΘ[wXKSC^U_Y{*p9/Y1_HopHEL-1f8QdLgF'f)m+$0n(%Ăesj\ba\ ['LS)wh)$Nf0/,Mۺ luчP1k"  G|[h3d}qecx{CGe%uKkrH#IJUw,7)aW.Orf9x ,|E*>F0_m2cˆ_O5(mKg Bٸ41 >֨" f\0)=jSAz3*eI)E4L,O3&Ue~"Ȃ3K7a5(mKg qfɨYܞjYtp-@̒G.>L2Hɀ0 aT`L=gSsN386?3%7~$U?cW{tc9yЕS?Ҋ0/9ν,֢E] z| hRTpf2W!E$ (ȫ6C0K_K3f15ӥ$bQk?OӺHP?Y˸# XN7"zH<{|ܓEITe|ewVǹe1fNZZL*6w (cۧźN^q_VTFӺYEx_E0 m,An Km22;{lB< xWby GBPOݔuj5\Ubn492?*b|7ޯQ2K ,U*5۸exWbTc1eWS-Xe\`ͫ{֍LxXNX1(Xҟd?·V N+WȢkZ+F1\i4S3MW{GdmYrv5i!Q/_u1.Ǥ1ƝPJ,W.\$n`7$rݿ0._|9"Osmx0!1Koza# ].YP9NBM(7:o?l^;ꓞvz{nnATn̂zI5 ./PT$WRσ S "f|S[}eo1K0Q+1YNFKf1Wm1LsC&Wbgb rb^R>˧|ffR䝚 1w?dT0K*[~z,.#t5$fi2fQ#ikːa[#_ub_,);^H=f*xH}[f)7%!K\>Rb&}kS}xV5t~?cOӖZ*t T"7r c3S&wv;2 M\v9fn=tJڼ$l[J'[QlER敜d$˨wRmDmr}1"ϥan'FDWIENDB`usr/doc/clamav-0.100.2/html/node22.html0100644000000000000000000000642513350521603016122 0ustar rootroot clamav-milter
next up previous contents
Next: Testing Up: Configuration Previous: On-access scanning   Contents


clamav-milter

ClamAV $\ge0.95$ includes a new, redesigned clamav-milter. The most notable difference is that the internal mode has been dropped and now a working clamd companion is required. The second important difference is that now the milter has got its own configuration and log files.

To compile ClamAV with the clamav-milter just run ./configure --enable-milter and make as usual. In order to use the '-enable-milter' option with 'configure', your system MUST have the milter library installed. If you use the '-enable-milter' option without the library being installed, you will most likely see output like this during 'configure': 
        checking for libiconv_open in -liconv... no
        checking for iconv... yes
        checking whether in_port_t is defined... yes
        checking for in_addr_t definition... yes
        checking for mi_stop in -lmilter... no
        checking for library containing strlcpy... no
        checking for mi_stop in -lmilter... no
        configure: error: Cannot find libmilter
At which point the 'configure' script will stop processing.

Please consult your MTA's manual on how to connect ClamAV with the milter.


Cisco 2018-09-18
usr/doc/clamav-0.100.2/html/node23.html0100644000000000000000000000506713350521603016124 0ustar rootroot Testing
next up previous contents
Next: Setting up auto-updating Up: Configuration Previous: clamav-milter   Contents

Testing

Try to scan recursively the source directory: 
	$ clamscan -r -l scan.txt clamav-x.yz
It should find some test files in the clamav-x.yz/test directory. The scan result will be saved in the scan.txt log file 7. To test clamd, start it and use clamdscan (or instead connect directly to its socket and run the SCAN command): 
	$ clamdscan -l scan.txt clamav-x.yz
Please note that the scanned files must be accessible by the user running clamd or you will get an error.


Cisco 2018-09-18
usr/doc/clamav-0.100.2/html/node52.html0100644000000000000000000000463613350521603016127 0ustar rootroot Engine structure
next up previous contents
Next: Limits Up: API Previous: Error handling   Contents

Engine structure

When all required databases are loaded you should prepare the detection engine by calling cl_engine_compile(). In case of failure you should still free the memory allocated to the engine with cl_engine_free(): 
	int cl_engine_compile(struct cl_engine *engine);
In our example: 
	if((ret = cl_engine_compile(engine)) != CL_SUCCESS) {
	    printf("cl_engine_compile() error: %s\n", cl_strerror(ret));
	    cl_engine_free(engine);
	    return 1;
	}


Cisco 2018-09-18
usr/doc/clamav-0.100.2/html/node60.html0100644000000000000000000000526413350521603016124 0ustar rootroot CVD format
next up previous contents
Next: Graphics Up: LibClamAV Previous: Example   Contents

CVD format

CVD (ClamAV Virus Database) is a digitally signed tarball containing one or more databases. The header is a 512-bytes long string with colon separated fields: 
ClamAV-VDB:build time:version:number of signatures:functionality
level required:MD5 checksum:digital signature:builder name:build time (sec)
sigtool --info displays detailed information on CVD files: 
$ sigtool -i daily.cvd 
File: daily.cvd
Build time: 10 Mar 2008 10:45 +0000
Version: 6191
Signatures: 59084
Functionality level: 26
Builder: ccordes
MD5: 6e6e29dae36b4b7315932c921e568330
Digital signature: zz9irc9irupR3z7yX6J+OR6XdFPUat4HIM9ERn3kAcOWpcMFxq
Fs4toG5WJsHda0Jj92IUusZ7wAgYjpai1Nr+jFfXHsJxv0dBkS5/XWMntj0T1ctNgqmiF
+RLU6V0VeTl4Oej3Aya0cVpd9K4XXevEO2eTTvzWNCAq0ZzWNdjc
Verification OK.


Cisco 2018-09-18
usr/doc/clamav-0.100.2/html/node13.html0100644000000000000000000000503413350521603016115 0ustar rootroot Compilation of base package
next up previous contents
Next: Compilation with clamav-milter enabled Up: Installation Previous: Adding new system user   Contents

Compilation of base package

Once you have created the clamav user and group, please extract the archive: 
	$ zcat clamav-x.yz.tar.gz | tar xvf -
	$ cd clamav-x.yz
Assuming you want to install the configuration files in /etc, configure and build the software as follows: 
	$ ./configure --sysconfdir=/etc
	$ make
	$ su -c "make install"
In the last step the software is installed into the /usr/local directory and the config files into /etc. WARNING: Never enable the SUID or SGID bits for Clam AntiVirus binaries.


Cisco 2018-09-18
usr/doc/clamav-0.100.2/html/node15.html0100644000000000000000000000555713350521603016131 0ustar rootroot Using the system LLVM
next up previous contents
Next: Running unit tests Up: Installation Previous: Compilation with clamav-milter enabled   Contents

Using the system LLVM

Some problems have been reported when compiling ClamAV's built-in LLVM with recent C++ compiler releases. These problems may be avoided by installing and using an external LLVM system library. To configure ClamAV to use LLVM that is installed as a system library instead of the built-in LLVM JIT, use following: 
	$ ./configure --with-system-llvm=/myllvm/bin/llvm-config
	$ make
	$ sudo make install
The argument to --with-system-llvm is optional, indicating the path name of the LLVM configuration utility (llvm-config). With no argument to --with-system-llvm, ./configure will search for LLVM in /usr/local/ and then /usr.

Recommended versions of LLVM are 3.2, 3.3, 3.4, 3.5, and 3.6. Some installations have reported problems using earlier LLVM versions. Versions of LLVM beyond 3.6 are not currently supported in ClamAV.


Cisco 2018-09-18
usr/doc/clamav-0.100.2/html/index.html0100644000000000000000000001404513350521603016135 0ustar rootroot clamdoc
next up previous contents
Next: Contents   Contents

Image demon








Clam AntiVirus 0.100.2
User Manual



Cisco 2018-09-18
usr/doc/clamav-0.100.2/html/node2.html0100644000000000000000000000517713350521603016043 0ustar rootroot Introduction
next up previous contents
Next: Features Up: clamdoc Previous: Contents   Contents

Introduction

Clam AntiVirus is an open source (GPL) anti-virus toolkit for UNIX, designed especially for e-mail scanning on mail gateways. It provides a number of utilities including a flexible and scalable multi-threaded daemon, a command line scanner and advanced tool for automatic database updates. The core of the package is an anti-virus engine available in a form of shared library.


Subsections
Cisco 2018-09-18
usr/doc/clamav-0.100.2/html/prev.png0100644000000000000000000000042713350521603015621 0ustar rootrootPNG  IHDR?GT PLTEooo[tRNS@fIDATx= 0 _pFD5K t tޡC)ät-}Y#% 4ҁͥd/v`3 v3tE$S5s}jf/hQ!ە=KV_N8K8!)x'D^K -sNH!%IENDB`usr/doc/clamav-0.100.2/html/node10.html0100644000000000000000000001212613350521603016112 0ustar rootroot Requirements
next up previous contents
Next: Installing on shell account Up: Installation Previous: Installation   Contents


Requirements

The following components are required to compile ClamAV under UNIX: 2
  • zlib and zlib-devel packages
  • openssl version 0.9.8 or higher and libssl-devel packages
  • gcc compiler suite (tested with 2.9x, 3.x and 4.x series)
    If you are compiling with higher optimization levels than the default one (-O2 for gcc), be aware that there have been reports of misoptimizations. The build system of ClamAV only checks for bugs affecting the default settings, it is your responsibility to check that your compiler version doesn't have any bugs.
  • GNU make (gmake)
The following packages are optional but highly recommended:
  • bzip2 and bzip2-devel library
  • libxml2 and libxml2-dev library
  • check unit testing framework 3.
The following packages are optional, but required for bytecode JIT support: 4
  • GCC C and C++ compilers (minimum 4.1.3, recommended 4.3.4 or newer)
    the package for these compilers are usually called: gcc, g++, or gcc-c++. 5
  • OSX Xcode versions prior to 5.0 use a g++ compiler frontend (llvm-gcc) that is not compatible with ClamAV JIT. It is recommended to either compile ClamAV JIT with clang++ or to compile ClamAV without JIT.
  • A supported CPU for the JIT, either of: X86, X86-64, PowerPC, PowerPC64
The following packages are optional, but needed for the JIT unit tests:
  • GNU Make (version 3.79, recommended 3.81)
  • Python (version 2.5.4 or newer), for running the JIT unit tests
The following packages are optional, but required for clamsubmit:
  • libcurl-devel library
  • libjson-c-dev library

next up previous contents
Next: Installing on shell account Up: Installation Previous: Installation   Contents
Cisco 2018-09-18
usr/doc/clamav-0.100.2/html/prev_g.png0100644000000000000000000000043013350521603016121 0ustar rootrootPNG  IHDR?GT PLTEooo+tRNS@fIDATӍ10 EVf`errb1Z&)"{00"4Hϋ/)!CMQ̥RyiJ1&-ǩ\cipo _=}Qީz֧cqp H&eb سd5;~l L^ X(@@;?kPkQ;XEE_TIENDB`usr/doc/clamav-0.100.2/html/node42.html0100644000000000000000000000402413350521603016115 0ustar rootroot Mail files
next up previous contents
Next: Archives and compressed files Up: Supported formats and features Previous: Executables   Contents

Mail files

Libclamav can handle almost every mail file format including TNEF (winmail.dat) attachments.


Cisco 2018-09-18
usr/doc/clamav-0.100.2/html/node17.html0100644000000000000000000000566513350521603016133 0ustar rootroot Reporting a unit test failure bug
next up previous contents
Next: Obtain Latest ClamAV anti-virus Up: Installation Previous: Running unit tests   Contents

Reporting a unit test failure bug

If make check says that some tests failed we encourage you to report a bug on our bugzilla: https://bugzilla.clamav.net. The information we need is:
  • The exact output from make check
  • Output of uname -mrsp
  • your config.log
  • The following files from the unit_tests/ directory:
    • test.log
    • clamscan.log
    • clamdscan.log
  • /tmp/clamd-test.log if it exists
  • where and how you installed the check package
  • Output of pkg-config check --cflags --libs
  • Optionally if valgrind is available on your platform, the output of the following: 
    $ make check
$ CK_FORK=no ./libtool --mode=execute valgrind unit_tests/check_clamav


Cisco 2018-09-18
usr/doc/clamav-0.100.2/html/contents.png0100644000000000000000000000042613350521603016501 0ustar rootrootPNG  IHDRAH PLTEooo[tRNS@fIDATx= 0 _jUTK>Yw:x *VK7Hϟd !xx8!2 *dqM #la"d2ʋz9mٺኝCSr-$𡡗BD`GR wAsV tGIENDB`usr/doc/clamav-0.100.2/html/node8.html0100644000000000000000000000412013350521603016034 0ustar rootroot Binary packages
next up previous contents
Next: Installation Up: Base package Previous: Supported platforms   Contents

Binary packages

You can find the up-to-date list of binary packages at our website: https://www.clamav.net/download.html#otherversions


Cisco 2018-09-18
usr/doc/clamav-0.100.2/html/node55.html0100644000000000000000000001652413350521603016131 0ustar rootroot Data scan functions
next up previous contents
Next: Memory Up: API Previous: Database checks   Contents

Data scan functions

It's possible to scan a file or descriptor using: 
	int cl_scanfile(const char *filename, const char **virname,
	unsigned long int *scanned, const struct cl_engine *engine,
	unsigned int options);

	int cl_scandesc(int desc, const char **virname, unsigned
	long int *scanned, const struct cl_engine *engine,
	unsigned int options);
Both functions will store a virus name under the pointer virname, the virus name is part of the engine structure and must not be released directly. If the third argument (scanned) is not NULL, the functions will increase its value with the size of scanned data (in CL_COUNT_PRECISION units). The last argument (options) specified the scan options and supports the following flags (which can be combined using bit operators):
  • CL_SCAN_STDOPT
    This is an alias for a recommended set of scan options. You should use it to make your software ready for new features in the future versions of libclamav.
  • CL_SCAN_RAW
    Use it alone if you want to disable support for special files.
  • CL_SCAN_ARCHIVE
    This flag enables transparent scanning of various archive formats.
  • CL_SCAN_BLOCKENCRYPTED
    With this flag the library will mark encrypted archives as viruses (Encrypted.Zip, Encrypted.RAR).
  • CL_SCAN_MAIL
    Enable support for mail files.
  • CL_SCAN_OLE2
    Enables support for OLE2 containers (used by MS Office and .msi files).
  • CL_SCAN_PDF
    Enables scanning within PDF files.
  • CL_SCAN_SWF
    Enables scanning within SWF files, notably compressed SWF.
  • CL_SCAN_PE
    This flag enables deep scanning of Portable Executable files and allows libclamav to unpack executables compressed with run-time unpackers.
  • CL_SCAN_ELF
    Enable support for ELF files.
  • CL_SCAN_BLOCKBROKEN
    libclamav will try to detect broken executables and mark them as Broken.Executable.
  • CL_SCAN_HTML
    This flag enables HTML normalisation (including ScrEnc decryption).
  • CL_SCAN_ALGORITHMIC
    Enable algorithmic detection of viruses.
  • CL_SCAN_PHISHING_BLOCKSSL
    Phishing module: always block SSL mismatches in URLs.
  • CL_SCAN_PHISHING_BLOCKCLOAK
    Phishing module: always block cloaked URLs.
  • CL_SCAN_STRUCTURED
    Enable the DLP module which scans for credit card and SSN numbers.
  • CL_SCAN_STRUCTURED_SSN_NORMAL
    Search for SSNs formatted as xx-yy-zzzz.
  • CL_SCAN_STRUCTURED_SSN_STRIPPED
    Search for SSNs formatted as xxyyzzzz.
  • CL_SCAN_PARTIAL_MESSAGE
    Scan RFC1341 messages split over many emails. You will need to periodically clean up $TemporaryDirectory/clamav-partial directory.
  • CL_SCAN_HEURISTIC_PRECEDENCE
    Allow heuristic match to take precedence. When enabled, if a heuristic scan (such as phishingScan) detects a possible virus/phish it will stop scan immediately. Recommended, saves CPU scan-time. When disabled, virus/phish detected by heuristic scans will be reported only at the end of a scan. If an archive contains both a heuristically detected virus/phishing, and a real malware, the real malware will be reported.
  • CL_SCAN_BLOCKMACROS
    OLE2 containers, which contain VBA macros will be marked infected (Heuristics.OLE2.ContainsMacros).
All functions return CL_CLEAN when the file seems clean, CL_VIRUS when a virus is detected and another value on failure. 
	    ...
	    const char *virname;

	if((ret = cl_scanfile("/tmp/test.exe", &virname, NULL, engine,
	CL_SCAN_STDOPT)) == CL_VIRUS) {
	    printf("Virus detected: %s\n", virname);
	} else {
	    printf("No virus detected.\n");
	    if(ret != CL_CLEAN)
	        printf("Error: %s\n", cl_strerror(ret));
	}

next up previous contents
Next: Memory Up: API Previous: Database checks   Contents
Cisco 2018-09-18
usr/doc/clamav-0.100.2/html/img5.png0100644000000000000000000000074613350521603015512 0ustar rootrootPNG  IHDR:#@K40PLTEOLMħA=># ♗^[\{yz2./mjkxqIDAT8R1KP~s lѥ(m?"FTEB 8ة EIb%, BEMh'4vPDww{y d -I:p5?3\y,t,2Xle3Ts \">q.}4ђc]Z@9qOPӈaNL$F O"hĕ+]'~ D CL<}ٗj(&+~lMSA̢ 0Q*;O٫)РbYj U̝TiRюDݾ'BP.C[iZ{F=VTŒƿS~C `IENDB`usr/doc/clamav-0.100.2/html/node11.html0100644000000000000000000000513413350521603016114 0ustar rootroot Installing on shell account
next up previous contents
Next: Adding new system user Up: Installation Previous: Requirements   Contents

Installing on shell account

To install ClamAV locally on an unprivileged shell account you need not create any additional users or groups. Assuming your home directory is /home/gary you should build it as follows: 
	$ ./configure --prefix=/home/gary/clamav --disable-clamav
	$ make; make install
To test your installation execute: 
	$ ~/clamav/bin/freshclam
	$ ~/clamav/bin/clamscan ~
The --disable-clamav switch disables the check for existence of the clamav user and group but clamscan would still require an unprivileged account to work in a superuser mode.


Cisco 2018-09-18
usr/doc/clamav-0.100.2/html/node46.html0100644000000000000000000000416213350521603016124 0ustar rootroot Others
next up previous contents
Next: API Up: Supported formats and features Previous: Data Loss Prevention   Contents

Others

Libclamav can handle various obfuscators, encoders, files vulnerable to security risks such as:
  • JPEG (exploit detection)
  • RIFF (exploit detection)
  • uuencode
  • ScrEnc obfuscation
  • CryptFF


Cisco 2018-09-18
usr/doc/clamav-0.100.2/html/node41.html0100644000000000000000000000457213350521603016124 0ustar rootroot Executables
next up previous contents
Next: Mail files Up: Supported formats and features Previous: Supported formats and features   Contents

Executables

The library has a built-in support for 32- and 64-bit Portable Executable, ELF and Mach-O files. Additionally, it can handle PE files compressed or obfuscated with the following tools:
  • Aspack (2.12)
  • UPX (all versions)
  • FSG (1.3, 1.31, 1.33, 2.0)
  • Petite (2.x)
  • PeSpin (1.1)
  • NsPack
  • wwpack32 (1.20)
  • MEW
  • Upack
  • Y0da Cryptor (1.3)


Cisco 2018-09-18
usr/doc/clamav-0.100.2/html/node53.html0100644000000000000000000000530513350521603016122 0ustar rootroot Limits
next up previous contents
Next: Database checks Up: API Previous: Engine structure   Contents

Limits

When you create a new engine with cl_engine_new(), it will have all internal settings set to default values as recommended by the ClamAV authors. It's possible to check and modify the values (numerical and strings) using the following set of functions: 
int cl_engine_set_num(struct cl_engine *engine,
  enum cl_engine_field field, long long num);

long long cl_engine_get_num(const struct cl_engine *engine,
  enum cl_engine_field field, int *err);

int cl_engine_set_str(struct cl_engine *engine,
  enum cl_engine_field field, const char *str);

const char *cl_engine_get_str(const struct cl_engine *engine,
  enum cl_engine_field field, int *err);
Please don't modify the default values unless you know what you're doing. Refer to the ClamAV sources (clamscan, clamd) for examples.


Cisco 2018-09-18
usr/doc/clamav-0.100.2/html/clam.png0100644000000000000000000031440713350521603015567 0ustar rootrootPNG  IHDRWQO yR pHYsddIDATxymYUc̹}W**hA%1]/I_1QƨbEAOv9sBnq>S瞳Zk9hز-۲K-۲-{m lٖ]l.u[emy-۲Kݶm٥n[^`˶R-/e[vۖز-m lٖ]l.u[emy-۲Kݶm٥n[^`˶R-/e[vۖز-m lٖ]l.u[emy-۲Kݶm٥n[^`˶R-/e[vۖز-m lٖ]l.u[emy-۲Kݶm٥n[^`˶R7\_TYODmٖ7\+{˦MU-?e_ۊZSpNI8-ge?cYD'VTA#PDhF>_߲-B%&w<9WT@ "JByU';PPi9l˾vy{'9~BQ5pAJ"c3 DP_Gğu[ %&G"بT{Hs&q `P0D FNCZiszC@ ?ʘC^as "\ A<3ls95 '6 T}qG}qDZy>{^fQ UGGXՋVğ*d Y.TI+%Pe]&PX(v|Sw 2hGx UPǭl JL``@R N] ~*7MZ1M0HM?!QHAϘՔ]_C>o-lKǞ^5їïB=4__S(S=G( q3ԫ:d~CXa2u  3 @ tQ}u81ԯ""d`60=VB2l;ܛMv%TȴBݦOPq )1'ٗOG~TW y&@sRꄢ:^e _KH EfBA>  T6XTJUd́ qď՝|leD&%2q H^@'HyӃ΃ZL9..qjpd,ZY`W}5طk>P# )S6 (4تRԵRQU,(%ʈEQ]6+UK'(ԛr0QF$C0](%؃ xfx:UB*}mGKYH_Pb UPD JTJu5HҢôU_T lÒy;h@B cmVP~DjT9!PWc>Oi0fӏs(YUBCϢгw:ptn!3Ovޗghy<Bu}T+U_7cӁ켔1UBsA/ιQ). Te2X 3;Dд^@ @<] !Jp VQ-j((@f?bTu+t5?\\ÍJM:6qOT- ԓS MP6jM%`$T>?&Çd<䇏[{"ц-I@DUR R%CZND %uxlF!%C (HY$}VP288z0),S%XqhiqLPM@& \B8K?QSVD8#a7>G{d|4vRc,M$ն_jJjL:NHqfd!C1(xGD`A $j8aGo/#{f @p.焨2(.hY%QkL` S޹2xR=:c2gD)_<) @5PT="n_%wSJ_ 3Pē&jZ(x L(RB< ZGQchʀgAnƋ}onEmC/;[0:6!H)}cM D&t EV0:o. *!S!π{Ds\] bi"zJ P TU+R HyX !V(S͍w@iG1$#ժ>=4V>T@L=BHlAQ8+T N e 4/5؀!\F]1 ^falf-č)&H.eCd[ـ^.P 6DVc.zRwu]<5nR?VGiA@@-Ҧv}"g\": ^aon+eJu^sYU-2@  !HUTAݭ!w(s*x|+YBX8J0^.#@KCWA%jdX%7kL*?jE:@AD 䇏{.|5hPQ*TwB8@jt  s$ zE;F)QJwNN 8#jКXU)ɾp@)s~uLJ "Kl&0&u"-}rkTpLdl r=VI3}40Jy֯}XU#Q584%Lg:E Ƿe=@МWU6!E4@I3,ytz "#2Pj1@8%nw"pJLUdPz0L{33lwA(2`KFrq `DM}18eΈLGF`|IecTLFp ?~Z Lh[?Y-w$"@kڧ-N~q=ʧT Z3ebϛNNX"~,T 4 x FJZ -_L@f;yP"|ZԌcFhd#3dfZ"n]P8T?v'ȆXd)|,0LZ7l,aGMZ(TUA6!#BXa!%'%?NfVH}DUwOmDvQS{d{4-Dg舌OhDZmfF;sP-yR:R6RT|($q'M;J%WxqC47; q[BUBQĞ( 2~"[{P5J*874ٝ{JAD ` Y4\7#_7qNG6h CHC0ĉŝk|q`ҟod2vË"(YR+l'Q5hLv'%0e)Z !deu-B2Tr)DkD,T@DMDYSNdA 7L q2$Z9u}2/%2KkB#,jvNi>Zd@B(v^Zt|Z S۶0H]^ :ȓ! ~JPZS }[0a43 J@v77:-̿AԨQPN%8 gv 3 Գ%٫&`a:D-{Ss4c9 %?Ǘ@g9P&Qm8Q_pzDGq U {e\=m/?Dq"Z*Q(%2}?]>_X^ݒIWBM0ȏ[C ra X("QR>VMD J)(ơfKhY6 H ʈ{v&hrMzRlMp!IdC2$ȫ:(޴IO)PsW$anDJ X ';g/UJ6ud0H/63}Bӿ}!%(aD`@Dd#bmIs6g 5䰥n𥲋 d_ժ)',j~A%pIK >T"`C R t#+9QZp EEJٴ(24|q7B0mqhIuxxN. @#Qz1Rnt/ƏEfWHH")"RH#!vl8*~~3Gɂ<6M*jb1)Eu )T2Ug2:^.׋.B/}ꆟgg@*5 RM j@i7{^Qr;BqȓAd2愍5 j i-P_WJd0 T`[W>Ch50QPBb &#HR~"4cwR)S$תi0&n+,%೟>S?hT~_?ps5 6%jU(X^T~35j>H#'81RI6X$quh Q€-W?Yӹ^ehH3?x}FЫ#N6> xq/q}ᩆPNj 7 'YvUBLoSqDLͻgP[ l@JY PUhQG!SATFDC C,wA,MSԏZdg{K +Kd7ÓPhLGX'JR #R٪PfLV^ h)ET@L e%CUF5SIq WI*Q,Zۜ&"qUTV.PG цWC2Z26TFS?ק9V7[:Q UԓB[JT*eTJ&2RIɴ@ "FXBKL b^N}%@Jʊc~||49J`SRP'යJa84p)r jR(5@Qz&Egm0[LսZfqK./P3",%Hu -(jEf~F4NХ $mfVˤn׺ NdeX 4-_#BELDQ@:\=Zϋl@2TTdwLiƞS*"^TC*yE%t| %>5ɰ UTg05&5\!pC$oֽf#$ #8igoNv{Ti Pk7wAmH%∹.PeR=Fc4p|~.vuL9zOzA_v1Aro* AV* BH)hjICYՏ8EfG, AD5vYbP*4MX)@UN*di[J CTo[c3OqZIa :岧 ĬűЊa2Ya'TLt湽c6.aɴZ.2 9S ŴvPSW0'"ΏL{_bS!88'qXxApK hhS ^HLBR5ѐ54GDp*'!*ap`c8) ?9XGcs<ȚJ1;W>pj>rcMbӱMR)ug +UQ=!Ȃ3H:a4dj}T@<㘣ZA(ar"24⧋Sq:Ǒ !J=K19qKM*UY"GrP6H">ѼwD@ɶ/q}2|9jp;s'&ۮR4'V Qn4YO[Ŀ.B/(ExV7"ZĽXf6X z`ԺP'v1,IpcO :<'N?dso~ߍ91f'?S+tNNss6@oϞށsyeuw&JK +uAa2mD " R C wDJQ("u 8HR!Zm@ 23dS`Z-DpBtOio*U$9P"@$K<%I_ʧeK(? WϹԤe}EHÜWJi#*s) 'WPWCi2YyypC>yk̙|8NbVo a$P#|I#.-g8W23居m˯oZ~OIL31>*3 ,JAU PˌaR7P) eS7n )7X6 s,dLIOő8P_)mJ6w`ptPL{gDXsSn)@tFU[Z Wb. @sh`D@S(T a7EA)$m @rL~xϜwgV,% RneȪ^Ή@H+tC @Mb0ab 3r?U_+_{šCz7ہZijA 0>[<1 5RJDF+TIɶDDx;j^Pƒ]qpB)٨Kb"(+v (āS\(PSJ(LkQ|98/TSttqWW&3EW\IgGҚk<A L C üк=IrԏxzjeQiYKy7~^{ɍӧG3i³n`^;u+J`ivIgZN&WQWa?/j4q5b\: fNfG"=xϥl]s5F}|@Q3X0 !TIR( 3 X qX &l)'}4D6TGD^d(Y`(8~kP] B`RB)2&/զIg뤇g_l}aF]LƜVUQ6}һVi[ Ej |Vu찆Cu}[!0@Q5 V[;յ]y >?,1UAUQdZbof3sfۮ{w_ca{om3g?/}Ս/Է-/ |X,X]=_9trm`c<7eP&v{y/;tHo*{ٞ}C W@X,6*$df0nX4/#R;n\H 8Q_@Ykqq X䄳d+ V)>d{AB'Rc(؀-TvL86}.el6l lT]Tx46Zye)]I0>l8_= L1F:n!в2G I@PyI:]rN~|?t?Oϝh+^@E|,͎ڷm;v͵gZiu3c%!>Wne;s0UQGE>*7lX>sǟ<{ftۡFƗ_wyӛgf)ŹzPS~ +#4!mxF%&`pe6!cP%1)5>skgvS\]1' AeCB xrMHPU)'c_8Vpc G l`9X{Ф=ڱζ+ς2j~` `T6x0̉ !㺫|~KJ 76!N?{C&I83Fޫ(M}r\mlJE%e596, &k,CD^KRugڳ ˮN#?''VV7QE`6$pN}|1}x/\X#&nG|9S YNp*dU;ԑ pkw RWs"9=ʀIa2JH$~ )`BB9bDNgT}i;{j9#æpO5I̾S M}Y yIt\!%&jY<՚O~3$v&]>~Wg5UASEwuze?q=x'$1~_~Kom̶v)"8@ڞ,q $a^(|G\+E,v8F Dpam0BhKA6cj5 hWؒBE6\ŃLR8m۴4UWėFEBIp6l2*o*GkIG+pY\iRkI; Mq,/J>Z\cw~i?|y丶WnE_{ od!QCNf8QÑEӄ)^MКDDxZz+)EJU2u85 &,v^Z[Vnshd׾X^ph?#}t}m3i+DGo|Ӈ^҅W~neTʍU3&dvL*.V*TKT%i%ം!~%ݝQ T7ٶzOv2i=Ȥ +p`ŤVoɇ+gqeI/? 59z1bT5yAU|{{]oޯ:|Pa6EIa @wU Ϻ |柢Czòn~TI^S4-mB+*: e,SILv`/s >Ϝ; kl^w`3W夤Պ.:Hr (z1,RswEL~3AjnXC,.;$ab/E)(Ǡ*iZ?hj"f! !E?8:8}AC&/&bKm}$NĦYg\Sؼ@(AV q/XB5n:DԜa.+L>N21^5 p#^u/ܟ܀,fr]w_}gxvZm(nOI"i.Pl8Cd[D6Q9H8/PS9#t9B!el NPYڮޗp# H7D*?VdȤ%kIU鋍 FXnJRwȔj큈# Wy\>\[;.se"b;X=65+1j`OE`ԅJ$e-Kmy/v_W]knʺi<˪TzI`"QeU4Q6Դ%ÕϙMv ?P@Tl+IRC^^O$ 2Kۻ*\zCaZrX8Kte7zVN[k[?}~Eۤ P ә3BBDZB* ⬹zx **XB$jʴi(Q&qCFE Ppң>O䫁x* w!yׇo;$IrƜ•x `WkGO'Q܀xv5gm;2CW+'yhޟI@_$F*7_W_.O/>Z){y~x+|AUռұJ4 CZcH <WU Ȩ/g-ȅZĪ u/ad`w w#"UH^"܈:{m-L10 3U1V\B(bDhg?Nf9o__qŋ`&C;zi+ʫaЖiPRaHEH%`\ d&\]DL]G5-V߀ S LyL'ĐaV?h=wc72^PJmg~߇ݟ^9EeEGȇ?]f+ *1 c(!;Ն L'HfdiE:h oL *^}I&kYs#UTE)!J bdj_89!UU2`+|-a^ V]1N8Udp Jl8I{Ik<_9urW(N)m6ӵ࢈{X꼨sYoϧʠ<$wWmn Xж:6|67׈cy%qRĉ ~dCn\jt05TBٚD yQ/u~=}hKMjP cPc"0Ɏ_}e/3.y?'{ s|w@D ?oe!($r˕OTKā_0@u* &j*Cj iTv/j~ 'uԫ*51 6nv*tT *&#DLlؤUْ+Fލc7"~ 2i$-mqh>\m#B6V= &rip7A)ϗQo4ΟtWN( ۶ogo};^kRK" ֱ%IдCXP@ʡL@bFUN!c!J M\ꗨuBb-n'!K EèQ("P\jC'K_J\5jP|jetQ(0KD& lSclҰW.@au05Mso e8\?-#ED`3Iq ."/ *֚};Z$ _t-Y7o扡Բ!UgIm8`SHDj(z kjX%Ur♨ /1;"$kruPg.evӬmByb5P G :xh&څ`k i2aPH$3aA3DNUVM/ڛީ纭1m?p?;F BW]#H `XuUf30-2GHf)UhjF.I8PR֮[nRgj*L r`m&mp]k1\ql=d 1`6ȐNz٦㧟+^ 9)!+qzxqs"J~|wŤޫu/Ni9,p!*eäԒ!r bV"rB^HN5*`"6jؚ$*lRٍbo?'CO> gium33 lk~:v,ʋ/JUnEfrki̓bTO`72acTEMUs2f9U '₡_!茁"ƤݬUʋضkBQTF HASlRQSߕv^]!Paڛa@ = 1q,I%w?g?ieկI'u- W,sfXU@"aJQ&IRDՄj {J9'x3O;}16玟{ӓ"``-neu: l7Tx6yr4B-͸kbURok[&9xؐ^}~&ihjT)sp1\nu@]' c1TV)!NݘLFJtBA{#UxZ7Y8c54lllRm? 4(W_ ԈBG8U]Ig)(GO4*1E<5$话2Iۮy5۞Y46Se>׌MҬΉ ='~8 h3>C?G fW}q Cv‰akr+%kB@>DJƕlދN3C5Y7-^>|bc'WOlloyIdX9VL%ֶy>flonf;~pvzOҲ$^$@u^7nmW\u~*P Di'ܲƲț]$5,J u k/W?qv8WJ]woZnhM>g J! ED"H#󃓦-ѺOP?2B|',*llZz) q+ƴFĩi&iRx )]9tȻ$M 5NtFwn_֚H%Xkggw+6I-kۂ'൶}ιJj*@xij/?穝1ָy+{ǫüHR{PV%tJ]ۯnk'IU}g@12s-~)Ǘ?{?٢*RJ[@:NÊq+Mm %(:ߜs|g*PDѲMy- H\">C,6cx١'{|Yҕ>Wq}cgZ j_ DI]gPi I&60V~q5 -N|$oPT"_ fƌ:(%D+WRdJp;[|ZPUW]U+"k%x/*0ǨFyUyؤ+ *acD[hۀ`M4j^w uyY-ݷ2(+6-E&2@S3AbSz:c% ָ?ç[/9tSx!P; >ZQ%L @ ᶥvfw6ͧ8,1>2?민SP== ƙTX"2|Ż\ugzY jjӍk{U#<62UU9d3xWcQHs4  0;"/UDU;PF'"bC! pMU1* t(y*vVm 2. M!0Bۼw(6F?؈, 2sǗ=8֐5v|7|mžicyX=f0BD E6S?__O>u ܩLU`u$]ꏓ(ed'o{rdw#9'Ļ(&a iD>Uq"qYՈC6Li/λmz2[QA BN|_t^곺:?THUҽ _9o ۺ ^y vSr<ʆi|t1.G֏55_u J O&ruy'ɴÇ3/_sŎn0<1A5}D5X.A0vJ) zvej"S,~tkW(a؀dj|?ꥢ@чzU@D&Sͣt?!0:m.֨:UHB#:q+V) r/ $UWH{W '-"QiD f6mj띫)*] LS J 0MgW:AI yܹ)l'>ӾD^`5g>^njU7rG[yÑѤ/w`>UCAko3W;u̙#D&awӘ(\Y׽5Z?Ԝ&h6wQS."*g*'zBt5@NM@ٹ{኿yG2V'6a'cn%jQh剸ة+ӟuȄ^ԗR|Y}˓zCl&I֚=]O KKUvv_qG{~h")Ġ>`P*t8@:G ͣj0  QqU8OL  06@l,Y:DfY׻tP绌/}bD4IRUx՛%W^S2Nw+[55_}>A]1.0H?wZ縝)@0p MV1b ` ȼ}om*_x,5wcrbXHuFp޶G!r莪TafDUC?^U_S鄭/a`CMI|j.W u}3n1YqeK,">}5.MWpS#L7}XiL*W]-F^)XnN?֧ʱM{{2gP'1ީwe97y߹ʕJ_,D Rl,~Ȁ*XT!"6"3N!a}rYMu,S5&(g(Oω#WQ7~?g@/i+CRCLpҫ=c} !B r+O.W3\PBZU+q  :3l,锁~M^_&UQO/;ORUl"Z(Uc>("Jl@PbJ,n >ү+&eF;"I䛌 O!tPJlceSpHTR4 yus~Q}%jT0 q~ug5X(1_ /*>pĻ_)Ũn+sn+D&֗Nn5I8&0!k A|N L|]` ~IMWEhb`̦NG㲚_ `1'8yY&nʳD^qV(YZp,po?XFcKuAM;pjח",%`},.0M/L 'eff9xX\^qud-Kv$j@RNE@ `zjH,ؐ%≬UWlkOO+6#݁9/a `U@}hZ> D֍ZV~_Í Y<6B6[@FUD*Fgy罨iTIq~`jkL Y<h'|q??.5acp;ᵱ$|!8X I:I5xӫa+8ngL˾u7هN&|glk9~chu7ky`yys8cqȰ1`~N")TNs8{[^>IL2>`B+hM7<MJuKi2sǿ $NZ@!^h~5S+DJK}h@89ۙ6A cP$zʉVaZ R5I7E\`4B)u{qȕ} A=L1yU1V\YH4pi 52n]7{7]UV>$HƳ2zE1XfDcZ8ﵟȣq}e7;J7![FY4N ٙTLixXFK`)_CtTk̇JJ!V$0:6KUW T+`#L̢q1@'RRĢ+dsͶ.*UD1Ert'w^Փp,SԬ)Sվ^hD4Oo|(ea^\🽱(*Wy6>$%/K.Fpf1: _$XORgܪzx+w{]Cۭղ吙]1Tj5Ʋ5Ɂw8\{jGN~OW,5^ψ (A,@ Y;AW})5x* 6k{W:I£<}ζ^ P;@54T ᢽ`cj$h}ĉ-OޓΜy n IQ8X%4uWUQ}+2-2Gdl&Uoq(GU=$U%c t3i>B}YVx<;};]Y]lȸCY{_X@=KM"oz+_{#'&,sDb2bxQx.U[>Z Xը ]-u f֎s C_Wr'm Tԫ_zV˖9M]{l髮/閫>q#SƒM0נ TP@/\ت5FES[9ݽ! fTA&$L:aׄn~c'K%?]ym 411M :7hv(\5ۀ;F@AV\)*׏N&I~db@x 2uKdΕ`=@%1Ŝ M(E\>X-󾪀1ƦbKS+bTSO=v"qTAjwN&_N LW>Hvw2Vg0Pֶu[9.@a1Nx׳~LϘ*MUͫ@wl7Z Qj6MVf  2h7ėݚY8@Fp8W:܉H7ĝ]!$w(xʑLf?N߸=0 zMS AjVCY^rwț;~W&w?k۝UA8C)ҡzZb| HS(Z CYNXTd$$_?RV9m/vɴj9 $;%xF쏡:0gwQ9pUBf֪p9D 6ؘԘM(13Ijlze>x=ƣßݹ=+ċ*k&e>Lϗ,"xf߉~,37~㭋;fq<=^fA)jKUT+'WGpB5X)DJ{O7,Ztm;ggf;/jTm"xzheAauwFi;cV"8';6hv5^xw?O(Ä:& z~hi4%w}돾-P'KH2:M‡=ȫ5'vj>)|\2.0 w :V"?kq "KdfZk IMVFa P_ Ѫmͳu\"BTBR A@5l#"jl6ĆY;M*e1W 2d͇6&i(@>ʼ,"e>Rq[yuڝmӬG e-"`z{DXPT_Ug H+4!BMb>wȹ$K,NгnGI,qn zU,=p΅3eB]$ GO?'|UV{`>y3`${{}ߧ 0@Bo~oCyˮvpW+ WMowG)^S>S HloJvc8DD AMpS';d4zr;V/J(GiD"h_@~EU'"ث*%ö+./gl{fĬ*^|Q0aqTŕnqUacSec[d:=Q T`lD0Ijl^sd5&5& )U(e>Rb;6O8z;\ܮ, 'ju<973o{Ž^}lW=j<߲LpEZWĔon4݇BJtV3YqG;ٶcfm=6̫Xb(7˿C?ȧITTa # ^8aаv"ȣTw'gm/=7tdv90 w~㏿Sfxxw]]k:u}R;눂{^wT%${3~'WPP1TQUv/|/X as݁?ǰ?Bq3 F0d# E0Hf$"J%(7T"7CR7\10I* DQ/vڈ9!CT BfohÚI{Θ$bDʉQ Qscm%1s@Y.nTUS+ VGhovG-94_3*p O%/I | KVUe _}ȫPLWGZ2 yTbYW(5E Jh'+z壛q%wBw{tLd Uxþ*o7;@>?Z/K[k~gO(*zoX<ʪtn\Uy~ya__oqF"ιwfZozˮ?KmWnFYmVƃMn<.'N /~v&'E-dCm1@c\>?^$F]֐iCM)Tkfbtn "^|vs= fr8)rllFLltx$$|Ex*=t΁M FA Z6P  Egb1l@Zr<& x9I|<QdD\<ž HHh&}2Dlfz<ibڳgU3smW 3=kCJnbD2|=8DRT'T&8eZzߵt[tg=ܻ0…pKTrs7n߽\WU玍ժ:2-Ű(I$>rך4%QY]rOw7eyzrB8Qɨsȹ8pq&4|E$C1}p1._oU)9yo/oC "nc\ j4r &W;U<Ȉ/塁 N &50A|u=EDd$C+uUOLe>ڳWӇ?v4(XEŻrcxY v$ec_ sb "fVbvȝ֦"ＯD1Il76WOl;(3 DXLuK5eALD&}gNo[^r5臭VZX"IhGϖ^ a61^L'(y/RxO=gI޸;(`i߻qX9diz_u/W^~=Z6.@ u[<ۻ}ay}s4YZ窥~{?󵕬ׅsְ/= E1(͒7T ~P*RE mNUGWoڹR=2޹uIӏ=׿M͍OY=:^A>URpAdꝕ u>;^y1}@YLh6"efq}ܵ\~iUJ|Uf S70^d*)NP/QnJdlnG+\WӟuexigN$m@:\ƀQ!ժV[.mmWٴElBϓʇ Ym"Ga"*Y6@ELe6!bcx} 2){dPJ1<w}$Ţ^~u/ʪt:7D:6/Fe6k>] /RWu*Hؔ2J,/yS'BnY1? 3pΤ)s + u.`e"CRDhϘng%=8z~P?ǛE/AΖ d\˟_OF+h<*{jmċC!IBu.^zO,l>{ݱ:ۨ[.c4dɴ 6**>b ʾ'q@8a۞4WrlƙwVm )ƾPz,_ )3A`|{eWl􍝄2gĒJ~3%ggۢ~GڗPYD dJ sOM6 ؒdTJ eWUQ6*ͫ&l͑(þUyynfCC"~ڄC/Pi,klڙiϖM(F@T|@djLTzlxBfXpaR=ll1*%itmWA* "h-4wvRc2fZZʯ%Tt/[E/h'\x)'"WJWFJ٫:@$ 7h8;fgwzvJ4* b}،f2~DaT8e`xVvS}^HmUƖޏ|x6ʷ]~m Bi)MIO}~<3Oh̀exi*+cX\*Fo"'J ׀ẇqI Eo^h"5R)V + ؎Or[TX 5E7C;=O[%qp㜈DpwNUf^r̵/D,e$ %@cyB:r ӏŨ,G*.۳/Զ y~&R1|ˮܱ{,եdǕJ1ügğVj oTN5eV ,Kd[Yሌ0Mk04j ]zQy~l}#N߿Q0eq9˲,jXxg^~;ntԔ 切a9iSHvJ 0.!kK];gKK!GgFybJ6VD.B_NgU0ToPe,@x} /VЍ")RDJ$J$a|#[o1)}Kδ~>\x4&O7 ZTU]iN b A4o!1m4lb#U +;ɱt>ywq 5Ʃ2bӚ'_Y3["'2B_{{z?wuH/$G "=k@dqޱpt`;9q⁣%{ʩ<*Om<9Z0!DMQQ2hOF(娓(~ˆHU>*(Ϥ*"ц+$Z"$$zhH|5NLJdwڶd8F,og ZP̘]~UUlc i#D&!1\"k˗z[tOo4vZ;b; I]PbÇ^njK7z:b|_#+ nm~\jIdƿPlK)EԩzPCQh$t~@8[^$zvwt$vr/EJDȗOno?f^ aF=fǜw*b)J~uE6>9PD2?/<6Zy v1:jrm Hw}uz_hx G*MH&Bh)C(z2@UAZcQǢP-~p0IMR9$guE*O&H/U*sMkѶi*d*򲪲ppݨ[_6& c+LB"pȗ: }Y[t㑻 |oW/b<IDATHQ埐kKu0UdϝIt~Yf9J+PhV Q+~ #JuUU  J2] (& @Fؼd"=/x@ѻዏʅg?AdMY6mT^C՗#ڻ=n+4Ŗ0]~k}q{sTC *X&"2mGa? @F'ajl**5Q`򥍳g::;{g'"r;&61[Rl]fm/%uC2I"A48U*YYk DK_z GcPwwRz:hQc- XJU*cї5ہ"Ez'O {[m+Xx kߑWd/~ܠ?rT?Aw_As?DaNgڍS8ݧ?b%RJZrL&ǝjMľen烂Fo M:jCY6NċRfJںjpc_ 6WΟ~wQEUAј;wlNDUB(6 z;FU%dY#2̱88W֮@Su Y9͛y&26Iب5 , Xڪz6 MV|m_^D;7*< Kaηϛks(ľ8)_trk sȽw(IiP%á"jPu^!ϲ"b!} W&&RQ"CMt'"qaE食ܸxiecj F** no}5%DpoUU8(f@[g~_HIIԘ:mQC1\j dDds!$K`*IC843w>vw^#ZET8WxWn^ Dd[Y"k,I$d eW=.ITK  , TT9$^+^}?)h''O.]8X,Y<2"_C7V LݝoR~Kg{nc|3LSXxEDDin2Il;M9_pramEk#;HYUqrcR\s,*Ӹ\m=ۻCizyEFQO^}[f?h$_-;s5h"b:iiyy򚵄2V/AP44w %ifӑ?g;R\ɻ@5H(&d֔xϢJ`?rVcFӐ%VDՈ$2Y֚AJdd&h{<؈N5U@cF$p{f5bCQ O4#&;y8TqA%xL ٜ̾$B 2zX_}i-ͼƈSxv4ZOb2Ϯ1kןY:p '+N3tcϾ\Cov/ɐ/?J&*jN>ęG8}pa=X݇<ϡyy}mSӧt4B"J>I>?yi?s~={ ?}GOp@:"]8s2A %70<cژ&\@ÕνOaPPA@H&vPvCJAmIHD@[*뀤TWm`IUkE@)IWc$*栊ͫnvfh1܊"Bh'i3;l|jv})/!+ώGlY$?50m4 CD(¨Zoogͼf ^U )yC,]|a~{OxDA(EDa2Qw~5 _@epa0K{8͎ Q{䓧Nc|UCooGN{?O?O~?,9,CsUAD%VT󗶫6{"BD2hEf_X5@* 5,T&?DLoпW4:ۈ&Yr۽Gb*DwEpJos@`&A˸OXXEvR7">u>|/%CҤ@5qXIl6F G`t$ˤBI)oB*4QI[hR *,PY`4@d<..(?v QB714Z3}XMO"7Ϻb Bd&T$i63w\9Ѱ_fМefgjsժmo, if,oW04C. -!;O&FJ7KC$*fz۝_hfxvų#rk>P =853p[pxB4{CْHd{07bf[<fd@}D O>yq{kl 9Ӎ;9Jo,SW#+.k>vbaf [S?g~ `\닂E|2! zIyW~h(xu%;/x' "~Tk9D= p!ĠH)R|?|XB q{܇>;K?{fXf;{ *^~N `kF\I?(^CDY>Q|erN8*n #AAE0Q26߃c쥠*% *Җͧj/5UDJX"4a*n,|I6$@$@ʚS"(B~ͦozOw`B652*3fkzvs瞋$9+q6j 3ҥSflޕFېETf: 3l vD2 <=儺1i~ ݁ 5Xֆ S3ta m7I\JRQSWϟKg:-Q1{;?|i>Po{Ex MƝwtM_,ޫs>WBD?+@fѴo}?x{ޓ/,\4{-5^N `п䗴&YrCf|sR]S_Ѡ$Y$DT"knd (,㔧Za~T)Wn(LڙfBpbMPK)m^ P 4 QU4ɪ>VobD.I+RD$ML"h[lMzEP/:lr7 ~AԀHb/T-@ta:=E0DIS3#=ιێU`!$c*=~E:H&ML4Mjc2 @ %aa D|U4<2]) Bٯ TLӈ4?*rFP%h|J L2^nDI.!@wb,"*ըthOm":[=GpX`Udfi*daTeVJٚNF/2֦Y#6 psme1[xjecs|u_{|V֖±5Um3_X['4R3^,=J Sn9*՚L$FkN ^@EP<xWP%3Yy{Ux4]/jm"iczv? "P_( *\8"4#uai0XZ25sHػr5U"dR_: puP4@p 廉@TG3onwzZ2?yS_aYYjS n~$Eo80ڸ,/N}7<Pfo'Ҿ֐ $*..0g㱟IKF`,Pt$&(@Fp/۸j5&iӐ5hUd4fVmJ <̫W_2Iս _ܗ?r՝L/B" O?TA"UI&)\>jcMX4rYj jTc`.qYN6ع%"pjmw[Zs+֖wf3GiWzL@b9GFUOvN* FrcMR(dnsj! >K=(/sK4 a͙$/WMZtx[O1ILUS ߾x$2Q̹b`;ov{7lMIiH̘D.yq{k+oAHD՗8" **U=A @ݡf7&Ghw/_$X:&(dML 2rߍ^!pg95N!WlJVک2MBY L :J^M`pb(__yB L\m/~K Lr;9p|vFZhkFs?ڜi50J>yJWdDn9ZOFtf5n3i禙E$k[Fn A`%`"]Z LN6=*B(F(( ElfUM/ L&%IU+T0Fsδ9SDWQ$M2I,ⰰ3{0IU=1m,C4&yd #IPUDSqTz[+e1,6/*UUCIBp #,"E*A6g)Y xsGqಔ4t\W/6ޫwLM0#ɸ҃X3һ4 P̠;U)"c_Z f1|w/Mfv.Zxm{@{Z]g@QHY9cB5D+x &$Kx4(!H`fE , B eF,QY3p`]G 4fWH \TL7Q9K?ET/k Ƥ͙,[W9xL?bFI` ps$ J(ɀ $L=eMa]k9QbjRMfFDNr [KW.̊0t&ЈpM"HYTħ=DM| +| I vC 5xL5ĺ^qepe0D&^HdPEftL:sEFtM<5]Ee$񥋫5E흟hi@x*,?ey#BP?;'.N4,<+zЅ`E$oV^8~'NP$wv[E._Y%C1A@4MY%hB @h 1"!B@,8+E"'B0 ap fbr+F PbuM닉~}ŕCUET(huU@aꋽdREhFV@-d@"2HFTxcըH&i|gfwVX9b>;?|HAc=+c;kWNʲd{ٚB2IswsK=3Ԭ(G ~8v +q &I^}LRpE{MTxkjp%c;, әo Tdؤ[.И4 G~G*C ACg^?wnKxLfnϛ4?=z۸C l(ll>܇E$[S x> L ΞtL5fB63 Qٝ޳|qcu ݳIc!!x'xt dXhw:SsZ`\U+YIc{Qܮ^\খ/@eMa#΅X&Jo>xֶ.^Y$;uNBӲԲtgs?z,=l3$*U*LHY._'z.H+}xK |k)66fv˟>3zW G=8PDsFݖ͓Fљi)5eU d~^YGP@Da #7&0B2QyWTLJI;*7hբkdh[ShrBUm@ Ƥ3J27pⳮD:` eBc"FUJDW~ed "YC&~ܾ1S,!d^W.cL ;S{ͩ}2xkjQ )nZߙ7daUQ狲bNwVʢug癿+EM|uSCv;[rz} B`Tvʦ+@qȑv17sQJDW!^E/\o|M{y̌_Y66Ԡ2 /=c?ǟD&#,S+CtG~Ϟ=GA$|b-<⩟G~ym>H3sI37Ԏ +b"<7oY#jWR%$KHA Q"^Eyd (i(ABEh2J7/eg'd6R*ToL4i5{k<"Fps[0 dl+ڼ$ g/9"!itZ9IA.!/7tsd[kg!uey90{8M*bE88Ʈ-I*3&vRR@5@`g5茼>Q@0ULzTgUrluW fqqs0pizCO~Sۃ{>sPEB-*.IY_ g u:eE W7'NEy Ti 7 Aߞ?vOLϽ^x_[.h"̾;lW~ =QdL09xl/Y5B-?S=#DqbP:RQK&JqP5Ik%:oW)[%.{ $ `-qpJ ȈYsڦԴ bh@"D#ykVT ׯ ⃥;?oM)A 1b|!o$3/<1lٙBsp8oɓ9`$پ)݌ef!c $ӝ"BN:X?wŻRj@ uK~Wp|*$=s[ÚDpSN$NNܹ?id+PT# xasƱ x[O|Sk۽++sjR\`qAkA=EGDc?VFQ M23ɾ R$zӧ^/1{~(_$(A SNy*$Y6. ((N#~~app)T?="@ADPA$qGӶN*AQ=,Q (K&C;4kF$Raf/kGÑM ldXٚ9t >җcX[:q3jQӴA<?ohٽG._83{ݙ26jH.x/ Wogy\uJgN߮`|}3*( ^ v/x}t4M]w7&apsc$\ N75;dY*0oT5>Hܜj7=w8Ej!X2'60T0ohDD HkO~|A- `vU}/ @ӈ8w3KA(*/]h2KSEE0TcAw`9J2X:tpe0ţ((PbE!6č7\C2ђ`ҘN}NT=7ޒ(kR%2*jDyus,pd|eHѪI+@<ҥΗZT7۳{#s$bܿtic4k8Hf{;l(3sp"a>o&YCsmpoowf YcyT?ϻr58=7Εfٮϫ-f\kw5&kf[wl»2LoXf;TWQ.CS[4Op䡷tԥ+X 8UN/p;(_Zk(m]@t'i_-cg)Bs Wa#oz[ C"r"m=曝FdXSMm0ɩVQi}ZѺEA"\Q@6L6UE71UaWl_ 6iTQ$_8xe9FڕETl#0=5#4>uYAF2Yc(|S{4M*%Y|fw$c`f`=q 닁1V~VEw!$ͫOX4+|uV'ӘH(]T8nkVsݍq]-]/cMHD =XmTsAawI_iO'[^LR8<} .m&@PhUEՋFCxZ /ww^Wۚw&kH337{X#Zu%ThOTJ@dеn 깞DMq ղ܊@B4 |ģL@](P%*L+a7W_%(!R&Y"¾X:]zI(\4gfǃM$0IfLDٝ?Hbϻ1Ws{Z_TD̛ݹGoo [{1Lb<yQepBk+GQ5R;$βIVp]ǰE]0#νq-^(0IW8<5`fcgve<fɛ?,OWfӆ̧}C;8U'EJUDQ'AUT.71T]&N)_p~瑃oz_B? dmbG~3,ڲͅĽɠԠ!5hF*BvŇaPC۝<T HU@aϘl"lV%;7<@D'YYԉ̸<ܸ݀C MNsjoe  T[W7^b d3 2)*dSGw(5?:?$26i YfW9c*bȀs h[_]<;5;dEػBE{ +/]|9,de1*AY {БtfCY|YN?g/˹=*$:5+$&9B\jbz]UhNΪDTNS =/طew~{. G"(xJP1D @$/{W.\Mhx՜[hT55}Y.P7}y8(R_;8.Ta"tijz1ŅuNu3h:Z0@-QcZqPUEU)m뎀MW9LȏH"S6m*E"@v1I tf7sZtU8ZC@2 FCc#Iժ_2~fhv)+!M}GӼtvety}򰿉Ƃ"ӳiLͱp#ʅۛV]Y˲< "L^{OzujWo̽.DٻS]%zeGUGF f?'?Lw5~Ot͹'7Wuuψyٲ KjX( }ݽ_mY<7-s3SYv  0p`>l6ŋk'>pc ľs㱯$='b7tgV-"״D^6a5iTExS$@ Ji>=H+[ aozD2f$ dT\1\_|1"XDC)ZpkWy/H$ $搷*aI_2s'$Y5$cf1*rmofyCdWIgf68řc^[Ӵ=9ȹKΌ"2IhM~;F;>r}GЋ|>t•#E{3G@173$֖.GL69rlyixyp\K{5tACgjsmX٢>G|+aયT]*}.[iw{ǝ_~t;W7 8Q03\3w,PX@ *Mb&zLTdN !==~7PV;>KUxS_Vs45fbnrC \8VyjD\!4t&{.Jsyv6cJ[**xKlWU$ </!"iv*}ͫx[EL5?A%oO7Z Q0R.<|!ZcRBCfq2*CA\9Qkҩ4#ѐN/;|{Urk+F^9?\_4w6P8=`ueyiHy'|vhinm&uο/tm~鮂I.qįts.e=xؑIjsk657ص].v{L@Нڳi2_ \q!8>\Yhj@cEM*Vp #7X\E 7r^0Pv* H4i-4UF\f%X=X֞$mk GP]9c29(`{M ƃ͕sF_"5}d̤b|t<2c3L ";ЗcU}~wfo\chLb|;La,8sr?͍GDAq>\ٱ[t3$i\wwdy+Z2vzN_8Jkz]w_)>BjbCko ξR=E_C@ "xa~w-`r"Ho?{_iC>DĪ/mVE44 sBSE[, `ӨQS`o~ݬ#|!?3=$peW[sx$YfϞZ|s/ \<|k K'(ot"r2Nmҝu,*ꊱw;ic1 Fk"}t M Zޘ% ^xDС;n[\8*H8s46>3 xyw`O13?p¡#vaO:z'"lug^?zv޽8_DIC߱`D.]kUZj_ǞH0}`B%"\}<λYz B0ֱ)AY޹b}ى(,UMm(lLNAї"5ƴ:Y$ /B(= "ZDN-q H`k)JQ%b)4kOڌ@? d,*5oSa\1񰷲x:͚Ʀ 8њ:pCFEsEM2x<,GZѕ{TsK4;qenfn/ ZcMItuEw ]Ј>$Ģ=nsxZ3Onjs;U4Z_߸gϼSOhO|L2}߿]R`FC5EYUEnz;kHXk~OF~j\\p:W\`|}9@бW{j_ٟ|^w@U}o[T(V!ƜA\G+9"*ӼiW ! u/,&AdFkت@#F͢Р"h<byψ5g:sG:*m]^( %)CdTٙkOcT "3O.{$LjȰr5=FrpxˑMOs@$##{W<l?'}9Bf8~}-"K+K@tkc+q=w|Kh1yM^i\ 58YCDϊcs{v֚ѧ?vr7v5(y|{`us[Q(;y={CTnf4eՂ1C ,TWcսI6q԰j*„:IFɉF@+.xx8e"{z8͒?:I5_׷{#cTZ8b:AyAh!?׶ YfɬysS40H(؏gmh6cӍ6U$2#GTLjxqo5FRQ;sD "䆘}o"%(Q{EoKM2䈆}sQ^QXwQbxy"kTbOwKQ`t!8sݩm*HPW/FNJe1>~ooIH4˓$h>ߵX! Lvv7$Q`2ދ[$E¹Ѱ45{CLj_#r"$Ko7Wk{Ta* Tc&0JU;z{{<Et Ig],M Ǭ#-uVJ}(oZwkNyK-9*N]!DDnOε !% @XYBpNr_n 5!LBBEd7`? 4 :2?ޒ*bTKFgob}1Xn\њ9kG8CDW !$27oN:DUe}E6Inm t%!һBז.4oDp "{~aPaʱׯ^z&wŨ?TVQ=z=%8ppeYV/adk+¡z e  4;w+k($_}I"&``cG0"&矾hQ5nvs:0D൧'?7@ ln8pmNZ.p2"@3{~\ey]wg&ƚ3w-6&) AM@!H*\?b:Z͓;Dn9@(6ŏ9+05l6HnõPP ummQ/o_Mɦ"fS¼qpkC@2InL dDdj^1G9< {kd %MSDǧ*ղ =F{&Zcf,=x[훤ޕꙓV+ Pٹ-(/K766r WΰH&I,oL?xK6&ʫn: k]z&;w8~|t>ILQO>}'T78y"fZ]LO2]@9|ϝ1U1[?s2vn<`Y~ ϛ>KбS*D1fژH'bu.Z/ qq,k>,;ʞw a,/GWڸ(._v`'/ bwo,I-iS'5RʯuF\dP;s$;nٻ͢n C6G@*eɗ} 6ieyDu ƽ _DL h=}0Zhc x'ILfg@8Vm]]_hFv_{zQufOkFyb߾Ѡ` *T %hecOct ۧMƇoGF@P$TVD1E6C@؍!x@ygA+ᦈ ЕC"$=p "aous\%!!$uf {2[hp qHDhמZ8pm9DΕW/ju$W g:z.ge9.ˡMҕ ,C_[?̌HDش~ck:dLwzOhǞJݍvfҕKkt^g;[Yfㆌ"ؓ^2v~I;Nw;S\uoAV?0 _LERJQn!4X2ĈV@yYf3aJ,<Q`}w[{ o}{?OΞ^L1h`+ut;ͭV?V 5NO934I$"*`-_,C2tZK$_DtuIsRZ.n&cΡ f%Y7!b9\wE? 2IrU[sy{+. W 6W{6% Y=[ %`rEU@2dd $y@BpŘ ]|+eͶ 26ͲցwODed\tښ,F,c?{|La~WW/-]8{2˛Tݙffpƣ&ɍ[k}B{sof=7՟O%'7) ki{sMw}{esR(= ?4 o9?~\61.xYx\-5wP"G;>T@o;+?v5j* bA$o7rjh AR K.r \[tp|9DFX٫JLU&0IA_l:`pU(i4ɪ 0-rA9,~ӇȤufU$˻C0~:"]93Ibxml{sG Ʀ |3wXI+"مl*h0L{v# *+#$_Z<ǟ(lN_t~#鹚\9yaKM6 W7zݔwV9:׾?V"| ά>6W!>dF0 `ok7nn ~W?bE04_kǎ{z[ޯޖ aƇf%aiD` j>$ X!(4[~rS4+K[ُ(R렮Iq!*zXRFY9щ|ܪj]*{#Zy~64%aE# HE?P@DFA_ aD@1 I$Jcr=+ޏIMNw_gc M8__>3^ !F(w$S2)D`_( LFhЉ٘ r85`0N]_OH2w?Z@S ؇W,wkW:\GOjA>IK^O,+ٳ jppdL`D* jp UaP0b PRD0&*5MRb1mWMܑ #Y D$_VλbXkl bH+W.=/IemUH[|s6[z矛 JD"=z7c>pp3!3;pqxd$Iⳏ;sfjOvϛ^ *_ y.Z]y?އL׹"4Ed>!/O>sL5-Kó٩&c W qjYF+v;y۳Ng˟|/o;#2+rL>z(j S+<&w ̛huvf?k~D+nCȣo/}TwAw`BqWe=H ajϞ7|{Lb80T0jQJ5$⎠^|Jӵ/Y漵)h HF\ $*>FQ&٪a݈nmVDlw*Ra~}aoQbLU"{+H`a4Xyv߉VwTqUV*F#@L$GJICY }ޗg"sH_*3$k,^R̐f==v,!cE$ɶϝzn L,X^0l #R+Wo:xV_i4,ͼ׹"S}A̾ĚN^x%\m"C]}7~㉝@j (dx<u}ֻ mm>pps_}Sh苑4:`e@`.Z {9tz{?س hDn \Xo|7맯.-gsYaw56+xQ'Bj11B{ vh8/{XG}EL~T좤e8T$PT?bWGLZy{~bPTBpcW 0I[ `FޜRa$:`sw*hٽӼ q^[íK/ ibmIEўY8x0x7lc6VV7:h,;#& =s۫W+?M0˳{؄l|vks[ZN5ZN [a~!"]m~ߑҗo$l|u]8~}?/,_'EO~_z[vof.Q-Ŀݐ v~9eg??}ۛ{ӉxGn{s2X^ܾpvgW/o?=^_އNiN=>pxĝs'n9t5^'!xcir$<Տ(Æ)!JuPO@Ýz]zGp ]8Vv`DDydPDqXyK$xxxdBg7(HҘI3QY(o {"InI[Ռt[a__bf-4lwpEPfk}DB;0=xzQ6تdgK'Yrpo{h;Xa_=Ww^x6*@f=o|o5 ZQ 1oyk4pƘ$IMlя=OYNӳ{}G+F񠷽89z;K*,\wj kQ#w髮.Q@Un}/ŷ?fI}ťgE`kNzo~ӣ=i j #ڑ6wywrٽ)7M4h8r-m4,/.o|7w~3Sgiʡ dle'>s_K^BNY)];bvz/ޥQ vk:mJMtBh1n/-b/|+aT"Q2}5EÎϾeUX+(DQdҼ`l}΍U%һ)`֜nB @V/ 6/I"6k3 Qoʹ/lfL*6k+"*\\8UX,76]8I`Ue+em%Q"74o9pl[G^% Y2N|]t=5=*}Y#1x8bQT%˛D9(B?'u+K8=_e~~o,kyfgyc?W/8'ٿ٤y sr=>pf ^1IbĶf;D$/~O~EN10T7]R6-(ˬ!@ qXY$hd Q1z ޥϛCâ|Ι{XݖBX< T4{EHhR=T_T5B݅~$2ƻ~%( Z@`;T5EO(^]ɈiڰIѻ콨H8{gO~ h8iv=94\R}#ЭI[*4texؗ+洱+ITʘW0Ɏo/|Ia̽!og?9$ϒ?n pXÁ7ŵh*XߜStʿ9mw=~C'5YkُG^d Ϙp[Zsclb4AJ,JҹswduSU7t3s^l  lTeKdɒ?YN%KdYb0I@E]laL*q{z `̳{:u{/=vvJ<|fPo0^}xWnOb/0vEĶJu&'ݘR`d(ҬS;I'GDRCMMȹ O%f'dȀMIcIFHHߚ95+եQU'M /* 'D#k J?d* ];}ǬB ׯTKS'H$nKOI7Ď.cذ嫝5dt-": W\ԌBTKoghx^cf<|`R< WPJe 7 :Q~Jzt I3VIief}q?AOô޻/5d=%b!DƟ<}pDD-&lA7R$Ϳ?O>O8[دn`i  љ3WϜ?}ʵv߾q۞uv-s^ ,:CP_bFԚ]:;K珼pk@ern@! RX  <節XZmu! @P% P&5O>}Rh&߹߽& Q#33m9' ˔uTM[3Φj@! ፙ)e|Ҙf&Ui?mխV-MLy ?t+M^>N J^.RYW_|Z&-VvakfT_}k‚1:-h^@R7셡rǞ0jT3( Q jf/V+\Id$ 6o[20É/."@fR0w{?ͯ W__ņod1Dt-~7~gB#bN ĥW.O~SO|>.򁋍5ɟߌ[֦Qըh:قJQA#f_ސDPedžrQτ4:VȐ&`$"@(1k"4ج'qHRpe_o%<& Duhs~^:@*Э*9kNFWI@tR!02`:U4IH? /[+xX'K4@!7B!o0J:I$wէjsQNDO~Z5iLys$Đ7UvQ5PyR(f&vO|s#\E`X>zu BƯRȋϬ^u=ߟ[{~_B~qFkj}x̃;k4RSqjxĥ+WRY@!)N}k/~lЋs2Gԋ#x![nn  -9 qsn~u <(.|Bd꼢:.rJ D.-?u B֎:ghN;CGLyE$*!W2C+sg %Vb^I-sDV۴Adۃm҆3)uHGDP'"!I[i\c!NMTO:"T^X,G?ҨD k0_g?ȏؖE>RfsαT~卬\X4Jk;=?B\v[<)g~ '8@ J㫷G f}_ ֚3'^vLK}~P$v}WGuk@D1=y903yƾu֤ze{C^tȈ2s7wf9ڱs#.ෞow'5G~ŮSETdj#cC 0|^w@CQ E!\% ?t &{bLM#6Y-U/D 㘈-#fb3$B`'Bcid(?n`0=4mZg숀 [#_= pܜqꈜa /TVR6篤0Q5nͥIe*,ȼeIk~~BZH3*?'=ߙ<0>8 fT:sZy _b\oǭ*LǍUO0SkB!fm:iՌNxa Vn#UȜ =u:I sLp#i7$~G뵩ReYcuJ VV]l""re@Xn[ܬ99R=h`0 $隍;2Ped((3WIV=}w dK+뀝Qۃ{I\Dv`~{_ݫ?/~k7 :V>v\ 3H_gItRhg~W>?Xp d| _gs_oȞBpST,'ϼwdŐV6N#"Y\gDV&d ??s'oGI*9e8$A6!:b" 3.,/H&& ?L4YcҖǏrbey;BHF%iGzBgM,[=Kɕ/׫ӎC?PM QFjg^}JJ%ot${+6ڜ֤ib/=1y御4M1xMt@g: =Gy/RػD;_vQH)o>+ f,fs_{p0b~s[?/_9LAPy3 c$Su#!Xo߷wu֡ѾyO O6Qvxt.Lj*K {gp4PE&֌GB*b"ffr&Zp6uPTyD%B9Q$Q(D%JDBz+I&m%QUD9!Ted r䌐m qk! (FƷ"0J!"#XJ~XOh|ݮrfcc/?&yrȱ@!Ug#IDATod{\Ԙ4jQKg=yL8 bP6i7|λ rT#C_i6W(rNOM\\v.`8ky<]9$qu~rn.[WݬS%z7EXzv~/<"Y2 "w)ugfY~o\s8ԬX;?ÿ]-Bzץwj~l`W~?X1IOЁed2h0B;K=_]:q3V= ᧿s"/Dsec6dx͑2@~&aMdL+U>, CY[L$JތTB*r>wUͨ1oâL\X>|}V8m9uҜzYuAĤ<d|>;g$r^8ypJ*o͕Qgs6i܌湓/1# {20J9g'<[(լZcm"f-BJՓ7 TP~7Ǒ,enF7_6_- ?6nZLZRb.|^?f | Ao ԩn,[?/Od#(vMvQzOG{l\k/ ۘZ 3'?_pVgV/Rsa1-AzBn]w0KXԒuBYڲCHܚ--aHubJdg\`k303RRV#3N9t˚ 1/Wa!d׬5V':iR7#ٌ8TJ?iV[ku\@ ad|s4ɘHH5qĥj@EDI֬\w`dcDS"Oas?2J#Vn%j  !^~/\!b$k7]6yyΑj٣/=Q ryr^v޹zvG,PBH璸5j5^@gܤs r^/}7= >~W>Ө9DPCwܿi}SF7\ '2 ?3쫯zث[Dv3| tj y=%f?XYn[cӦ zI!xCXf∈,@)zZ2qޓdӇ/D{^6v 9V9b"\ ʈBւՑIΦw^lTAdիLDFG:ih\i`lrP ߚ6w9i\7:Q~Ny!9JqrR"I[WϽ\`?;vAj~?33F'NKg^Ifo: aہ2ks&MZƤS.;y G._*  < k<akLk5W"e;@TBJ^yW/-n!J]=!¢] ^s7 R k+o^xޅ307uuj2C'P _̚2-0(q V4Z4 C .ՑΒ@a@0 -=CYDƱ#xxǞǞ'PcvnJ'lt6ɺz) C(=D%i4oI#՜(}& ፈJJjkaP:nqͤr83(Åg$ Nyչb?9T(D䕓OD"`-}LL:g_9~KbC"G؆wYIi47}#L+}c[oSʷV*ĠSG_204f+7ߏ {Jy Lݸ|׾8KFջ{&O{Vu =-=֫z=_ /K(F]z잏}N)Bg?Oߵc$6ʓoWd[\v-vyřc\:K-O ۹l%;20YN7lhh|`U J$vȖ۵N؁BB #]lwC$8r?ʓ{ޓy4Py^>5TJ PPn29&dU&G3ڦ-[̄CaiDH(dAΦw rHLRxi}~"it0i"W,\PRzB*1sVY+xAtplʍ9YmL5kμ % b<^Կr&V$"gDc;rLK ,Kb!ݗ=1+r_9)_?A襩" d'Baˍz,8aXvM^9{61Un'Q3H0[Ҷ!AK}+V߹z5#%HgRcDBeS KE]F;XD"b,;GS\ (1oßHBWZQ{f9ݲi&g#9+T~R5lbӦ5 ʀB_Eb`4gZhDV'T(l r DڪN괕Dukr(I˃Y3j!g\?F `Rxيë`vV{˹|YHHk6Yr1%Qjًg_0 ž4y|fP~!b5Ϝx)MrP4fCoޱ{ŚZDBJx?7s?RFJx&BquYM8 X+zITi疯ڞ+T2$n^:{ eBr ;Z8[$O6SC ?KͻwlryfB]t^+UB mIKPJ#8rȡ|!A.[궻rF?hnɳ7 _%douFJ4W#"jmw6ZX)R3?) ~Y5Û7xehxqǩ(qu٘o(>>M4_ͨڊQL(8jR(HO,;(1d'K̝Ҁ%o-4_V?79܈5sPp_R!@ (%`r& ! pP9@T&:is&iMY%8dm9"F'&m9T>km=T^ЪMQM'Qׄ'|ߊ{2MW(?7F;?, DUv PMD/vTSAP9fFkv Gl >™/ <9Qct5vi(/B9)O_:w\4iLm#WXQ*)RTʑ`f3?a' @!wX`5?\yw'=< 5zWq4hq/.| ojXOJ }q/k?x7MSl.mW $C+ &)H A"sG `@d@ʃ91=xyz *$&۾e~M8Jp٭~ 2fWu&r.J ΥYgbg"1 "qkkR4t\w*cëp'q5睵_@ix?,Rymm+^?u|&Η EF&:_6UR+jtbt5k47uءma4iAaǞ{=D7ynګp:rlu&Enρ7ܗ_I<%bb)G/gJEak 䵣:j5iVH]W$$}˞Lp ʨ_+]hPTŸwO?@Z[!oWxAX[_aW2ľ2T~}a Tw=p;,J J'',0WW.9z=+m袉5^2q"\+/܍?ʡ5.0^|O>~z;醠s9Ė{m/XbX fH-9".Ws&;,}&z\ῡIHＹ\dFY~̯},=;ʟkd4&J^~YVk!M\# <2 ՑZ- |8ͅ$BxdNiT7I<2BR6f.qU:#qͶr>!јC٫: &R { ubMz箞??AZbypöa&q p/> yN_fщ愐њđg[R^6_EM^eݮwcRe$B9&WU ՛x(3>v4ڡbf`w!t)!,J;s3o+ 9D|`?eM/|??>?saZ*!cm㿻; `Z@S~8#"J6:gIa`:FG]*Q~bKomĵ4;kF+ %P^Umg֬NT!9/X_(_RO7sҤ|͎R2`"r&j̿Zjԏ(3DD+7^Vg5i9/=S^{~ب.(Uع )?GDDy+=/l6ZuG};r1I2Dlp|̉RBA臹ƒ՛~tm~[2u;o_,tM"!2nM^zmb_Fq11}e#$5(t BYd Ϫ5q{זcjKFDn;D KeS X9iZhߖfš;R3ü?}mӏ?_ȅx%g~iHb&;܀Kک)aҦ3YM6Ef&F~aQ֚:Ո+|? %)` F:nXe(2&_u:IZ5kTJkv Q((֦3ĭs6ȕPiZjۊșFusojR5YT^D46Mi1E/ǭw=9JLrNt*ȵZu~>jwxjRH!$O+/.!Bn`p7Z9F_=nڶE9vZ@C7OM vkT l"7YV`)Ex|׎>nP+i B\~ .17)oAk}q hzh}c,`h&ІMPA&K`˗'OKY=!tmޯ† k rR&2:_5dӆ)YMN8bR~Q,@#2);k@H2IzyDl4ݛL6LҲ&-D^cZ6cLuF3 YTR*_sz+`Jmy@)d._8u$NDao٨; :jK=G%kz+xG:B?{Q͇Iܯ?#A A7M ~v߶rڒ?[ڔIy13-d9r {5El &1?/~{n}lep/z=^quƋ 7# @Kt H) i5?'\/pnt=cn0@qУ:fh),633Db(:qpH(yj.Sz㉡bYIb(̩ &~ U(d (IPB*[֤$&e򁌘c`)}rF'u qշ>f /8Ӥ4@z^+ȅ"6NF9cR6fȚ<ɗ|ъ2`+!&:uDAXJQP~a뮻 *S^<z5DFS^6wo._f" 8M#7=yS돢Vu`/(в}w<40<_:wz,ҿht5; گdaqDK&__+ 6?u&+RŃ?x];\3*M :s fӮ'\{L6CdE~f@íeZ 9vL/yNNͅ6;:O@q|UOe0*D,@lc)u.v+qD`s%DGdgbJ% 雸6ّqc!zaq8"H(Yշ+c)P7g$j[qc!M#?,ew FL 3Qœ]x, 4\b-Y@ G1\x~.)wT46:iGW{lR ?U;DaуζQuw]AC)c٧ҟ^@#cʕA .~3?ۛ͆RKH,X5X DAOb`]P_s Wh SЏwƒsBb~Gԏ}OdR7k=7 7\rzp?-lAE6iaQY.YPbjŏ=NR@]? Wn[:Mi^GNG0;^G3r0M:'M7J*??gܘq5iæMf@ P~Az6R0yVlWy!@>7kS֦:jQ!JLf!WNFyg z~upvu'_+^GTqxUn!&[*~"[ubsNzޥN9hn54&kw}xt5z~ Ytl>OM_*<` fF'IԪxعUkm/P7^x@oK0iUf9Z#DD!Z7׌f}Usӓ_[~ϔJa!ZAyODv@Xv`i{,v-w&"}oXm{W?9?TBk׈c~6Y rL*g,'bgryA3,B59ebvFDik%uڲ0 ߗ+1mu$ǀΙ4nFJf==)U\HUFl[RK&R=]n[iQ/}+[iG' ! sB,nn"@/" &ߵ~5쓏}>p-&Yhzo@+=ktd5 z4qM~θ@$qʗAޛV=/|􅓇/@I£so}ˊw qJN :ldjrQʠed2qL6;5 ʘ>w:2Ed2*QP Zq_r!E4nDg͙ʨ@(dc~b꩸U7i(5JzckwJ9`~2Q\^vG$Ngu(VJaXRUg}eJ1ԕI4%(9pإ=wqΒh Nv瓘y-%I#,۵7xK27Y8oznݯۉ{޳l>xO}OΜ }+SgN]}}𶷿eVS[^< M嗮'c_ YʿN\Dr~ELT+G?DDB-}g}[޶cc+ƸA5Ě+ j/‰;j cg e3ynsϜ>qsR dNR<ؿ~[?ji̖aG,"ء LِdRr c&D#M& L䜗S~QVG:ՑN*T~>3:P@YjU5u24vJɃWy(Dw&JqgΟ:V+g"Q5oyxuLvը| g]!P ny["k3rXuD K V-vgdte:gM<~zu\קI:\XԘ Y(W<`nXx]_)IDpǝsOĽ_/剉yA.lS}S}qhe˶ܾө1!bƯqQhgm;矔)O&V#o[ywt±F3Z6:>pCoL-@\ҧ80Hѷ-;n.L[$Rz~G^{ww:? oLN#r˿@,_A&ܴ&V^dZ7 {6yN_>(/#l>3yMv]u..2qGDӾr_}dr9Pw)}t2x'DL (DѵKgOL9z.DX Q#NR?ߺwj*&zK+# @;g arBHF$:&r)F@cynP3jf Xf`|&F5笵ё)V(? ΦI b`"gMD5&}#먣-N朳6jiT`}C }˙IH/5&z24Df֬z{J眔*jb9󃵛oZ&$n<T7l߿vNgJ#{?v%yJ)ߺeǞ38il9“lPaaPΦIuB=g'/o޵?j8wѸ/:t֎-X)hU.f7c_wVJ2s{wݽ>W± AD|3|5u۝oٴv5hN%XGd#1 T9s-S9F($B!KZřg/}J+nJ𔒹Ql;\5^K;wqF=DfQxgb:9MJRD aӖ)YCNg9WS2YY1I621S43iP^8 'IT 1D%F֙Yi$=߬9#Rs{%iܒK8_[ s֜=ճaQT ]3fsVIc@8ukRIZmu@H (DN{™WuId:ð~9&1 [y W// :ȺM;xը4:u ^=e!w_wR>v;J$td zaCxu"z]u RduBkv~Sf&M[V, a!$KLkV80w޳-j4&DFemX!M ;t,NP 2 t:B1AQ戌5)^.WRlcv&JZU#2zcyx (3;rYv:]󭙸J?X^@VǍFmj]C[\hPgœO]jgu[g]w'_wSOO+ Ȫ j;n}f-nVG?=3uox@榧}y\T'm XaoBi3q1k~kϕB?,0Tt|m:vd_L]}mavF)H!o7GD6fCN :%KCXsz}.M%ϳ%m5T`".}Wۿ{{o3O>y\$@z5>/-ݽaÖPq`PކN)Kb0֛I-NL^?;}N& M=ܶ?mܿ2Z5i@JAfGF 2̎mJdjگ ) 4#rLNhEtiER65Φ;dPf!49"2ilӖZ(п"K*9y9"gIB/u@!3Өat7kI؆}AXL ^~.kI ֘u[Xa1 )~gujB>[*CYcN\>wj`E`Z0WٱRe0MSf}jc4N"BxC.A*9ĚS\z8T2TBݸ{|զ8ksYj#W/)Kz׽Z'R'įoږ(ߨؠrCqT+{3:5Xga_w7 s7^|u4y2,j>{"p`loF-X;T,il>!QITkqL_}Sf6{uaabA'&u %,E:o ZZͥ>+kcj'` !r dQ(f إRp8 #2 ȥL&%dP&))P' NGYZ]*Jur֑6:::}aq9sW $ om;2 ͅ9KIJz \z^=?l.xYubZZV)<9g&.Q*D,$CkV-D43y鵗.elwMqP,_>wȡǬI(PyV=/ĮY>/L] x{nY[!r.]:O?+ONmܲ?enLGuV]ݼV;ԛgAn.PdA,AXbW ιb1رs_Oss^8굋fgfI7=>1;gӍ|_ydcv /;cFuj&q9FT)D!yuE12Tؽuc~ʎ}c Y8&( )`2D3\ Axd[LfdP%;ְdg<&3!*@!I}ڄlJd1D21¾[0j+ D&\yd]yp(Nk'&[$Ȋ&gQ(DdL^y-d Ww\?{~NxǥAbź]CV4N>?cѺQ,[k^HSi#ct(+N#LM|[~20LJDj֞]>[,X/keop$  ҅Sɝrb,s2ڽn=V @:2=68CܲgNdرKp8@fxXתF{' Ǧ6$ 4$ɓ%|˟\ˇҦ->n- sVk _g>|h~[J\&rDBj!z7NfT؋|] fUo&M@Y;gժV}̙^:99qvB5N$;e?K!{>{c&Nmv?Q{jb`(zYn! +B9z|i{\NjF\P_qԽ1"˹r9z`vX]צOO/,EjT8JhI<_sa|yj$ ݚee}K49F[& m6qdby,K: 1 A;B\lɦ rCۗɒis&%(r $B䌎Kɵ \?2/I#扝IȗG Lڜ(BRPt՘ q.z&yy=- J2'tXcsA!()28b56VƬ,D6 9@21șئuD/!/Xӱӭ\Z!9 B*!5ׯ;Κ\t2I$ "78@D>CD&Ipmlm59 #$i4&[9ng֦ szv#Bz^mWm؋Ba?' b?w߻jf}Qw/?HHL8rQg.\:s_pN8qJN)8W_z8QKu70r @!RK=ʡӤ!D,۾|@#zH>^Id.:N6aFɖ,qnzЫ} )Vֱ΁a&c:C_s-+B9CʳE}a ƀI "*/k?RĴOD?$b)1T> ٘&2Φ/R giJۜTmRiӆ-r2PaXtM\Ofv&5idtR< (i+/D!%Qr0#ʏsΤDjqTIrCc5RzRxs//\Tݺo͖A)~٣ϴb)<`ZbZ_:{Py^j s@޻Y0:4:—g&'55=]ilMLΟ{/)e-:MFWnyV&@<W.yWIrmyCF̴ҍw:"w ;C7{ ?z. !U v3X":Lbɪ12`L I1"(6i)cfr3Q{ x>0;d" S!T!TԦ-$X~aPHREdƔK[6<0P¹4qՒּʽϓ3dՃ20Su\V?WjB5&թ66}G/B*/zijlwmaJ3\X2Z7{{4O )^gT FN[C^Rq22q̑4;u&c`x=#k8f`&B'3 1^v$8n)9?!kB{>ްmo۾*Rqoj#IӁmNJ eB!h®fn]%x?oP+=}c2ڍĘAPX4mu&S#e+$. y8;d?u9mF dPB!mJ:bl53Jߥgp`3AiP9ᡐ D ΦD:KˡI@mҖMZaqпuҨNϚ3Ts818kVM'MfY5s(?D)IT|QN1ºm !fv֞=Luz! "(Woܛi4IWQ(٨[#nkt(?rW]`hZa4 r‰rE2ʵ[<5&U^#+ko)ljEk= }:ބW>-..;הk/apnzo4fMޝLnx8@d H3٠M;&*LʰHrKi0pF^ 2%om1[reX6LӹKDPad(l0Iݚ!Gf* LF6wa"϶JfiQJ f*i:suJj7c+6`2cW^p«O4ƤqݲyCO=A_(Ŋ1T=oktH%'/?=|[Fi6m[R5/ĥրwSo[7pXzfUoJo/<x}"v KbFsFqN Rw\fdD: @ LV @DnX"Rᕤ_b"Y13ę ҳ&$i,(-ۦ< am5F'IT3CkPq}Ur}BxBH1׿lC8$jxiҜ:&M\\ۼ 3?sjsל̸v΍;U~Q\=OP* Rmw,[XiT|g/ f}!jw>v$C??;9Α30bsxtUԪ3sGDnnfࣟ'FR?ߺ R ]9_vPr]6l]]vNg+ M}s5/X'7F[Xjpy,wg\*#͂t a^rBls1#3dp@d=rg@tۖ#] 4AJP 46e""FPe2Q᧭1!I4'תO%Y`"C;_`iTϕFۤ&kJ_($s3 {[}/|ap?E, {2M$7y! rsGaB"Lx] d߲7I.Sؖ]̹!32 dp5 Ak1uơ#ƽtm C!:fb@Bq&.(&lBLdcD PHΙXiD P(gSWiGQ QT&:nMc4lX禙H9@ITReh-J-Es1ͅ1tA |*nV'.fi9ǫ6n^?r)BCk6l &;{闟{TXqFuöJizs@W_4IM3ѓ|ŃDQ:kw칻P$QSHD nUOF9a`x[X\/yO0Doxl/g9f<8^ W/ۺGMW>YywmrFuᙯ|SAaPbN|`ȗ*fs_~sloݺ|jzAal,BgBztw@M"kPu39e A d]>] B @c7K"n'W7ȕ,ۘ@,T TȚɥRTgҦ5#&L *(1Y (iL[;3PX+IIsIӸF/yf^8mVX^ι4)/*r}3|}n"W6y */B1SSW^: l=Ezq9/8kK˷}r<“_ Vfӎ-L" G=6?=+tDx|HJը/XY>乓Uj qw}]-<P?uW^tFy>σmrMXlSl֛gsIG`1 8$:C":[ o~c[V`qMJ,[5}?|#l&mQJ!@(і#i;%?p/mÌC2&d%^.;̙LL6&r*vAظL윉 P2oD)G&MsDdSgrRzR i li/, +gҸ6wA4r/(jC`j,LFyIcUnTo?r3ZJOJ r٫WjIҔ7޻j>t:g." NVo;rsma՘?v./_zu&,SRK??y23:猁w~۽(W'&I)^ð{^y{Ԭs; ى4Bmj80ǜ>bvЉb8ٍٿ߿4vs| ,75*c+06`ԕb(8Knh,\3DN J_:dLQe"L a*DaJ/MaujMJą/J[qcA8$ms422siT/ (sJBz:iM^GADonzb};=HDH|̑/?=73BX͌;wy'Ξx%s9ka6?=?$r?u q{JwC#cW/]a{, 7vfX] " Ȅ ./XJ%FGu&cep>џw#gv <0P'G+ιkI3"Jn"J̖Q3,9VG( :ZN_,ULYpqpuyd"$\_(Qt*):})Nzmz]K/R~x+%q3jëw _^xYB )aƽv۬$NWNN T2y=RyO_{OĢQP=m/쉣~P}z#ly;cQ8q|H+lw[ gГ&|p&ߋ Fub,sf\y=oYe !N,9 3 " dyٵ vȔa!g|Ͱn,e8(d@.ٴ"k=ԭbbG6}AlR(ts&iN4r&&U_)6n_rM,97j5 gP34/ T􄐭lu¨1WhMaCw0R]:W I ;7ByNh52*Q&sVQMf6W>5uXTaunz[} ٓ>N,jYvsG& Ջg_~ԵKBBmmwY f:Q3^8r^>ٰ}{(Wі ]Ki$e!%GO33;~倛oY7NMQ u5F!94:B1,CJuˇha ! ȠQ-"M6A0JvVfلA#+$ Fk:::Q\eRڤ1X$Y??/sQs.nI/̾aqohu#!$3\9&LzmȊMIϓRjݺ3SBzk98^ U_xFuH /_rngNfc?7y\\sf6n? £0)K}ڨQr|LD$]~mqls2ڜxC㫶_H6?rՖ Ig lzuNL Hd$bh)LWxAoQȌ#D[8(BV,ve bnD(V&"IΦĈ¤͠3kBTL6g&^n ( eL&guydAO]<̀(<Қǜs('WڨN:wI[Od=Y¼&/$ג-v뻤 N4n :^M㖔μvrhY)_(/M~c?E Xі[o~XlV|?8G^xA L-=~Lb E_ ?LFXqg6ݲ]~q,Icۻ4(гPo,mL@O;~GVip)&e7;E4\Ȭ,lP03nKg@fd(cΚK8rZMLDNT*?DpؙyfDD6W'PJPG,)`u2( ^QmRG52iգ\yxCy`59\4BN*#뼠`L@yATv:#^MhlbTTN>qT_mmwIs^{fvRPrvJl7;x0̗R޸g[7 _~⩗QI[7mߗ+4BQđ^=tPyT}ۃCcƤmHtٯ=jr{穀umZ UNisoo~=k,ڎrG);΁ :a 2 yB[V ||d;[J@D&x'd[&NjڢemםͅA:MU.'TlkޙșX堸J$u`au ~~1Q 駍tdu\Z?P0I[&I[+V KsN L_\m"JHMsEɋoؿ /(xA^cOkSByp O?\ԨI#<}"I"Fء'Wf}BJuWNNu;4s/|cFm`$M@#BBhԞ?00w]XiO9 ~sF aG!tC!ʌY.}y@6z,GeAO؋&RFsyH011""r^%=D0c̀@DU@sd_^ɢ &i]E!Pa0` 6udLLZ l0yJ(( Jbu20ٔZ>?VlMeAN/Q+W(m0_q\>{xq2F)74~۾pܪۗc/ A.רͭݼoպ[P铯~.Q[{5T^:ة60\pCk6oh3D^yCW/^ش}Q:jOiphij %uxI v=$b@L x{y~ |U=9eDf@bئ`bbDjY ´HxE1٘Va Edb2 5:+3)AD'欳 K( j_{du}ti 0 H$EVm֮]~]vU~'W.{JZVK*0AȘ&͝t;C@_v}ߗCRzc7*g]\3жkBksl\7^<kT_.er% #]zwFvNL13KNV]BH) #{ MZͺέk3g ]+GO9Z][pkOqW薧N<2>XV&K3M c48sF2:IyF&9~c抄ؾ\NOH/bh! $mk%k8Y/ )08((ɓ̴ A{'MMIgXvXvP j] 4$d$FaɈRn} "@6~; "fF'GM{SQM@o2~Gzzšn3ߏ<Xqh#*b Ԥ L 3DQU ⦣}!:((%*}D$(~Z ;!! O"{"{pLifې%]]Lϐu)\*9|rRzt˨][%\dGR$#t횞*2M//\2y?I)IxffJϭ/0[rቃR nrVזn[=Frec7(-;po_H EeƧ8DDs.|;Ǯ15+޾'=ukϽlЖOk5A;ѹ{xwxa`t?7{]FiݛUeA-ƿ/]a).o |>ڨ1lIRDd3"0NbDH iD-$="HS [E@iIRn@N2u=)9wF) bPZn5 pcPErhD5YAtP &ԢC(!2 ~YE_p H@b؆((@F&=[r$gWtytȅEӳ%n,Q|G G.nM)fe_ж*ޱlq޹P5j{udqکFekf}m?\.fY&ݲmߎgzn^9w텹+@?D@$n\33W?oetW.nVQ6K c,%*a_!*Ap(i^1A E"o"C<$ )L? ;eF$"IA:ud:Dm, " Ȁ1"ܦv6 ~p-DBn#=f{X`Wny3n\^YMs7zG%I!O{?[' M.9'Hz;wq Ie%"`XM@ v>B9 {p¤ LPJԋ`AS|A N`! iª{23!gWgM`aQ^]"<|D8ƺk@U_t L#`R[k{]aLi։$afw:9\3˧|ghllnf+ksκe7jBhr1s/~x{+̬mS~ZY;?Ξ=Y^kn6u`׾cpuiٳV*=]#[w?b[ts54zv8$AVm/PkkaVR!@uDv:&>Dj)*0[H(@0mnazF"p^~$e5(& IE]DR GJAD^sթ/j~-S""Z%N@]{OCnVזoEϙ^ϵ+\a7v}}—bu~i&ײsf\q\3LWv˷/iFu3߱G~CGw?Bi`uw~Z*b߷~o'5#+<?RBn_ۿzfπԉ=l^|湏?[<>+['vu]ϫ-&\ft ͢京FVk6YP]7{V"ɜrE98W$ i!]2b<>uPk ߰`FwP`^Do."< L3ltn}s"I =ԗ4 LJajNc~K ݣzDVmsfuA5Q֍0&oxjTWn]p a+k9^%) 3^>ܕS['wl>Q( ܽvrY;02ϵy@ 1<>ߺr4ctO"^!p;v9|YIT3E=ׇZ[][_۽MHGP| ۇ0A@! 0q҃؈:(pai91ҏI9+Yk n{}_li6N'OcR2~x@D|qW]G d"_C5xY$u{{”F`s/p$#vE@$AbR5f6Xwqni:ZϪhz$`"mΝ{`ww1zQ^rF4HȴcUWgIHzeM׮sԍ\4w-߹T۶d1μP-\ޝϽm3d7k(וuWfW߯\;?{xjԯܼ`bS{KMA =ЫW@Ќ]^&¿]`K~#co. H `0ʒI7 :(p_MavX`$DD5gU k<*,PCYzyN }4"Y_]_5]۹]_zfcՆɕeD<ݽ~nTzFw?cd D5=a_/ko* ޘ}VF㯍|JuQ;}dp};O_{x504Qݸzp-DuE^$$COzu)CeȓD)nvsH <3 @ 1q][fzwOk]̕F3,\WVݵ{k溉de2Lճ5WpU@F3 WFi:pg>ϳ_, L=<_U}|x>5H:{JN9+?S3[$@9JYJ|Bfp'ߘs|[EX R5l/$RˆA|"Hg |qji:Oň~B ,Ç^+h"0XA@$t1첞4ڲkW\ `kBP]*<7=5SpiV|liqYYegjZwsQ-:vjVF{03Mǹv[/{ğ Mѭ'o_9ݨF3?٩Ynz]0cs+^[[Yܡ8Z >oD>p΃ؾ*}R4mmVJ D@O.b X?Q#Z_b*M(&"w`DWo~3P)4PDDG"/ <5?mu#bzfe, 햞õ3U/\`F6׷Ch>U^BwvO ᖗVo FؓfT[s@$4+[vg\w5 `fKxkc{8ndIJݛ~߳?$f^]mپmߑ׺'4t_'}}ӳ5}vp|yzᯕlJ~s3U=) ɇQ㈀Ɏc bq`kPa lBRYF/ILȘ טµ+s<ӭe51ê7ʷr{L.0гjkkK j+kw{͡Dz>)eek׹szo+V8u#2?ۨX|ipxgIJ /^p^:(:| LaBRz`n*^:0n vc0̐ "p ])r[>߬,5+K+ Nq=[[3n:vmFsKk7qk&r իҌ#F&?wima/il^[;O̜9_~5J3KȘmKOIG?_롨 1T#|Z'CBK &3!{8MIDAT%TuP&71"!Ez`!Z@ :_w ӳvnf \Y]sZKx2~u\47Fqn pɳRzO0-c7+%I!ȸp=@fJRʫ~tBл+1!Fmu غ)7ggNSϵӦY@Ļ7f>aC)JC)uDd~tooE^bqr(r ѻEE ՜?U5PKK۠@@ *c_:(HU_@bIAf+PY]:&f7\3xsi IxAP[L+0ss7;z'fE..9:2uS7K/,<ר8}[vnµn6Z:Q懿j{?)<qrjC,TCP>V j]|Px PN HA@Gxe~S/(@|IJ4D~?3FN}W r : o߶+q-+)=\k5;d8صzyQ7#SRx˷zNR3={H2np#ص;Ϭ.^c)=Ǯ*+F-p\{܇д'^ܺ+„zAz6I]εn_/C2O '3Ÿ`GC{޾0:PÚQmLu_H!WSGk+J _ __Į , AvQϋqVn!aHzŋIk8%y$x}"WaX?6wYY:j{XkNcf7*/zFƘnf3{T48% f M7 3_\ȍd=Yz-AߧGKA(ULnDVC1BC@va9@̷ `?e Հ!WDi!|5uPjESC"H O`kNtm{f<3vk[g3]۟eZiVoeJ;u奫~C-;ux5Y={ܧ&w``$k7=BD VʶM'l' 4G ]h@}2Su_1E]<,8R\`( @aʹ$ 1G~Ҿ@HM<:=rE:( ez^*p*a; TƐHJjxȒiR%k(7Κ ir#rݕgwL zFc-Sbܼs]Ǯv#508qر53Xߴھ*WuDs,;(y}kscr} Q!ERW`;NL)1p+|NQbc 3*(ZсX-9V+CA d߂KȁU Hi әgpk̾('g%Z_z_Awh`^&<sMpL 2&ӳej1#fpJ>&=Um7P|I CzoBa](0 v 95B&,%ԁp#} Ó'0z*@ o6"HF)DDR$I !m$BJ)%IJ)|*A 0DiVEcaI)-5#߬..\ȮžQ)IARHՅΜ<3?h{4I$@ܮ#yDmwi_QJІD݄?RGjśof)5Q J$E(Dp$R ! B#eYp~55䜤'wD̠@4k Ճا)>EOl (5[y%"ȀS԰蜑(Nii"O ۃI=<Ȑ0踡w,u@Q ,s> AE]T۔р1_GƐ# Rc AOFX %t2Amsك=*[-a@b qj+B?L}!1ajH+LEV`oRI$)Dp1,E9MVBDLd@L`O*Sp؄EZ$RR=!`C H*>4#zG0t#G#)} V1[A"0`)j"J$HcLJ ?L7FLy(B){!NT@PH}IyPY?EFzO|Uc&w"F?(1. ZK>lw&ך 1% xܰ6j:})}2F@ƙ"0!_ߌ݋1P ]ӤLM%! !g 6Ҳ66(bGXOi+ΫK -?%q gBl5ocC`$#!X;`b  2AxPrI1iix{Q}#Ҧ/bJ(vh"Ird ~P#! >W'<)+ \J:(p? ['v&ĐRBD|$A~.o'n 4 ;v->~fdG.d`26ȺU=| ԑ$* e͟ӷ 6L0/@T 0_@ {0Pc\1_EnH X;~;bT9_1KUnJ(Z,%b|a4c\6A5AOxOaq|QdfE3$An?)|;AJ !")"L!;cO+LXƄM%Bs?$SфٟW680YRXS3aK w3#H nD 8c*/ @knBឨ5ZjlXPM1R}R'99el*N_   <jmeBϼ j0JF@$m"FC/ҡܝPX~ԆBu"q/=jc)^hdhiD209;Um@%TZBlڴW_kDABA}!ƞXO!&IFnCPN8H v_Q Hm*7pGH~LN+I?δjH L‰MX/:tvs+G{N*@D"^;Ɉ2%II0d|)1Ik@;K$  |M"Rnu D8诓,c, zD,岀$\ǍIEw j)?_e6,(PQ Wn?(5F$1w"<2:AFBi{[yR5Gg> Edd@,S_q A?;.ҏt mNN K)R ~ee %?m((" 7 DB+U_d] B"Fc~sPY;% 1<Tvn3-)۔ #>Cľ@  OR*AUbΏBRtQvǧTq2/&C Ca0ZM񙜬Z2Dx~IF 7T,P7n@QPF/"Q.u@VRD+ҕ@؏pG<JPAHU*>v6J|qw}[mf7_%) Ԥk+'U@LxACM8lU'~S!@dQ11|†oa'H$/F} ?OV@n6rJ L;^"FЛP8އdT bY;c^bU$?*1q$r\}PD]!Q[4}z#O0y3 !FE0 ՅqH"*&Lha x}Ah mH5婃6)nq@ZPvFـ@-& %^=VU<5ƛDT{ iotm_P} <$6md'% kB ğ})OjH) wK{c?>g TԘt?:($H'8; 0>cKt(eQAA*J%ahG;Sc@erJ/m -[vީ_ bըd&x HFӧɫǁR @ . D,\q . 8#ر/uPaS|LXPr2@L+گ34 B@*c%2Ϩ ӏ%"_"D=_WIY,CO'ۿnǷ@Vdt;q@u;ਃ_Rq Z^v~U0*R~J'eT@aÓt:(o}/>%]{Bw:(ȑv|x/`z>g:#ExDUBnR Database checks
next up previous contents
Next: Data scan functions Up: API Previous: Limits   Contents

Database checks

It's very important to keep the internal instance of the database up to date. You can watch database changes with the cl_stat..() family of functions. 
	int cl_statinidir(const char *dirname, struct cl_stat *dbstat);
	int cl_statchkdir(const struct cl_stat *dbstat);
	int cl_statfree(struct cl_stat *dbstat);
Initialization: 
	    ...
	    struct cl_stat dbstat;

	memset(&dbstat, 0, sizeof(struct cl_stat));
	cl_statinidir(dbdir, &dbstat);
To check for a change you just need to call cl_statchkdir and check its return value (0 - no change, 1 - some change occurred). Remember to reset the cl_stat structure after reloading the database. 
	if(cl_statchkdir(&dbstat) == 1) {
	    reload_database...;
	    cl_statfree(&dbstat);
	    cl_statinidir(cl_retdbdir(), &dbstat);
	}
Libclamav $\ge0.96$ includes and additional call to check the number of signatures that can be loaded from a given directory: 
	int cl_countsigs(const char *path, unsigned int countoptions,
	    unsigned int *sigs);
The first argument points to the database directory, the second one specifies what signatures should be counted: CL_COUNTSIGS_OFFICIAL (official signatures),
CL_COUNTSIGS_UNOFFICIAL (third party signatures), CL_COUNTSIGS_ALL (all signatures). The last argument points to the counter to which the number of detected signatures will be added (therefore the counter should be initially set to 0). The call returns CL_SUCCESS or an error code.


Cisco 2018-09-18
usr/doc/clamav-0.100.2/html/node40.html0100644000000000000000000000475313350521603016124 0ustar rootroot Supported formats and features
next up previous contents
Next: Executables Up: LibClamAV Previous: License   Contents

Supported formats and features


Subsections
Cisco 2018-09-18
usr/doc/clamav-0.100.2/html/node21.html0100644000000000000000000000455113350521603016117 0ustar rootroot On-access scanning
next up previous contents
Next: clamav-milter Up: clamd Previous: clamd   Contents

On-access scanning

One of the interesting features of clamd is on-access scanning based on fanotify, included in Linux since kernel 2.6.36. This is not required to run clamd. At the moment the fanotify header is only available for Linux.

Configure on-access scanning in clamd.conf and read the [*] section for on-access scanning usage.


Cisco 2018-09-18
usr/doc/clamav-0.100.2/html/node18.html0100644000000000000000000000644313350521603016127 0ustar rootroot Obtain Latest ClamAV anti-virus signature databases
next up previous contents
Next: Configuration Up: Installation Previous: Reporting a unit test   Contents

Obtain Latest ClamAV anti-virus signature databases

Before you can run ClamAV in daemon mode (clamd), 'clamdscan', or 'clamscan' which is ClamAV's command line virus scanner, you must have ClamAV Virus Database (.cvd) file(s) installed in the appropriate location on your system. The default location for these database files are /usr/local/share/clamav (in Linux/Unix).

Here is a listing of currently available ClamAV Virus Database Files:
  • bytecode.cvd (signatures to detect bytecode in files)
  • main.cvd (main ClamAV virus database file)
  • daily.cvd (daily update file for ClamAV virus databases)
  • safebrowsing.cvd (virus signatures for safe browsing)
These files can be downloaded via HTTP from the main ClamAV website or via the 'freshclam' utility on a periodic basis. Using 'freshclam' is the preferred method of keeping the ClamAV virus database files up to date without manual intervention (see section [*] for information on how to configure 'freshclam' for automatic updating and section [*] for additional details on freshclam).


Cisco 2018-09-18
usr/doc/clamav-0.100.2/html/node48.html0100644000000000000000000000400213350521603016117 0ustar rootroot Header file
next up previous contents
Next: Initialization Up: API Previous: API   Contents

Header file

Every program using libclamav must include the header file clamav.h: 
	#include <clamav.h>


Cisco 2018-09-18
usr/doc/clamav-0.100.2/html/footnode.html0100644000000000000000000000675313350521603016652 0ustar rootroot Footnotes
... moderated1
Subscribers are not allowed to post to the mailing list 
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
... UNIX:2
For Windows instructions please see win32/README in the main source code directory. 
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
... framework3
See section [*] on how to run the unit tests 
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
... support:4
if not available ClamAV will fall back to an interpreter 
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
... gcc-c++.5
Note that several versions of GCC have bugs when compiling LLVM, see http://llvm.org/docs/GettingStarted.html#brokengcc for a full list. 
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
... built:6
The configure script in ClamAV automatically enables the unit tests, if it finds the check framework, however it doesn't consider it a fatal error if unit tests cannot be enabled. 
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
... file7
To get more info on clamscan options run 'man clamscan' 
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
... file8
man 5 clamd.conf 
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
... signo9
Remember to initialize the virus counter variable with 0. 
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
usr/doc/clamav-0.100.2/html/node51.html0100644000000000000000000000427213350521603016122 0ustar rootroot Error handling
next up previous contents
Next: Engine structure Up: API Previous: Database loading   Contents

Error handling

Use cl_strerror() to convert error codes into human readable messages. The function returns a statically allocated string: 
	if(ret != CL_SUCCESS) {
	    printf("cl_load() error: %s\n", cl_strerror(ret));
	    cl_engine_free(engine);
	    return 1;
	}


Cisco 2018-09-18
usr/doc/clamav-0.100.2/html/node47.html0100644000000000000000000000542413350521603016127 0ustar rootroot API
next up previous contents
Next: Header file Up: LibClamAV Previous: Others   Contents

API


Subsections
Cisco 2018-09-18
usr/doc/clamav-0.100.2/html/demon.png0100644000000000000000000006135113350521603015752 0ustar rootrootPNG  IHDRZ= pHYs   OiCCPPhotoshop ICC profilexڝSgTS=BKKoR RB&*! J!QEEȠQ, !{kּ> H3Q5 B.@ $pd!s#~<<+"x M0B\t8K@zB@F&S`cbP-`'{[! eDh;VEX0fK9-0IWfH  0Q){`##xFW<+*x<$9E[-qWW.(I+6aa@.y24x6_-"bbϫp@t~,/;m%h^ uf@Wp~<5j>{-]cK'Xto(hw?G%fIq^D$.Tʳ?D*A, `6B$BB dr`)B(Ͱ*`/@4Qhp.U=pa( Aa!ڈbX#!H$ ɈQ"K5H1RT UH=r9\F;2G1Q= C7F dt1r=6Ыhڏ>C03l0.B8, c˱" VcϱwE 6wB aAHXLXNH $4 7 Q'"K&b21XH,#/{C7$C2'ITFnR#,4H#dk9, +ȅ3![ b@qS(RjJ4e2AURݨT5ZBRQ4u9̓IKhhitݕNWGw Ljg(gwLӋT071oUX**| J&*/Tު UUT^S}FU3S ԖUPSSg;goT?~YYLOCQ_ cx,!k u5&|v*=9C3J3WRf?qtN (~))4L1e\kXHQG6EYAJ'\'GgSSݧ M=:.kDwn^Loy}/TmG X $ <5qo</QC]@Caaᄑ.ȽJtq]zۯ6iܟ4)Y3sCQ? 0k߬~OCOg#/c/Wװwa>>r><72Y_7ȷOo_C#dz%gA[z|!?:eAAA!h쐭!ΑiP~aa~ 'W?pX15wCsDDDޛg1O9-J5*>.j<74?.fYXXIlK9.*6nl {/]py.,:@LN8A*%w% yg"/6шC\*NH*Mz쑼5y$3,幄'L Lݛ:v m2=:1qB!Mggfvˬen/kY- BTZ(*geWf͉9+̳ې7ᒶKW-X潬j9(xoʿܔĹdff-[n ڴ VE/(ۻCɾUUMfeI?m]Nmq#׹=TR+Gw- 6 U#pDy  :v{vg/jBFS[b[O>zG499?rCd&ˮ/~јѡ򗓿m|x31^VwwO| (hSЧc3- cHRMz%u0`:o_FXIDATxw$UBwO;3;ld%gA@`%# "^0 /xD$HE%Hq4&TUTuOuuuO석)v:LOu=yPJ!BZt "D!B"D!B"D!B"D!B"DD!BD"DD!BD"DD!BD"DD!BckW<䌐r0ʽ:!ܟ5,2!(Pm3CK_Y i2RSECvk%o{pL▘!Em ! lމp8!C`$߮I!k|e` N R^x0'M@o܃N%@tjI?Z]jnpn$7Rբ\ e l}ڴ.)z_޿_Zr%} ?}s/t\j0lFA;Һ@L}@h}OXi`>?0w 1-r/%Ol*t F@s//{?5ÁӦ tS9^>}{ pqniNS%Շ ׹͕+3S_ ?Ys)6{Sa >p,SN "`M2ErƧ>'3 $q}3㙶4N1ڽG{q[ 2:b2Ph *xB 4b>bmn/G؃ɔ=@ԤA(\=QOs| $,Us noJd.' p;)(4X5*ӆu&ëXԆ ق%z Ҽa=~wl7;l@IL4VN+R6;H3T:Q]Ȭ!T#LуYg+{5 i6T{8wZ!3ŬǸm?/`q0WEEӝ}a?SX4rޭp뀯>|Ў8$-jX䎞J&UX ̄9D_&XܼtI N- [IKZ!~]n%5XBѕBDtHIxegPCbfRz q p7nhE)}5_d2YX x)"' `ŭ2:+e97-8 Sw/"$cs5X\GyŐ]hDpi^Ţmcq .ھFpт;.fOKJe$u̐2@l.w̫1I 67⛚[_ıwy'8i7T#F24#krf_H u2kXT ID;uʭFgwJI^ Oarx4"z!IUHnIbT7=K 527(g ؈פ 3ΗZҼE]eZ0)n0pIItX[S`%)N qGG۪U ny :|@|vA+ZWz)zczl~#4gIfeWи/T%vVh]4&QX}6p*wKh0ܻSdi( FDƷotЉ:Dmq *cy$b,{9Z<Uc2 6pivpGj<% y4uҲ{p2US5@ۍ #0a!J2 0@=ۊxыwO!I@||[;11n4 hޜ?">5 !Uޑ~Std5k{T*D:Jޙvf;# m_(]L~T 5{Oj3#\K9hj!r~KI^DZ} ^)9#ˎ")c裃[:<8 ,D5!Iei`;:{$9=^˝ʤyUe10FM~!%L,4{S gg'vp0GEB8#fgV22 7 F FHJE폟i>z_;BAHk""V΁kPc꘦:a':arP:!8HqrEΈ"S AӉ. meYEc9+*rm d=K|]'q;JJ6/be9Ka]is[#/[q$f% {q;Y3ےhS )cg$Y8Ax$}r0pg7"4~D0 hZ|:]n$_cfܾ1yrgKJޅ-iqn_a#Ȯl)Se;UʥњBsUJG}6.j{ z憔#{=Z!n%IU7WUS*_SY xʡ;H)9@A7p'n6}4'c.7#EQ9&l>գClUUs1+'=W 9L$ϭ~RͶ6;GvWaQO}H&MBxHoAc WA(7̎,ۦ_gicܔz~"S<ͥZ=cE66|z#ϒrXF[3<>X|$^A̶R)^elemeWJMHиjjaK b" mcRҭH&|FG'97 ɢ ?4Gڇ@~5'ڒKzJo&i1 NJiD05].0Inj|!桳JqcO=FJJM%3A[qM|f/8YV;6n\J͏c;WDW6lh'|Eq5SUYd=}f 1 B NC $VM3뎝ofW!_Ȓ\kLuҧ|U*)"@,2դXAʃ0$o7dHIwh)}E"Oj[qx"Vd/-2 =*=K4J<*h9 *Q_a#,'Us PQ[ڗr捺Ɓz:-E&x7P %bQG&t]QnArbg`O=FRs(q1[l"1v }Vt +X=9U{D|5;qx"TEjoR `u 4iv)sD{iS'M3Rfn@01D72w+Qi ZGbRB+*=`U#Xͳ84Ln1b ڈB|QC|sjf|FѨm\~zBz` D\s}fq1O'f[Y""[ߏgiF{@O(0F/|clUKB]j g ij Z1aE' EЩnN]1p+#o% HѼL9@ZI3M ergI Xu V~*(VhwrӮ*9k;8$\,xq1ۯ|b_< *4vFjoi ArV ##/e G1bISKJ6+W FX511d;{bռUѩ& lv^-zhD>a$Nh^%٨=2ٻdox4S(q71 +oFܑ #O@+8%L_:iƱb\_xwośY1mu;Dr8"VŷutIgi6œҢO9$T ED?GIgNhX`g@(86": Q9Iτ&X";&P{f -Js?Wuŝ56o KYDbĀ|RJ2œZ^ ȉ]7"=rp#%ڧdzqN} {S7Tf1aQI\Uu|4 *fȴd'0Lrs,3ߢ*E򠥧qѵPh ˬՆXfR0n!!\V)w8XljMoP[:&p"hJ@^ u&\CtʥRO%K/i.asx%4\:-ipW騔0(ņteS,'0`2k4bZ[FTZ>e8T)){)s.p s ,B4(G_ #{nTI0qNwށpmN-HNƔdscQ,)7ioLi~y5rWSI%CGu\7"%gfR8Y ‹4|ס,5o=JR`&h#f;N~,|r^;Gֽšt W-id3 wvl4]yѡ^NY [2i*"4Jm <9ywAX3@@6C yձuVjf1C^8?߼zMU l/vlGA7xGM 61ͨH{?UӞhq0Yi^Q6un\xB0T>'CL𦧱s DצeT Cqq"`־" Vhh:FHlf0d;y5HSg ]i5ctZS)C&GB^7c[VXG Lm}])S<3Q#=\gX)VJѵy3;;ijnC6XdbnP'fJMX~,)žω9>-/4Q%,ǎ,) !xJ;K@Httt/}믿#ۺlKʲ)WOnX YC" (KR[81,KAڵk9øYr%<~:׬ad/(7&XY|J^KBʹ9צ:{K +Y1Wv+дFa-oy 7p_8Yz5]:KtYHJVa-"yzdwo]S楻sʼbeHϰKEGpɢtN$YgOS7,.Z[ЩwY#1gh%I_o/Vbٲe\wuz뭼]b,[+;5kְȑwYo>vi~vÜ۩edcN s\QzVK*c񸓥^#%k׮ַʞ]wUW]Œ%Kx}*, Bpyv]6;it'mccQܴi>iYRfıh[c9c.0yZS|+[xՋh,:555G?O38_~9sׯg>+IЊ檌hsGAfѡpL0d`@CaʃV^ ֯_QGe]VwK/UWR0;sS\㒞>ԋ>F*r,uAMteӳn Jpvq4M &@W;1hYTk:7e9qfGh W¶m.Bq\J:,֯^0EBn(}u\֜ 쀂M3BMa{S4# i{ džp;1zqnj]#$L!L'x+VL;\}\~$ISSWfbhftB+-i#иa鮼q>]VzVZᔵ/c)Jq,Ο_ Ffض͇?a>Os|9#YOU_)lϝs(i6?U~Pp̿f=$ />j1cڠPzp<(#!aYSʶXĕ&9+Kx'9sD2 LI p^/.&ٍ\+;ڸyh@+uz:rv39yMrV~b6F*]VVrd{ k} yNh\ ʗ*v{}}p|m͝wQGE__mvΘ-̯˵v[nl wkB IH͛yӁr-ps衇np nZe%J [cD(l m>6!auTV HZ=,="W8sxGp9gces#IKIF94ᙵV,s-Z,J*׿wON>)/ZDv$vkZEܿJ}"gRkJk;c ^ϛCtm 7*iYIto;w6@J|m b ,i=B//y8Ni:J)&sYx1e$[+cdn|Uj?z8VU2\4 mT=RओNb޼y^}U|e:eǚ/F:MB7lOqղ4 0:s9I$t'Gxݶh`)SLSxI\P " YHIzFJZwnm;ONj,=lLd,N 1r{0P/um2T֣,n&\riwēN"q3/m崹X;'.>V)ȔJ) P &e;6瞓2 \{ͨt]l۲袋袋Hm܄Zu~Lr}vS0A̎~`͆]rc0mr~Ǿ=`lv,rT9Yi?E.aaN]}lT&X63tFb#IsG>b5s%_O86lՍ8'>^Yi@l `WT/gzWw'o~3s7wukXc{/Ws;;]-U\[9 }n]T/gn^cqm]z)?x>@/y#i~ 7vO(aR3i#$H=LlP𘿶TI_73HRnB*k /"bymY9Js5_L{]-xeY=vZS#fV.Bp56p٫/Ҥ[__| hj+ެd%B+஻bㆍ~;Î;c,TJ`(;'a+@"KO:lfhhhҾ?j#Q$s1c~NKK ~NzIe)UYL$n|a /v͛ϳ;.-9AX5۲y'&꠺7r}> 6,hoxW#BjW?oHI"'QU!5)'㏕}O`…ފ+w+O=G>q~e8[I5@NBhl +կs)𳫮b kҏ>h.]ZVjw}wJNFol)UH0Xt9(oc9ǡ1+ʗ+bZojut]GeYM{<㎝\_Βc/=wx!%^G{BAfNY|d 9ù[8C՜~+1w}QedxAlHA&m*)c6G*]VxM NVwQCgg'X CĶk#r)kơʿ| 6k'</wmUYhttGy`׿桿??Ψl89~z_h Q8cǠrkH{vv:N&yW? \4-.-Fx3*嗳眃oimk-Sc #$ ,F*E'#GNhNlgyJ#ӽ+K5[rw;YK 000%0 I%>~t 55vqꪫgpw3m!1kT}vqL$L?dUe,m$:nR 6B[.+fv:7wFpz.jj['; d~5mYfl-3O՗`}YGfɲe=w\QgÆ$&PUUEo_Ͽ6#%CZR299ϭ}.騌3G€ ;/s$gMШ_4fA2bKO->Ѥg hq[~n p_GogyFooGU+1@Sctn^2㽇M7퟿^ay:6Lt41M?8e~`{0BvëG}|G;kWՃ~TZAfw<{az{{FgΖ-[H_ZzOr$kw}~>TTwN=JBP't|%Wvzۜ͘Yy2U۶ܼ98 /WWũ4ۧɃ)[' 5>p{[XSAQ .p=Uf͚!@46mD&y+]t1mmmSvLf+.?NOOIk:d.kpsnmm-oy˘t\kG)6mDֲ/t?/,Jg1 cڄmX?T.d=^\* ĩ|DY`fbv4 qظaC4SҬoIWU @a0_g/z3>9[9ўs5 {R?aL@*EsSϾ"y'/d)4v^jaXeQԽ4$4QMxIJ2O39﹛Q[SSpu]'Ͳz"(ڞ9d@ol q;QT3lڼ+pg?iH4zzzgVtMCx# !_*hO C _d"tߕ۪isTMK+[[3+<#$ mڸ",lm܄5#6 U q4Z``ժio83.ר\줳-GO_+Y5isU"CRV~< ,"z%+Ex W wͧǹh ͡Ͳ$(,az~E\ ؆Ɩ{V{n{\F6mHo_a]%444ѿɉv"P\WdXk =aaS@4i$Uf#uWw`Ꚛ"%%7n+T Յ0WT2}&;1iZJC{)x%ZZZʚad2l``p%OqOʛ-iAabW[93]Y  KADFNپ[=?h #>V475k.xyţ͛GScӴ]6EpQZ7TRדJ0}$7ʕs"Rh)| #y0g~04[ptgʅNd_HXeoX Vid36mHd|{kk+,*f=;H 3 HHg&=7xѢk:l6ƍټy3Jʢ}KWvXDC,F NqU Ν϶{ER 0E2\ܐ:7ٯ~Ձt[a 4~֭[Gww7i'mKbC_44c+UY%ihizQVuz-ŋ 3ǢŮm֭]ˠgkV n3\LۦN7Aη,;!94Ȧ KH0r]+(.UH;|vWͅ J9“wå? 5UUQf/Pn:vء(;N۵ixj[Zdzndg9uIR_/­7w,Qa_ᄢ[ouJ:ED/6{;!7)A`p.iKw#zsd=(. dYIs-eQ o\uA*RԄ&b򷴢bMؖ--[_̇-g^[o35hN"-FP4g>A~+8S"NYd͟a#?_D%gjږͺ}]Wi8!s4k_Bk,As% Ā,ۅ'yؙgݍ۶,aw%]4MWhyii慗"/,ri'O}7(Vp'yG.{;0쑼"-JLgz]bI(L1:`B9DpHErh:l_į7|~>H$%T +*oG*k@nXF[K ׯ̳+λ0 H>@LʿFT-6SoŸJYZ6M)Đr[sJc /y&TWU~׶ijnN.2?ꨮ7 LJA7,:Fz|uNe-NY~m4׻-eS~qν;y85G?v4O=IgţO' ϒ)Z_/;Ȍle-H%$\6_*ا^ص4۰r[79Wk8k_:mmm4QhG_ŶmO:cϧ.O38UUK9X/X~w@9,E璥mG.CAKKKU3yKs344ẅ́465Q[[5^˻N;ի.{`@EERkCk \`}~9gR[Jr71\ 3s镠!XaVqHTpo˩E]s=G,Zgy׻ I!a<'8t/Z-}f5#’ %8a{;d=N{z4a q%|xzCɀ<3imiŲ,R1o<^5>OsL79X"t]p"w.\ !+ll ]:kE6?+mkrg'moIhtf5p7;Nq^455O|ﺛ ;GMtK:3nzxwډ ުW3"[AiB@=M\Y[}=#O>90|2{B2^Қ08 >xDk/Z[[1M2Lފt}UWU184̡Ɓ=wÆ^}Unv62{/j&YNyUU<=# l M/>}h]jd^xD z@3j@*X#-^sa$5 Kum-;.^B6e57@mmhMt7\HŚkyx葇yըl6vLTsP=A3,M,*>s&p$o" M:Љ ao*Q>`* z& ԭ3rZQ(E@s蕊bte3,*{hkme<QVX߱T*Mֶc& fRҪj17htRbxu1+J5NvY^ΦYaˮqGv}7V,[NKK 3Mr&I{zزe >$7qt ;vūh bFCL~Gf =@t*o;f܂NǢSI6K.M*%ee, l fh4&إ|Mcf2O1@,ⓡ`$F;6xBn]:˃lJ%AבKJZϧv&wK#QJѨ`fKU&GȬdBJYKdw/|c~iD x{0y! I  A\?^GH)IR)̀J#H:U4MAШ4t -Uq8Ee4y1Ga ARJJ2Wlq$!-4z)c#^:Ӥ.Yhk:BJ30RdX&B|t6D_Irp}VֺWS$<,#B |'@S^y/~ D$"lL:Md Asڑ0 ;E DEӌk{!j]h 0GL jJD.ʩѮF/y?I&1#1G2Ub_>RȀ@qBz $(NL 5K\J{W]㾔ŏҷ\sNɲakjUvbs)q} 5s,ZW[^F_F[,90Gx\ ~ % |z.1޸,c~o4d/r'@`T`?9˱{%pFDه?8͖h|xZJyKxg@@hgߗ{]>/P@~b -)jׂ. !ߔG>\|qQQ?{G5JPH"O8rZ / /|}*fvX[aɏWmۇ%w)R 'm9s>,U"$\LGxn-'`aN|a\U U4@eL[rpioP24 FdQ$+'>˓x" OWF&/ln.hܢ;U;GMEY©ϙѨv|~yP;k>p|&=_.B* u)a*x&J|]E{PrkO΅?gdǁ'G(=bj:=@z-t_N+ )3DF$UB@~W+AJq[㣏Ev?Z{`%t@5̜s޿wh2"v}-`OkwTßfSy+B~StW>A#B *҄ivYg'˿c(N_ e*"v op#p$vowJ,4٠/4ٕGԛ( ԉ\}EX T-p՘9%H, ݓ\:3* o^GDУTBHZZGSeFysYB N`[PWivU&WsItYjg?WُEu癋"=X-W\spqZ>X(-Bs2 RqR?a9I]NO|)m8w.Ltp7;QU“@3JJTN4ߘ\OxUFpaQtYƿ4֦* IN@s+t Xq0ՃX>׉[(xY ^˛aZ|T f D|:L^}rfwr)\YVarawHߋ9<}ntJdV>=LZAdr9x>܅&(ObJkf%:!ڻ(?VaMP4y=QpeAk18zj-LTĉp܆P\\+÷VDҵ9 O^tDRxxh漿^^,`+VV!5Ǟ`Z\R[4Yc|,2 (H'KinKߍVjD@+*ՕyjBM^z{%uUNsOSUHnrJ7JhnJhoC&S}R= WeoX"Z6wB,ʘڔŘ~ɭJa]„5'eS;a"#oKo8pU'i-CuY/B|㠦#,Z؀”{iM^L~n+{qKaD“Rp!9>&pl{F/B\J+´{fB>KC 'hED.\s >'`i 8-·GɔMt@d%C'tLfzC4Kke}&+W7.D,`?t) *8R$d6Ze=KUZߋ??GD>SZ|T.PZs,?q6:AJ;F]K-PVTD-pB`oy_HR,ZO[7]NX#pSt"F8 OoC8VBCV&Åk2Z3"ZGqɋ}CS7`w4D)m^jL\:cciy_^|Xm苖FDk_*nަBL05'h w$h DDKP3ށ*` K?/|TX=gI ^Eځ ZF#{;m 7g4ݠ:ݘ "m=”; <U@7h-Tk[ }D3˼J*DC.A#D=B#D=B#D=B#D=B"D!B"D!B"D!B"D!BD"DD!BD"DD!BD"DD!BD"DD!"z"G!"z"G!"z"G!"z"G!"zs'紳5IENDB`usr/doc/clamav-0.100.2/html/node20.html0100644000000000000000000000511513350521603016113 0ustar rootroot clamd
next up previous contents
Next: On-access scanning Up: Configuration Previous: Configuration   Contents

clamd

Before you start using the daemon you have to edit the configuration file (in other case clamd won't run): 
	$ clamd
	ERROR: Please edit the example config file /etc/clamd.conf.
This shows the location of the default configuration file. The format and options of this file are fully described in the clamd.conf(5) manual. The config file is well commented and configuration should be straightforward.


Subsections
Cisco 2018-09-18
usr/doc/clamav-0.100.2/html/node7.html0100644000000000000000000000406213350521603016040 0ustar rootroot Supported platforms
next up previous contents
Next: Binary packages Up: Base package Previous: Base package   Contents

Supported platforms

Clam AntiVirus is regularly tested on:
  • GNU/Linux
  • Solaris
  • FreeBSD
  • macOS
  • Windows


Cisco 2018-09-18
usr/doc/clamav-0.100.2/html/node38.html0100644000000000000000000000746413350521603016135 0ustar rootroot LibClamAV
next up previous contents
Next: License Up: clamdoc Previous: clamd   Contents

LibClamAV

Libclamav provides an easy and effective way to add a virus protection into your software. The library is thread-safe and transparently recognizes and scans within archives, mail files, MS Office document files, executables and other special formats.


Subsections
Cisco 2018-09-18
usr/doc/clamav-0.100.2/html/node26.html0100644000000000000000000000534613350521603016127 0ustar rootroot Usage
next up previous contents
Next: Clam daemon Up: clamdoc Previous: Closest mirrors   Contents

Usage


Subsections
Cisco 2018-09-18
usr/doc/clamav-0.100.2/html/img1.png0100644000000000000000000000020313350521603015472 0ustar rootrootPNG  IHDR_PLTE___(8IDAT8c` Ta#JE (6 +U: QCG 5t Jvr7 xyIENDB`usr/doc/clamav-0.100.2/html/node49.html0100644000000000000000000000532313350521603016127 0ustar rootroot Initialization
next up previous contents
Next: Database loading Up: API Previous: Header file   Contents

Initialization

Before using libclamav, you should call cl_init() to initialize it. CL_INIT_DEFAULT is a macro that can be passed to cl_init() representing the default initialization settings. When it's done, you're ready to create a new scan engine by calling cl_engine_new(). To free resources allocated by the engine use cl_engine_free(). Function prototypes: 
	int cl_init(unsigned int options);
	struct cl_engine *cl_engine_new(void);
	int cl_engine_free(struct cl_engine *engine);
cl_init() and cl_engine_free() return CL_SUCCESS on success or another code on error. cl_engine_new() return a pointer or NULL if there's not enough memory to allocate a new engine structure.


Cisco 2018-09-18
usr/doc/clamav-0.100.2/html/node61.html0100644000000000000000000000370413350521603016122 0ustar rootroot Graphics
next up previous contents
Next: OpenAntiVirus Up: LibClamAV Previous: CVD format   Contents

Graphics

The current ClamAV logo was created by Alicia Willet, Talos.


Cisco 2018-09-18
usr/doc/clamav-0.100.2/html/node44.html0100644000000000000000000000444513350521603016126 0ustar rootroot Documents
next up previous contents
Next: Data Loss Prevention Up: Supported formats and features Previous: Archives and compressed files   Contents

Documents

The most popular file formats are supported:
  • MS Office and MacOffice files
  • RTF
  • PDF
  • HTML
In the case of Office, RTF and PDF files, libclamav will only extract the embedded objects and will not decode the text data itself. The text decoding and normalization is only performed for HTML files.


Cisco 2018-09-18
usr/doc/clamav-0.100.2/html/node25.html0100644000000000000000000000602213350521603016116 0ustar rootroot Closest mirrors
next up previous contents
Next: Usage Up: Setting up auto-updating Previous: Setting up auto-updating   Contents

Closest mirrors

The DatabaseMirror directive in the config file specifies the database server freshclam will attempt (up to MaxAttempts times) to download the database from. The default database mirror is database.clamav.net but multiple directives are allowed. In order to download the database from the closest mirror you should configure freshclam to use db.xx.clamav.net where xx represents your country code. For example, if your server is in "Ascension Island" you should have the following lines included in freshclam.conf: 
	DNSDatabaseInfo current.cvd.clamav.net
	DatabaseMirror db.ac.clamav.net
	DatabaseMirror database.clamav.net
The second entry acts as a fallback in case the connection to the first mirror fails for some reason. The full list of two-letters country codes is available at http://www.iana.org/cctld/cctld-whois.htm


Cisco 2018-09-18
usr/doc/clamav-0.100.2/html/node5.html0100644000000000000000000000423313350521603016036 0ustar rootroot Virus submitting
next up previous contents
Next: Base package Up: Introduction Previous: Mailing lists and IRC   Contents

Virus submitting

If you have got a virus which is not detected by your ClamAV with the latest databases, please submit the sample at our website:


Cisco 2018-09-18
usr/doc/clamav-0.100.2/html/node14.html0100644000000000000000000000432713350521603016122 0ustar rootroot Compilation with clamav-milter enabled
next up previous contents
Next: Using the system LLVM Up: Installation Previous: Compilation of base package   Contents

Compilation with clamav-milter enabled

libmilter and its development files are required. To enable clamav-milter, configure ClamAV with 
	$ ./configure --enable-milter
See section /refsec:clamavmilter for more details on clamav-milter.


Cisco 2018-09-18
usr/doc/clamav-0.100.2/html/node58.html0100644000000000000000000000415313350521603016127 0ustar rootroot clamav-config
next up previous contents
Next: Example Up: API Previous: Forking daemons   Contents

clamav-config

Use clamav-config to check compilation information for libclamav. 
	$ clamav-config --libs
	-L/usr/local/lib -lz -lbz2 -lgmp -lpthread
	$ clamav-config --cflags
	-I/usr/local/include -g -O2


Cisco 2018-09-18
usr/doc/clamav-0.100.2/html/node6.html0100644000000000000000000000427313350521603016043 0ustar rootroot Base package
next up previous contents
Next: Supported platforms Up: clamdoc Previous: Virus submitting   Contents

Base package


Subsections
Cisco 2018-09-18
usr/doc/clamav-0.100.2/html/next_g.png0100644000000000000000000000036613350521603016133 0ustar rootrootPNG  IHDR%wu PLTEooo+tRNS@fIDATm ! E.Q2# 2J颓β?/cР)fZTU39NP5Rsܪo`"Rƾ9Wc8qBbŀd(ZP\:r^aEKoIENDB`usr/doc/clamav-0.100.2/html/clamdoc.html0100644000000000000000000001404513350521603016430 0ustar rootroot clamdoc
next up previous contents
Next: Contents   Contents

Image demon








Clam AntiVirus 0.100.2
User Manual



Cisco 2018-09-18
usr/doc/clamav-0.100.2/html/node37.html0100644000000000000000000000515213350521603016124 0ustar rootroot clamd
next up previous contents
Next: LibClamAV Up: Output format Previous: clamscan   Contents

clamd

The output format of clamd is very similar to clamscan. 
	$ telnet localhost 3310
	Trying 127.0.0.1...
	Connected to localhost.
	Escape character is '^]'.
	SCAN /home/zolw/test
	/home/zolw/test/clam.exe: ClamAV-Test-File FOUND
	Connection closed by foreign host.
In the SCAN mode it closes the connection when the first virus is found. 
	SCAN /home/zolw/test/clam.zip
	/home/zolw/test/clam.zip: ClamAV-Test-File FOUND
CONTSCAN and MULTISCAN don't stop scanning in case a virus is found.
Error messages are printed in the following format: 
	SCAN /no/such/file
	/no/such/file: Can't stat() the file. ERROR


Cisco 2018-09-18
usr/doc/clamav-0.100.2/html/node33.html0100644000000000000000000000607613350521603016126 0ustar rootroot Freshclam
next up previous contents
Next: Clamconf Up: Usage Previous: ClamBC   Contents


Freshclam

freshclam is ClamAV's virus database update tool and reads it's configuration from the file 'freshclam.conf' (this may be overridden by command line options). Freshclam's default behavior is to attempt to update databases that are paired with downloaded cdiffs. Potentially corrupted databases are not updated and are automatically fully replaced after several failed attempts unless otherwise specified.

Here is a sample usage including cdiffs: 
$ freshclam

ClamAV update process started at Mon Oct  7 08:15:10 2013
main.cld is up to date (version: 55, sigs: 2424225, f-level: 60, builder: neo)
Downloading daily-17945.cdiff [100%]
Downloading daily-17946.cdiff [100%]
Downloading daily-17947.cdiff [100%]
daily.cld updated (version: 17947, sigs: 406951, f-level: 63, builder: neo)
Downloading bytecode-227.cdiff [100%]
Downloading bytecode-228.cdiff [100%]
bytecode.cld updated (version: 228, sigs: 43, f-level: 63, builder: neo)
Database updated (2831219 signatures) from database.clamav.net (IP: 64.6.100.177)
For more detailed help, type 'man clamscan' or 'clamscan -help'.


Cisco 2018-09-18
usr/doc/clamav-0.100.2/html/node45.html0100644000000000000000000000456313350521603016130 0ustar rootroot Data Loss Prevention
next up previous contents
Next: Others Up: Supported formats and features Previous: Documents   Contents

Data Loss Prevention

Libclamav includes a DLP module which can detect the following credit card issuers: AMEX, VISA, MasterCard, Discover, Diner's Club, and JCB and U.S. social security numbers inside text files.

Future versions of Libclamav may include additional features to detect other credit cards and other forms of PII (Personally Identifiable Information) which may be transmitted without the benefit of being encrypted.


Cisco 2018-09-18
usr/doc/clamav-0.100.2/signatures.pdf0100644000000000000000000037267513350521603016073 0ustar rootroot%PDF-1.5 % 3 0 obj << /Length 1197 /Filter /FlateDecode >> stream xڅVMs8 W3+O2Ii8n6i;q8=m3EW~AN2{">>tf8aB?Nbڛ.{4 e($i;0\VR5K]> 7;A><ԃ 9P(I9n4U&Λ(]:֣O9g,欚\ʽ[OUMX,Er+2(ۣSti*eY XʬhrZ Va_;K얘w}TJ>0>aj?bM׎l-ELz6Q2,9ͅ~ gȭiB,zb$va fѢQ0pJ<6rU 0*.[wM٦(w^Dd*QGcl-ٌ\Gb4AgSYm$>.uh T]$~ݔz[{u[ ЍqSVf&t |A.^1s bk36u5lafSɕGU8n 1lƉ/E8eFH3G-E:s)wa#(2o,5[pn#^LVSdمvECIQ"H-,k;Q<|K0|wrϚaVr}&oI:7ߓmn/˔Ɋo/ m>ד_]yϻ82,n>-J"|Ʀrq}N?u:ta}u®TTDó+8kT{5?׋7MM'Mmdfp+E1mP즶n[5_czJ]-- U&ip(%BhI|@2B}<|f{I~gwAHQD2z*fT=/hKlP*Ԣ1X^*O,$NlzFUf?7=?S4|w` [ I.n m>:Kq[tu8>`#_AMԅMhj((~<`i endstream endobj 12 0 obj << /Length 996 /Filter /FlateDecode >> stream xڥWAw8W|0-m%ɶA6$xJpl3# H|'A y>4$1Ilͣz8Q5#c!F^.+YR+J X6aBx_A%u7f\˸B%- .VfÀ1Jj)3{6 8q FAGQ vقďIbFzՕ+"~w"Bg6Ҭܨ.! JY>1MiHdT>BJ\of^+ơZdB37tM\|~H [S /ֿ_>^^0_+j)Tג9J6nu3O npĖu6>1 ;`Ζ{X呋 =VnOWW0\78R4͟u`:= =9%H5iZnZ%s+EL^s3u~KfL)NV4ɉ*W򒋟L3Dߒ\q NbCAOcPʅªԙc.N Y,3O#uOۛ> stream xWo0~_ےI {ktnUúJ1iπ Mבv&Μ;w&kYHB d8l r4/оLθ6&T ̯7|T.-`(~k@!60E]0*x*[5aIV[5vh%^\=xUfk$LO#na%d$`Jr,zⅨH?ئ\wW#y+ * 22I2Ə]&8GmqEϰ0 CO!3 l CUahHp$ro?,^T&aD |~4M~AHm@-T&]7(**~I<&koM5UR&:PV6vݬj2 >gB^qܕWCƾs vp"O>;]?B5j9IaV!eY%<jvL$'@ R;~|'$t+4PqfIeƑx1W}j!yjҏLѷ[zQQ**ם]M/7҇+t_ݕvrJr-RDϨFnt(@uJ0 CCSzulU~n6ͥċRy(>N(]uN]vx%R7Ԧa:g&1d+9cl&nݛ; " endstream endobj 18 0 obj << /Length 795 /Filter /FlateDecode >> stream xŗKS04Fq4 ڙ҃lmH+Y $Ch%YVt4?%;;7N`Qg:_3n"'qҌv r|"O(M_N7_F8fw(@zyuzw}?4kҜR}=/h'sI8qssK"s_fb $Cq ,fFF.{+[ h #r4m \[Ewi˄ y]8sI`وY~:m`L'F>\Zţ%8M\l#EaC֧yC1_C"y.J;5Čx宅kIjl:79F }b|{8]32M?eP)@5V7Ȩ×'=/>r[(Jh .P++l h Ԏr&4U2S~@> stream xWMs6WЙJ3 IiҤW:Ɨ4EIB%*$Ρx\.v[ȯW?Ɍ`%D8[W3 Y"xl.g5^.y{KH+ cB-yqYꦷjX~3..߫6M5S%$}K<ϗޯfUpW+YP57p{,nd:a$gLEN_堌Vgn{֯~}2/[sF~hy)p*X4_Ux/h ]*ܩO٦P{k}G)I"=NV汣;ӡ~2Gfhx>C. ?bE\e蔭 [eFYDAIJDmPE"j{ L JۚRM2\n4b( ӭA). hM2*j./Z,Uiz7mhKdn=V0B[|'W~WpҀ,pu4buyԺvҋBXZ;B(vwmxm(Ƨt'ErMQ#k1t:w}B7ry1v oPliK v.6>$..Bgw-y6J]D({ÈvPtHW-c9Lqn?mc%KW"|H0Dkku@ڨMznx;SNz3p"Jrxz54$V[%E#ln:D| 6$\"TOT;̋>B.by1 cXrﰚP8br A'dA((gie.Gs9r\D4W4X`xq$.9jpZ<[`K 仆p_Ԫ3|7I 欋# ʹM_9XD #YƂ&8Jb>2~Dj zʊc-OGP5anoY OEu.d[kcomvi}R /3.9O .㬈ES\*^pi V|UV O,y",0R_]_I endstream endobj 24 0 obj << /Length 1582 /Filter /FlateDecode >> stream xڝW_6 笠fϖع]+mt@AD-4#E:6,/H) !$Z乸ZXDe]$yy[ )< 'Yel~v1qI9%YħJuD#+yik,h:t9l ]ۭ앿 ij#Nyq(#2΃_zLPB$-i$tx+?wS'V`d/GH X=본b Ka"EVbUo(E/땲.HV F!kJ[i0[^锃'GNq6%1ĸ; a@WB!i!~0$>׎* 33ll>QMη8TfHyT٫./ +SMݑE`½<)ݨdiCXo¾jTn5`0KbPڐbcxt9r&\M1E67Cnݠϡ{\(yhSH?IT)9oFx0M5,ω'gc-D'|g0Iw hJ|؉%K־#];~,r#z@ڪZ==rbbӭc-SE$Dg"= Gf8xvc|֡ުzer{v :cJD1&(րL6 7 @kBZ%iC_*\Q}mIXud6Wsn e;~lal燧zD?IЩ9)Y,~ȿοF('W,K gus/=A%av[J2|sDZAw\g5?x6>g J&QO?>$K/A@8*x*}`f8Sa8MNAi[ΐ)i4ŘEEyu4Vi$)v= 7w) 4ˏ2eQfdoOO0;t endstream endobj 27 0 obj << /Length 1536 /Filter /FlateDecode >> stream xڥWێ6 }WC؋ڱe˗}i6ER E](>hlZ/d%E;3q+J)<Լ!vqRaG",t8׻߼FsO+kpRx'?ƚZ QMfoZ3=^1i^lxlUԼ60ޛM0F Y1@ya bIQyo(9(d'~V~[Ae,% K(Q >1 TQJIwg UN \I瓦]GôY@$ng'5Xa hTjX7wԣh_@;f`* U8[>jrNP+km(9X=[4[>hf ==S";v=oo9]5 [F+ {{M&%nث3_@/Myd8( *oT%PJJ/ -9ؘ/!La;D]/UG( L[WF伸 *ߴh66lOFKT\:"tnUO<`4*B !aIk&h jpE50Z޹ns{sN'5꟠BY]@-ņ tcusujf ji ,Yj~kqGOdœc'e{Eӆ^9=z`3-@hs&ulŋ4#@gp`Ӫ?/è:WV $]W #,&҅#,g;bϢru;7L@I UVezR%TU#wv]bET/ }xD@c0_] K(̳by=AA=wǭSX9U)8jR?qxa-a2\ާ=}jN/bWkҵf8Z=v><|e!-C(K*;2d^$H}i&yUeտEmqȧ)xږoOXa*Ekqi%.|-"Gr[^?d5 endstream endobj 31 0 obj << /Length 1414 /Filter /FlateDecode >> stream xWYo6~ϯطJAD#=4pZuR@DR ;<6@>''(]`rJby$D ňlow!N˟N^dŒQ-BtzXȘ%\8FqX ʵzLz7vQ(># $|:a-V EQ߅4Tkl!s!TLa ёK/~yC%HBC;{>7  =%=',7++QtROB'cf1!v-fjhۋ'vBiܠ5J˭,h${ .^-&+K Msn{P`tѪXɪJ2myڎW}97?ǩ~L{.|QgN{Q(C( Q Luő1 xMt{[ӐA4{arNT$9 1.B;hP2_@mlU?Z.q. hzψ6R'!,'L$Pjqr Ey]quGgv{6[3J($2`ëD9E8gc<(5kWG{M/7QSꞟGQ nVg((:O8ʕ8շiS!B_Wv{}m8%(t[Iɕ&b5!\G,0_сN}Ms|kѪ-udWe`v>ђA9Ph~##mn? YQӢ`,g>\tjbd8n[wxf(MT9eIv[>n36ťP8)^ߧS4J(έ\ X $sO,sފoTf M8S Y(R#nʿ( 7Sr X*P6w,/bF)Oz83 }$d.K~l9=f\[ թV^kJsAcim AvJV3 Lx#"r\_L9aJXn':Ϝ1LWQ5}ga7vY\mf1J2b8}r|Ԗ endstream endobj 36 0 obj << /Length 1096 /Filter /FlateDecode >> stream xWϏ6_11RqfTQ{w lV 2P=7_:%q8gÈ0>[䳥GAt hDfxY)Vşz)2\* #})9~n7ZuYs¼B&{nToݶc#cRfq@ybĩMbG|! Cf]8&ު\4϶K*+A@J9\ESOڕμ;Lʙ?ƻ? ,8ףQEY dSdbspǒIH)C1 $B'>ӼshF=C@+Q?K&==6*1'P |)Kd BX9G4Lz@:S#( ~O.C+Nb%/M]^s|tL|Eg)#o:#˜q=LS}SVs扮&J{F6n&Jۊͦ,dn;]mFW],?麨Òyj5Rl[J2p$"X ٸSQhr7nڅhu8۲+x_!2.Qi ` u>AL1 ^e`[ ^*33 K)J 1`(pZױO0s(fޕAݰ~;V~KJ+*yb#Tq8vqDטMmCe\sb~zJGF4zQa:tߨ1ƗH)# nۧ<]0 LI!eA`@k٘0`h *RrEDޝ:?L޸S"xw.= LHMu2ݖ2B> 2G4yIt > Pȣ0PZ,w5uf|q Ӊè [8rK[ m*l xϘ"kz?MnyP+oon~_ endstream endobj 39 0 obj << /Length 1490 /Filter /FlateDecode >> stream xڭWM8 WVgѸ Cni`/m$Beٰ%EIbE==R$E۾xc&b_u(r|֋/ѧ*MQ2`{Ӵ$\ Sʽu%+-T,B{0B[.ph߶bŲ8 ⸃U^#MtFBG8jhϑ;j6Li?,YI9c@Yq0Wir'JvKIJaYk/Pmt3yw͐p^Rnࢥ0~Hq3N9,HXZSM29 r#_XZƝmSIq;$@z,6<Η+$IN .5-:%#k.XkT= O捨vpZzJ(ϗW2]pg'sz,Pk_zr1`O`brUIHR=b4wAN A(k OhU>W6E'xvV|Z˾)dG?pQ U:K'DCZ-ؖ=sj0uZu2:i-AJS9rfDOeM SpL?;yw7  , > stream xڵXMs6WV* @3=5=Ό^(8H Iv~}w ˂,I/&R۷\ D &w e>TMhrL4sÜǔD|⛏tƄfWs3 HvG_~ k={LcEN`FztyGJ'?jd:^g7SV?84[ґyWdldsm(Iԋ؎x!خ,غ"TW/(KHb%D«#!(AR0A$o.3RaRzZA(-?v9.qRok\!#z[BC kO#np U;Q*gϋNet=v5 ~Q-tNUy~?ޮӕS^*A\xXkǶTK F(UNO Z:h{Pt(]Cq>EHC0!EqNM\/8dֲ[1~:wBBWP%E RPX0`(.a=q!R gQנf&is %U^ Q"-8k!>!Y\ߺPU\E#}_3_ a$;ݠm]ʀ P ;d$yM}WEGk xZAF)ś)>2/W k$L` J3(((|q9X`1[W> stream xڭXo6޿Ÿ8Hɖ !6LZeӣi;dɥ$>N߿&t1J#f$D #’r=ãx MbxM~S򶫧8D3k #C~'1iN!OIE5%̻C/vsm/G^bZΦwR;04)Y^aդ{^ԼM}ư*wz7>+IYUVo֢y!Ut^5 Z|UÏˑL vd[P8P pGif+;`T,*a/Q^BK) 50m*[OE8si # 8_F?&}WeQe   \y#N&(a>u036ʞeBָt4F8u|= L$x|Uu3(oRrmvy=%S÷F%݀p5JK*kb#= vQߜu2\e!IC40*;h ōB\ "I#05fռ3! "b;]ngR4i_/2#xٴiUWW. 6uyL$D=,@%(]\(A0&br 'RA8Ta3B6e TS/+]'kQp c#mT@er4|o] QҰ7ϔz5wGܞG߲>N@:hie[cc` fxdN p)a8)XKͻB88iوwx *#fpk%eJR>nGD(;U}sou'9`oX&O|S)߸K "0'Ⱦ! +i uyMS}߄NOaHo& /Fq|#MʷE8Pyc9v+Q7;Rq`w.#@aһq!\.~vp}|m^=6I#S6ȧ$Aqz=U7d(hIy =uTzPCI+VPLBb7Z<#M#d`acqwM[љ밭3 ͋ʞi$E$:jqbPt+KlUMG5yY 8}J k~AzJ9si$+$]jַҧw{1LZx^wfMc{@|JtO ʅMmwPeלqCp(J&ԘQӋH}VF>o`Z[,lB,O"/|hl 9v,f `u׊\-A zU*/ei|>E1>?!FsE,J燵zCz]p D4c՗_$,̈́1!ZAo`| (}LLʖCa~ziէk3ȫZ[uU+il !_ ϶zG}%k^o, i;)uVw!/݉9)P|葬swB(8 ӟ^PDUe!o &@ 3&rd' endstream endobj 48 0 obj << /Length 1500 /Filter /FlateDecode >> stream xWmo6_O<*IIo!:l]xe(hْ+KG2V/hm_xԳ٣ϓdy'V#.X|$$͖?k񟳟>',1zQue:ݞ˛ի7ߝyjcXt'ȃV'gAw-Ʋ\6<䑿+[|807K#ZC܈#XtIe>QN~y\(n[<"Ŝa="ƙ<*:Z$"RC98" !wWeWk>wO 7y͏炆8`J]{~{4&^#?FвPuGa N ڢƺ?Mk,(65ܡx}CBY7.ީOb(^k>ʦGvOIxM\"MidP"AVOZ-Z\da o[`x <,y"-'2|ePQff>=& endstream endobj 52 0 obj << /Length 1542 /Filter /FlateDecode >> stream xڕWo6_EB*ߢl EZw{h*fK% #%JtH_c$Q/QN ,c Z3mtqCLuu#Vtc%]}g^~'\ tlbsVqK*I"~`ªiY[Nla-rjT,J=-c疍9q"YR(3-D1md9aelxy<'b_mŜL4G{-b7kqR[\dIE1kUF,*]I̜"/HLleXRhd KrJ:>9>@DĽlA.aMv}L`C? 5ERnm/?9QLyy6*dBP KiY%$I0@~=v;k,Aaٽ_j~(jtyړslf~s J,47Udђ0RJ۪[X4Tvټ*/ˋ01%Mrm{|{9idw 42fK*6Uwj/JsQpnjY<H#F%dj9?A@5Bg(aD36 :1)$zTx/5OГt*?n.d 6lW~AlIvYcaxZ&W *.k\gr6L7 .æ{7 ??C@U<0z8p| %J!(Iԣ(DjƄh>r8Ə,x)[M*?׹tnzB!,z,a1~*¤A4xtֳu>#_[mw;Zbh^Mч^lKv+Nzba uቢRtɾк~1'Z z@m8cpxRIHt{vVpG^sE\:jW =GsU 6*|ۆ]̶1z[|`uӍ|-4 Igf2C`:19(!w!\?lT8u#ڼ_?oT>uHQF۬&Z?|)kAϞ^ olM[a7f#qWv=w=Rfqvϣe?PǷ^ӥӧQ6S(eۃp!gp s9 c9#DBd`!Β#@2do|}/iSǬD"C"BMBr':M)KT7pscy>I TDǽ;L"g< endstream endobj 55 0 obj << /Length 1365 /Filter /FlateDecode >> stream xڭWK6Whl b)>m)AƷZmJr6M{J6 lj88WՌ1Ig݌QN4)l5K}_ݹ,fݮW2˔E\7kM+ [>+*rxvnHYb -GG."k\jeST?L>`7:׭9OI bkρm6/b/D\~f ./ ^pqFX" b1J.p,x9ob_,X:7(]/xpKSQpdj0L7QLf'[CX/(ɔ;\z>\B03p\ޠcEhI$5EYss_oLJ;"t",e>d>6L"!(D 6olT7l;>n,QQVӠޡ,-ڮT[ έU-,de+.[JA v +!>`x`ϔ؛4`.;@ ]Nf5z_䮢톯8{b_^ i>!v1>.s*{.r!Ђ @=+IJ!iLFt? KͶ̞`}<e=,@>JVL!2w ʴq²xw 1V#NW1nU|gћtsxǖtyRq*>AaUE+q$Ej:Ts ,NCu IPEݹʻtY>x8P.Mա$K({i.}&E-9q\lSbf E +[%0 CR9f,Rr %T27G}i29 s {pݡ#0}q M|$t3A2n a/ϜY]P~bŨ߄BR!U$٨BxfqŹCȤsk߱g-ʱ2__a!<{R)X̧m-,%HrqLk,hlr'VA ׶/n20(>Wf䓂=H)a8.Yj#kMڋE~ڕstbei2PK7A80}hȔp#C],M?6h̑127[4’C/`14K%~@~KV< ,l 1_#S n*oH_(MUޯ_f* endstream endobj 58 0 obj << /Length 2027 /Filter /FlateDecode >> stream xXmo""+E$EqȦ!/9\X2m%WIp(rۢ@ p^yEI"Yb}<|HI辚< nP{r+{:9]A"q/[v@0KԹA^LVKRVwy*e'<5앺m'^JRgY$qDDQB' ZA ^ZneWlѾ`D,öaﮐ;VL|e޶nRUyhXgNPZ\" HC7]kCoZ٧Rb.KynWZfIdCdj 9KDE >YϷL1xxhݾû#s&D0s`1vό^yk\IWJnbjOpq 4΄}Dtђz Y]-hs! . ¥3j . ඘>洝*&ӫ7&a"Ax0y`nsA!%ld4-*,Ց)`xUE]-51˶59Fj52wC0,N9jԙըuN< Vk]A.WdQH y(HB1!&,Z~Qow ]eĞXD"zW4Ԡ,'pCgIaUi6$:[ TzT+JĜQ^Lm8B0 2/`YV T*帿P&A`X|ȺVUUw]( s\F?UusTIS-H[`+dp. EqN"=[ȢT3(1/GcLtogFزyo;:jaX*C,J՝Ʉ,$ee@I:) #T],VM; \vl4d1Ifi ^~%(<*&VI Aҥ xXȘ7+!ΐ`w#" h>PCs%{!\ 6-5uI흇ei Ԅ[ ^=^8c0ń~MCJ8f6|O\-NBPuSwvKJB <}vu9k8') VnDžȇw )2"pBM,Z^,:?ltVh*:%h L]H" cOn~[A*?iIa'QdF#0of3[]Ԇpa{ȥK2/M'N6=ƶ(1GoJ y=r!^?P-w6"u:lL O#s*]5pjQP/֛[l6}˕Zp|D8 fNx7g endstream endobj 61 0 obj << /Length 872 /Filter /FlateDecode >> stream xڭUko0_O LݚPiQ!%nH*߹Ѳ *{}ϹF;c>>T>`L<'=Ao$FVzTS&Qt2:z#|a8;CtlB G/'xHv+Fs8 ǣttb[!z#Wzbz b{)9:yV}{Q\M5ђJ!L$\ RL@N.]Ι*L ^hO 'lp Фȿ D>2T+2g D i%S\9BPL&GdjKmW bNJiHjNRR1FA" 5t5^l")˸MƁJ*Df i\CL 0[Tzuh~s%8^XFEU^,ћ2堸̪ rT[GA<Śe\eynaY^1y}'Sle.sڟWݍ̬FQe4.f0kLu ;k -YMm V&P4CBlb4gk^fjMn&+ {jw 6t/](`V\yƍ׋ۤNf9kp)?UN)ArF vlw &/LuX^r^ۧ oP6m%s'KSwY(Z07 S4S@:i`6SW^۰W0nD(z0Y})`9lN] endstream endobj 64 0 obj << /Length 1759 /Filter /FlateDecode >> stream xڵWKs6 WRO77$4t:\ˉVJT]{]%ME@@͓g/DfqD$V*;)r':iN~8[J!DtY4E4u4,ȼ"ɣ~w<~"i!͏,92o&NN$eī͑9[Ś4t0;hDžזeձ|+ Ȏ)7 aOLmd}>(ٙúEQ>ΙzvۧU04NU\z9NΥ`Ie3mdv=l)1z1#dWwDEst Z2wM[L#hkgUYG1' )`CjbOTz4k5tdu(~@60M&R"I#E+߾ys۟I3bzFbEyxO4? Xɬ2VAԎGa:"0"}S4S|p鑦/_AItΫSvQ_1)L7qƐ->y<3;Iʸ7Q [Xw'?-K) |y|jW9ȍ7_h<EPL)SͲ?[@f984QMX$͒hi/j<&Vc~[&2#Z4}Z9#9 B|GU34]kdsnhlZ1x0q}Wgs+pLbD*BNDj!2K3&fʐa€Zb5UIH,$r#\ !E&jZ6bãuZپ`eO }\2v]z`nt_1!\FbI!iL$ :ᚓѮG{[2FƬѣH<@VVm\m;g7Uqp3kd$ [`[k,`H "ec:Cg>]?enftTb7, a endstream endobj 67 0 obj << /Length 2001 /Filter /FlateDecode >> stream xڕko|[+$%"mФ-юE$9Gր!{wI3)\kuv>BY%ZJggw/.AiF.qBSq0"{X<贈M)tcBtw~^H~lōmlsL׻8NH`!djcQ-Z U&NڞTh{;U\,jd 2LzjTWH5퐺 1:>XZ)X* |4c6 @ѢTEKTզwD 6$J:qb,}v7H Ěv}-3ҷB"|yt5 ,H2MzG+ P$0U ROU/bPhh,ɇZRi9 4둗(R`FG 0ɳ!K&SAi:3y(݇{ڏ˷DJC)D1'JqeA7*%e612,e# CTGA$;C'|%bG>sJ~4;B,ml}`-ueUUW¯0 Cl?VvuYݼ}+Dj ^NCx*"b hѕ/$ЊX!Dՙ Ddx.&[ ֵ`Gmϡ%Kj_ᜄȧ3Qr4JE(X{^ߖk2zj \UmzZPKY1Z.c7E]<(R{uFYLg0+|DG,e *$)'̈S ,õ T e׶a['* .;sCP=kۙ0fЩlt4j;p},uxu',[٧َވnDv|R3(nZxJB"NCOHZ:$NC\HIӲh x+NB_!_G;LW`q&qL%ĺQa͝(1/%,>`1TbmϸjlƘ`"z Jq-cG k> FXc08r0$ 4@syEypAX}rY'Pg?WuYXgQ+2dEf< ,:`U@F7 o KlwŵaLͶr#ݎ.[ -Ў?WnISU#}$[_+38$ _>pHϝcu+IV!h>\vs?N<IoǀfW'eTe_j$[{k [ס}dI!\:jå) H%T&w:?i'QnW3Vn==/C?F#o.2({p"x60ODd>" o\HY?; S9]ϔ|JXͶ<9>XzH/H|%-9ck%Z̿׀L^f:N,]3"rt,m)shO{OG>Fmö1Ń'ȩxohɴL0IAc:CLɝ>H:kvDO1,<:t移=9eZSM>w9yr>ѡ @x O"R8CNlgw$~=AQ8УS{&{{'~b}3*üZ X%5L-aފFNjR+Kr  eWt0J%ݒ9}wuRt endstream endobj 71 0 obj << /Length 1132 /Filter /FlateDecode >> stream xڥVKo6WP *EQen)vAcl%f#KY ^)Ţhyn~AY|5c1Id<nZSWwժY T0Gb]ޘT93V_tjuY^ʈOwb, `PIɌ1YÈ` x@DVRz]ڽ 9 .$I7uG*;ݨμ8&o^u4UQiU'Lh Hg,vdO~I%٠(\_cYI7z{d)}J>HӅ%!k*d=$X깠cq+ČI?aނ^Hz3,FKW5Ju}[FaN*H3 VuCDj51zmrU8x{%x‚nDDM8Ҽ4)ӹX>; i0}nM5{?yh<y& ^8_ǫ?+D endstream endobj 74 0 obj << /Length 1200 /Filter /FlateDecode >> stream xWKo6W(k.IzMbbAMDʒ!I_!-WY4Ah(~SV9#[=F9IЋ#\$ުOժٜ wțUzEY?RBNj1_Z 1 yHBwŨˣ.#IQT*ǘqثՠfUwa <$ԪN'!zͬfsXPa-Zfvb2q3OA9#Qp0o?f *&B_Orn(Fh Jo${%pMY?h2?OB" Tm)I8QPmOo3X.9Jnu.;ΣBeQhLQmhh״4N@ZmPgUC=wGWPp (&,FhYs(1ͿIawVw)=M 9`7vl)zy?eR a zF ػ&%Zin‚pT8c)C)1>M1bEvej׉J˜7{qpFQg(HkYOV',$1KBcH 'e3!JIoȂKplH8AzZľ1":q6h;g9۬Zٰj'6 ># [>)czvug op}m 7N)–Q Gh%􇬲}WF+W@cΚa뎕Z@U]wx碲ݾXoG];GM}.N/o0B6:!dU6Ć)wXP&I*l  {-1FWa|r0b<.v_:f0vdRHNu?lU' )lIsp /3&$̊AT'OVv Tu ummeomnAqmE[ҳRNXv=-O2+n;<eW6vE2 XAOgm !q,VRF귫?S N.zٍ񳾪3 FOFi}GY_?|81vJx;O&ӭ/uU'ZO߆ BazG ir;s]\.- endstream endobj 77 0 obj << /Length 1531 /Filter /FlateDecode >> stream xڵXn8}WmbHJER7]h1n"ѱY2$m||"Kvh83gy=v!(d9$y ʂ<c`;yK0A3RhZu漜߯DӾx |MI __}|~e{~aPfߩtlqM\Pkf?Ds -;F31DV6H3|uy}X/ssu=aBespfpqa:cGZƢpڜ<7 R-Qcx)_|Lu/Pͳ^rBG6%"la %XҪ|_K{EoB 5N(ya+_XB'NΩfy1Oi]Lɋlq;$QJbHr'*e:*:#[Y7]q*AKsuL#lS+*R>(PRBQ}oL x 9"9oӌ_D+>;|\ʸnHެK^Ui*.4hYyCrRjƈ> -*(lSm,ri[5>|4lrl3[ C!#8y> ُD"I0W&W\2m2QO_J'Z0>=I13)&Gi< mJeKOq>ڗ [0H\Flm%e6,`X`(XRX^5J?ƌYJ8/.5&N #;ݳ9./v47g.#LF fÜ8Ƈ im{R @_ :GMGŅ3DAINl'oqL! endstream endobj 80 0 obj << /Length 1257 /Filter /FlateDecode >> stream xڽWKs6WHv"\מ\M3H$|hHviQb-ŷ.WWo\0F2)b]0N`"p.V3eIOIłm]ݶ:\Ҡ54J?kvUh`w b<"^[C_+<ݾοwp|t~Uٛ@o>GSK<:kݠ\oN'XgXᱜC,K\uj~7 c~BNnwh|t{#Ǒsc'| dU7s'BSO[pգf+ՠjTY>miDK [$ AoQa,X(RH1Wdp47.La|ڹ( D2`PR$Yprc ,@cϩYO}ec@W*GP7n@sXc,F``'dUbI,J`{lPq٩N%K{Dpˠ38-w Ϧ*P-`elUGiXb"cLݹ JwL|PE3A/e 񡥑v>|Dzʗ'$e5B.>,Ŵtam*P_gPwf Gz2^+m"efBldKwjMJ٣.op=L@񷨫n[ [as{4 eG2d60S *<Ukl/f_LFݓi8d o{맧!Ӆ0Mvqr!U=g7E$z/RB]˘ѽ7m-) Jhzvnu: endstream endobj 83 0 obj << /Length 981 /Filter /FlateDecode >> stream xڝW]:}ϯ5wj#U6Q[ w ُ& ^،'l9yspN##F/Q{˕ÿD?78s&(fN|zpZ+L)ǍwcZ'˝]zeBBMiB 2_tA!Ne@PK;Hu^" 2?Rg0i N k4b1.1EԂd/K4BEH&=dN3YLNl-lUXv9H<!ܷD|BI +Gq(Ƹ3R(M<1^8ZY1]]I94AėO3DQs(Ebv;n۾TbC~9~{}Vf:Ovm4͆Kɀ_!t9Qk3ʺ郵wj]wcu}ijUJ1ˆx£1l+kY[+Rn~˔ _ř2|Z/};֐1Wvcz3yig_y ,+ߗu#R9Ug63%3>Zj8LÙR&^f6N ø! OG,}AIVeh!j#֝F0ni UuL(}u99Qž\TYz,'&\8B(`ɏ[˹KI=5[nʱ9F o1<ח 吚9dhOV'bcV`fTh̤w+9*fOV U|h>5 OУN4> stream xڭXK6 Wl M EӃc`˻'޴ rEHʯw/n߉p#F& nvO/do}[/d<~i7TeOnh|Sn#kY&=+B0c:q/{r]n,ˈRMD}i7媡Se°ff@g{>+Q{՗h ފ" ^j$ʦ 7I#QYu0F+-K՝|R]_A; f;'`څ0gA8%H=tUG͇l26*Ȫՙ$hGp˰Ft{ܲ5 '5u@uv|VH&5i0:L uc̮@lDKBs$E8A6B'k2 JiBDN^KGv1ƹ\dwGD&b< 51O[%^mW4aWWL5B5VhּWxݫj叁 E`+0t1iۿM59yip;u_ ˵2hvo˾2\SWy[t5eUI(&JLt Sa[5^p4 C[=0rℌ}9"'VU$lMaHC9970j 1k99#z{&8a6(X]]BV9N`DCoJrIrTC\SMiL~Q{jz@9{|D10DeXK`a%Bh\q@V۸QiHGBPw$R| 9+1MCG[DArM:5&bt{ܘ* 6+PDpIqu.ʗG@'2(Pfܲ0R.7ɳXx&\c;JAt YEpkⰆ {h/JD Pc<)B}?\%EDSr #&z}G!wCquL]wDxͰt}F5߈t]!`FAq6kVDٲMzB- o4aN)oI,+IB%/q>XLj z/[wu" V}}(ci_g\ᤙ'%cr$W*>1f@1ryyζU@b(erJ:=10,hZr@r>ȹ4ZNak%{VQyeƢ,z+pUo_"PQKߔY8)t>;j O! Ģ_21 {%IzUu\W%.w.b> stream xڝW_6 =8CJez[mQ(r1خl5Grb眇%)R8)lq'Hr_l>xV?-3\2|!Ҫ6ʆ3iM^~tΥՍ$>QkA.6sWX1һGM` (-z akbM5ͳyIUvsH/!|"yC5H1ՎvYڵMhq _+5,=B}yY;ʖ{tSmiUN!otQ3{|6ehZ-m`UŜht\8DCDOb], e ::/D.|z$$1)iyIS <%{?Ξ'Qleh-6x,Tfk}Zco^9؇~LƚJEPa8Ij˦v~x2Qspl*kNe.cчT{20ɜ {e]e!Xl=)Kծ.4:R0AD"H_|. n,B2<ŐZ,9_z6G{|19*>ME |!/ŰDA؅Lp^/*ࡡ56!"RS4XBǪmnǂ ڴʺ[aK]|Q ʠ7%Dgg"7Aw>`OWng]keT1+eГG1T-%|Edy!†Bdl(i">a![OE?`~"ՆX|ƅ H(5lW bf*|} t1ezcs+Z" u+*Zo 6f4Soeqvz!Hxf$g FH@`'C9l ,tւKɪJP d|rY%S쓲ξn{h.Ij~ĺq潫׮JISu]"y8/(ζSx8Vk~RN&55UQ_^ܼVFվ/ndg@V6 tᣙ6z4>#lf T[8F RfSYWď8d:hSA F,Vy4 j]u*Z5t Aю8HlanrFY>ʰörT Yb{LN'Z4?|eO!rmuvʅnxlxvnIؕ)e|\_2, yUƵϓ1_cQTҴrkt> stream xڥW_o600`!)ђuEh`q hɢ QIO;%۩eۋx$;ճWJ-`Rr.,b*[6߃\7Y,^pb]wgۍgI49/(< t՛0}g6D5 J +9sh^ҌD."$zҺrWk׷ֶ 3vl{Ԩ+7fr)YLN`f=8fIFts 2)T̗l%IJ'01E+Rˋ9JIX,"!|3zvNA8 %SxYËP*sv@3MC7jA@ն=+m= ݾ,DMxҸ1D tӒfBOMeK.e}]n.BY|h,dj ks vpt;@/[0zEׯ=m,K",c9Op֍[sehRH1Uy2@RH1t4ph 40`vF ^ S}7mcМQ*oM Lx9E`БT Sª?x!J,;'=}c L7=# uz]yWLџ̟xگvcHg`qh0Ĩ@:5A~sZ{u󃧮#85 =y}E#O&!vSs 5bDnå # AsJ% ]3nQޔS kl⊢YU³>8I>4s5C9>Ȩ) 8~ s6r=> stream xڍwT}? I ܄FwwJFlc4HwwJ7J#!t3y?}~W?7[ 쐶0U$Itt4 $ 88Xz #ᡄA82sA"]`! XT,& A hI2nj"0 C B:?@_@W :#W q"p)X?ÏD;rz@vBB\a8Fpo!AÀ8  C`p!v04Wh C;iW??!P(Ax@{ ͏Bv?!.$.@lq*!8ah8 ]~bfb?ϧ Gà{ 3[#°{0F4T`XH\LH\s<? y`j?aba~>ivp(h s#ΎS˸@s~` _O8!.^v5b} mME?eTTDz}|" $,=3Ͽ:7_{GF =O5 7%t8BÀ\H}[+GYWTsvWbqˡĭ]Ma7ZfV ,$  z8F Bij{H Ńˆ=3rfk?enyis'ED4Q'}嵃ycS]w`M<2sr{iM2t/=h.29;^CJ߿?${pҕivtՔhӳH|dm0Zg+k|rEdnm-@G5b,u@MoaXjeajk?ܷh|lhz-p:nYJsI>aF)f ֢fe0&ݙpWX5C'G nf(y{.V{.Yj"K*]E.AJlvF2EޮY8Y`W[t?MO^s}޻.e2 _K/wٶtMaWPT+݀Oo!} R([=yJG?>8 :vhZ扯WeI%|r`fˑfavi{MŤx/hi6WFW U^"wHJ1ǎnGqueo3Sm;= v(F h| p-}~Ԝ O@hZIȏu7i?eMYz]M6{ֱ0z|oߴTS80w\fbaFm|s]ۤoCPakEMZ"ٳS4/u(dYγHOAlF*/ xWV7YTs.+fI\[&GvM J(?H]>uՊ癝~{,ƛxX|Wg+ 8mѢ <Ɨ$7a;]ȶuV ^g_[cצ naCOhFSk RnH`Rڗۨ8綅.N TT?QrE.F8*fn}q"P.&߷C Zl#E] I**n\%]Xea)amy=tU=xRP+/@H!y@ڨjXC eֹ} {&h C.evXߠ3{T;ZTXk~m#V]ƞ(w?%7joBod%> m[Џ};$C=6)?z枊>/փ_ƣ(7Kk D%|lQ?NͿ Pc?YblIYm\ e\۟9,=׺Y='?o]m]4w `d](oU"ɉf]?|!Е@>h@9SA(U&Ǻq/ܘ/".³]AηΕ2%$6>[=sŐL3٭p2qcyՍcOK0R-N˪tF(Cv fjN1) E,\`d-#€*;w9h4&2/,f^tfCڸ'-n侼αTN\dՔ6L\<2PFRg=5%lU`^jw^2,V"*1ACЯ!g(T oeh y"7j*r׃CEU6ѷ2tK,J꿘x^K2&#~YnB0C-O72썄w9"@E2k*m);V|.Vu l}oYR`lb>wcZ鬓1y˪!zI*lG;Z^9/jf2vj8YS"ҽ3/V.#tvHuyM#a,.XNΥJGrwhhf $Пh+<{|&@1) GD\:5zYx);0`YӤ6Pjԧi[iM+dwĥ>zp!dͷڬqPV8'wޛD*2ç\)A޽.DL!55$剢-lfăG4`26Xе1^r;# J^FATa]t w&;{=_j8EX&YFI]~mAg_Pf^lդ&ϽZ  po$vݛ(0y˵=?"[˓?= JY;̔Dn-uf(+k"R-?dz< ^>WU}-jDyF 'Q*\kǿ&vy_C=tR-eizӅ':¦307Q>m4asbJqVJK5t2sQ]J.A˹L]sz \ v*6cuj{l2Zsr*'kZٜ{Eh vA2v1S(OW5O+{ <(U C2[y>ްAb "/)RmX5}&׵6>hy&δRWҐ'wWthlDi|{bm3@I&2?X~MYq3#h^rXN`!}߀\Åw?}w5/MP ;K٪wzl7V\*8\AYd{JZMskr*w ƎRoo.9ߙO7,8$W d&2n,,0cY}^[Rŧ w/𚳌5ttX}k;؈2%b)hGĝo ׉mORs["xoJPd Ry|6M􁸯v+aoryF*^(Lڶ5Ϗ`LlXƾ y{&y~wlXP1 Fg 8.5 6<'6m%Lתo1eD -ܨ1H=)iz?=3QN6&2_$BLhbPWRq_ r+gȘ怌u(Q~ 2$'f"on-:gs5u,&?x9@qDmp^3(-9%+2 (ؾ/ nO6~ '0[χ,T##XIExlS,v\L;,mx"}`JįZ=[47Ů&n#E7nn-FNU7i=0z{11|;z ޺viu̳dpYx='Jx@-erhjPn|:rg@mkS9Wv4O7|u-~SqQ<['dOW&퐛"xqڽ 9/C`XJ@CpuU> stream xڍxT6%%9tw000twHw tH%t {y}k֚yu׾}{f >!xyyM}S~ pYX (oC l@b 6&P"@ @&P4yjpEqpD `qDd]n ip +l}8F#cGUˋŝ z`w'2@/. Anqܑ!0;YvrˁpJ'W"w wq@`{ VEx#60_6Pw82E:޺ @IV`d; pu@qẙ0;y p?Hߘ O`o#߯>0C+`؃~6`pv` vp Z#dT)+q/# ""B 7cȨ "# I2MnQxOlĩ(W_Xq$'ctt+KɈ-N1% /hdiᘊG:VнZ{!*. 0uHTy_=$[c>lKn3G2-65ģ$H^9әcAVO $|9o:*0m6ƤmZ2Lz3Ŗt}qLj;,>^jNj_$14o~)h+K֑ʧr B1`V1? h o$6SM0^Gf-2Eў9Xke>zZ>!_%zIOL{v,(jaF>Z+;l%.2M+2Q<ָشh_VWI"e_]\k1(d%΢`M̂2(Q< FsEo{RZ3ŗ|eqO>;`hJӂ8Wk,-*]"C+gUǽ}c7=VYc잱!α2/7} TEO>ƨ*A˖lH40.Nėo! 37d~lOmHcH˫(>YV{sz=O=<]G\*Y+!<.gx[{莬ꕎ%ZeCRi갊3;R0G}pȾjDŸ;uimg߾I¶,څ2{*a$Wu^~Ldndr4,Ӕ>oؓ^Ou$XL*S"dy,cAԾ=@[֦ވ_ ݞa! W+N}Izvf/jʒX" 7Klg>uVCf_XESa"O¨Qգo9kKR7rRn;$~n̈y2e #r5٩(4=qŽ5<-_Ɔ%G`3åu.}B/7(1Br@uۢI1uQ Bcàyb0CS\]k8ʿկfyiMD`g8kiMĿuH usj٣Ǔڤ8Ipwp8eS9wCL{>5.-s/&7te'}ИX#P;:j)5/=wc@/ ٪aԵ.JCBF{ӆOuB.of%rgzu0爝'l}Nĥrp ~+T% D,?*m/()s(+R9 p((Ds! ~ޚwq==T7odY m푣7:d>S,jHr}f! ^eҡlOãr_re˫Hֻ<%dX{: +>8i8g盝h_'T#'R&dw7mXZK9n4P]}Nr䃚 ]|;^1z2KKr|A]2}Z.+/L߹OFd&wL3F*_wK*O& kkt X xM,jAyEԬ_}gkNc-LJfɠnbT6{6ڮ,h^)= YZ&e&7ZqF]:3;;3[<ګ%8ٷ^ucgȜ|~խ}a^Nzt iҴ(9Y{"?V_s=!.Iƽ'lOM Pa4sqΧ|.TmEW>7kY*i;ukm;rU\snώ׎/_KQ ]ȓ޵qYVRgΡpjQg-ɗ{uo͵@'NH?PfܐʁQq3ϊ!~:龦f;nSC8AOڑKςZ(f ^:~uW:ϸxT>ˬWfxԡ>U9c !V_`Chhr4%ޒ$A_};#ٖVo|bTΖ?iCeȯ+lHt:R S#jiS,62U%ɎޡA(̋BeEdž@FV `yc {dziq7!֏ʊjl+z8XAOʃ7lj"σvO=w{΃?iή J/$WhZ|7 #dH ʺg!q/\!'̄4Wg]UBѠ8{ŝbbUXI)Bob݂5R>!݁]YB([@iłaZBTVCWBt|2>JgL1fjW|DiӢ'fX6>SM#%gc1)U "ꮽЩ2ϟq0i`h؜|V#ֱ-c.$L3!KJj sZwJě[Q O=@q^v16#I$@P{Rw9"YKhx КVWT"0Q}U0fjw?ŀL?GA s{!8OIF\SZU)3oꞻaU}JyYr+wΧR{L[Rx?Xk @G`X&LCj*pcn2k;ʗ\;o#-ޟ؄N7M^(kcQew/55 ܋WޒPVгghC;sYA(piE.yd3P5@_=c-큻6k)H 2يT@YۏTD?J+屵wm)+pğQ`csJտeZ_Jg=Q\vt7խYES`zo$BrUojuM%&,EpWR{)56Y}[ٷO;ѺϏ$N$*j_,O*@^Ru'Zd;7Xܛ`#bIMJ8)OhS t0»T&]aڷߦqjh9ҪLYo>..N&J>nzw-+Q]SM˓^Ƿqm#KYLj]W;o*g,);qXQ躋Yt3Mb|߮ M҃/7J\3<,e]P* xL]vp]ãPi8wT]EObPe=?N8OvŠܣIc5m(cvo4$+1[q],ɀqjExam쪬1=56D/_B (z=+N [A@)@?wX r2%J`׌0[ӧ}Rok I鋚P~e+n<~N_X]RJq}ALG3$I>$ Yn;PSS#şV8NiwP~'1 0 7=Z L3A ^i;|&1{CM5&lk, 1jO8yhCyS1jY]tT6(9i*'#Mv̤D.ܸ-VGE:ۑճlyҼX X{fKE+a/ ^^}7Vߑ0ݶoJsOq NeZRV endstream endobj 105 0 obj << /Length1 1618 /Length2 19153 /Length3 0 /Length 19997 /Filter /FlateDecode >> stream xڬSfݶ%m۶m¶3a۶3le ömQ]NsT9s"'VR6s0H8ػ330)Xٙ;ѫ,܈ aEƮVbƮ"MHҕJ]E?%x毧=߃;`Q r[D$$ԉ$gc["%7[+S"9+S "S{3Rsa%BdL048#r8Y=YY8ۻ?Eᯅ__0%WSg+GWQ$.VD-LI_0V.DOb̬\m l/n.Vɀ`alf pq gD[Ǝ^v`5gafol +{E܁r37йU f/ c3{[/"39 ߐDTw]fkC[o=Wh 7[[cCw8cl?vV^j 7iW& \$<fJVDƶ+/*&=3ѩYZSzf&:٩➮ '1pUrf%`.8x},D=wycWg+O"ݿ31qeL:q{S&F/?jS7g翽׻5'fuuzV/̼ 1}̠!ejŅ?w>Bxڽ?dhG0l){SWx~țAe> r`:L*SPhdOi q]HM@()N(G ނAc'z9?4~sz*#U2'E^k 7 qXcg*tP`-) \ht;IdxMN茦mN jϱq+Y~Ŷo,ڷɱL@:(4pxA"esco D"3E^yUT>!Y߼ۛOX#A+Hew ԃ5#8/qlfؤ~wuo0$ G#;5T`˙]'%qN\z#K8VrsV yX"Ό/YRr2rA*iCHohe'wPwX%y;@9$~,?Ϛ Hٌ ?]ЭذRNy< iq¿#@ZP[!b$CuR_XM!&jh{0+QB`^k`bB-%lex~ngb)Vw'0qBh䝐65ݧLsc&V T2Tw,ffT"FlQ`}eGU#<$Ոֵ ԍnz`iu'p7Mw(({*H0rS ,XᵎFĿh_Nm 2a'N8߸[x-Ps8+8!א O#ږێ(e Ry*`:bC.i0hy08^쏻' ,# oD֦WW cB0DŚ / ,}S& j[K ދm>]4 >sb,|8{Nn/eo#;jERx C\8'̯vϐ8lGE})`{+ISB'VސmobQ8Y[9 i|;aeWzh>|dR]U}ۂ"D/[:ۊ 7_J  ss2TBa홡Ԧ/t_ %"٨:O !( 8e5iVXBlvI}K+B~?y 49,C0v6$9TρE|5@Gd]BFPNTG}h2HA󭷔ވ_&@10CĢk JOoa$yAۚk}pOɦm]' (d n&'x+ɝ[g9 )n~b/W~gocCΦ\(A~b9Өh72%5@RR9~L$dQV$ʀ?]"7fشݥQaZ/Δd L4pLf'?C4}BZ֋X<7q"p.yFbuoh:T T O'K8cγ{L~m4[&P5|xIԙokWv!8 ϶Dkb֡888ah^2 d-Xs%6ye2mA@VNaBhG=S,V2ɲ/`:++Ǟ`[58jnќKX$'Ռ~S6^8Sp @)-(}cM3A*aEACGEj]? FPi,T(i{ռ++S@7@j$$VMs»| [EL:<:dq9;@Rm'4KWylQ%lL~( \X\(* $tU@mѻDhJ._Dh6"շ%^_kYͽaг" =}}kyOeq޶Q9 1o%5/{DK%DShTOfpӮ0{;8ׅMZYSNvL_I&{)E(P:Z2zهQqVfƔSS4zOf p\g >TRqX}9< |8ܛdȗQ a.84v ~,KVw$]i \.c?Bc2_"s |Vo/%RQ L$DҐޝdIdUy<#Km\%I&NhͤxPt9+c@I5 e&ս5 -b9 sPTxݍŔkM;3S bhZ e.-o$_ȱak ^x4a0)3}4uwIiomp´yz=}YHSGҍnRjk@%W/ĄamCp[ꛑۿCKh{&$6(?KdJJ[ʎz!7K\TA^Z(Cc4EM#8mO|6|'QKH)L\d?rSJ׺RI\lcA4I[0j52~ #CQY[q*P 幡Ǿ njyK.9jBG_e :|+թeϲwY{}mܺcr?fB[qACݢ7KU[>LR!oI}1%m3+ Vgr/]^PFVo}XstYr9FQ5-zhusa.0'RֺUo=jdNL-IOۈQSʹc/]$읐 SNܳ6|)VHuD#'3_3~^q^QT̡K.R>iqYcPzz%̅b5mxwPC4rhda*WID^㮍DZo7F ⇇~)\)nKX0~da?eOI)SűV Ɲu/joA)Tf?T 3EDr4xW:Xg/Qʣ)*y)&G9z4j$qT0rz)".|T͘x{9ӡ 7ˏ6B2$K{pp*N[ՙQZu^COɄ:]M|p{I!)7[O̓ ;ף. mS~l^%UgGT5x],F V1=+2m-FY8od mQ~lWJtɹr9ѩ3Ast2]fz?3' ar晾G6&αBQK&Nٖ!Fi~2`訧as_E)D3.8lLfIjv+xf1uyb "tN^!`:.)r71ILpEϲ+ ّ[י|Yml}NYzl`NW[т~XןV_sO!-]f`xPGO 7P`|= nұz{䇃I=8x epKH&eFZL77gܺ'A3xwh 0vX? u`v_߁fk\O os5|Z\rd4X@7 -b-j?M XyYׁWb(^7Ţa#bDQwFOE(Pw5p7*^:+>ۄ}՞Jt/6icz*d(( ɨOЊ 5s?ԏjsM~ZCm`)#0OtG3#:{-|ֻ|?u2e_%OK&WS"`9` DL4 b*ӭ= U(eJyމ"'%G渎U3'N[5G):Q}%R {$ybrtd_NȟNl qB«i`8T׼q@B n "\J$b , J+4C?S^W6q-8N >Ŋt캾wAʻHvlm5҉ftF2Ҷ}1a{̥M>kԎ0 p9&3lS@3321)LP̸pҧLzw;K9Pܑ'XXV=ݫص'ě~Ny(%F7aXnlV H_ \c)-.W)z1R1JpLyi}K]< }_ՠ/WY.:}Jֳc"|_[:!W1+mMsx# ))䭇y~B-݂(Ѳ`Zսp 2L$[SpQ3d y$Hp\8yzRz'AQz! ߫+~=҃'9X!wrv1E_xdX^!y-r]=+2hЁVķ`BQ VP*w#-#l[I AS0[l[AerJufԆh'Con`&B<[=RD'&(xd!$(UFCwxA< 7xz~~0-+84Yc,0+MC#ڶ RDS"\nV V f ς=Sw\[c,ފ2M4uc,9l6SiDe]2b<ڍ`l՝8Ujvup \.4~U ;եs(/WcC F՛M@n;ayBkmKncļ5jF6~[d (8Fa$yDŁ<@ #2vْގ'רLbXd3K]"͎DՀ(p 4K׊?ueтEX}62$EFy|r\<э5YjJ500l\-GyЊq}QE8u}CLd/[1rj& PqlZpmp HbsH wgV"N⥡;`Xz*|!6m-EF(VMǜgQBb"eP*b8uY#8:Я+Z-b0 hP[d2v[S ?r|^ Qwf''a>65W~M|T߃fgV3"g 2Q^a#M=D64YO%cmEf"<31 a\a9usλxi>$2e3[Dcv|v! c'SUW5oaw>JގoYѳ]x@μ9=Z60̼y̚|OO䤛0s;-cޭ6"Yz1~&-bEGOQEJUBXڲ x (%@j%Qx٘e Q` B{3O'{r|F+[?x@F^f/m[&z[^Ô',PawnfMp(`CW1=Ticu6kaL$i0|.P~y -7B,'${+<rG=';3H6sts+nWת$ZCz0f)$*T;1`4`c43PãqGjdS&l\~j^bvFiK0it0Lٺhde!YPRU z26m J _H/ȝMnqϜ\dZ,A gNQ?׻d):XPk+T#g"0 xDkv7?. *,udɔglw4g*ד,@sć{˝E\1Z= ymH 8'C0U9ي2(t_pٯ62?$1_- M50%V#XlUonה5i+\D΂e,:ǙݎQSv /R3}P.8fַB-+u`3b͔s}Krw~ %OvsF7%mKN]4 6cSK BE^vuci DiJa˿FEs1u7[ޑ2eB(UD=p1ht|v>q*y::) = Wʓ`dz6?E^2 6GGJW5 u` x8|!0N;(Ukເ-yHN QT/]ޞљ "וq2]{UHVCo^]tQIS;zmwt~iDdL/%oD^Ej}؂Q" vCci 44G]s8 ).O\Ӭ9vD\aEٻiG:Цc&5KlSgعdraLRg9qHX3c#P((lF2m>\&ֺEoKX?+XN}#h&+lL0٫y KOG(G+Tt4XY#2;Sw[o[ccmFO[HVOe.A3+}=#RF3lp[ö–v$Tڐ(i>UaN1˽/`\Ѱ<|nz,pbn:/| .hԲ2}? e{wǏ^8H#EV2ɹiWO0uXZZ?䞏ʲ%"fGK_5*e S#ۛbhNYvze>zowDn0 R).5_5fjgDMؘU|B'D dAs UdUS E^!.րd6`b %%sGJ0Hbw<%!&t?jN{%` e%>UŘuo)[@kMC*͒0&E"u~[%Yfx&^ia<Į@V.Cd3,:kiUQ@oRS|R\šQ0v7>YJW\vM ]M941?p cPs^8X,5T6rHDZy qi'Qw"g9vRxQH>#A N.mğ^Ly@ :t7uن/WǦ:Emocܞ zEp½1d'VA"Oª1\~x1ڌQ(=m͓(=h6^yϭ&_ۢN70ݚmzKe``T/mšKUr!"C1ԾZ57~EsUU5SKe2( :] }3Io,G2Z8l] rePBޑ<Τtt~A%BOn._CZh4p5mpʄٽf4/^qP"I&QS /\Gfo'9IsRJD09Ӄ6I'Kw f# mg<1>wpoYg15լRvҹQ%~xOH#=kۙ>6D\ tWBK@o;Zm;Zn@[gyzصwRּ6!\֧pZmTbmGP )ٜ7 ܥjb6:}mǂբrcïR+gN0W&XͲčL^L9uglMf8>?χ*gGQu&` Z)1 O8ӊ4+Gגm= v UOKpqƽY9 ldACȻ?YAé4C,r;hp ӁC4zH:}:,cqM|Uۓ B!-2h$v|p/]pmi+gV¹57y[.։gя;Խ1 w܆o=͑Tӛggs_}' WvK{ !-c٥`[taŁFhw2*+BZRZgS=c%)ͫOfu>3X bbB&cjcr/S%ܼ!NAڻ>\9:t}6bM鰼zd5'woRZb$MHYh2Z(vD#6 jӝYJFY톞hP?l٤JOQ#% >gmPPaM3ϯ7Lpdft6>#rpIT`+&(XycNp"Zb 8}l E n 0۟p>$t#IamX}2Ji9>ra[!O;Vo.T*w絗As.iu$uY~v=R֠ eiπaf9zA'an18߈N]v^̅޼#a0- @w#̍en=vFL~CrC4Crg&35=_Q]uw4jͅ!jP|tXr$lSu*:0y, `T]yWe*%w#m%}k<`WR_ىMhж$vn2)y/rɀ"qZǵ|"0ܭ\UVy#Y`$ Niq'd^7&:ߗyyC 0mBFb,Ns[z}S-X G|R( i#pMęz4 WT<%soc{d*o߻c[F\O@pmAYQiL`dI߄CKxP(6>ZRœKi$R1㶢N<]naAp;4Wx]f7ڞ㰺-Zhƌ{ylx~HւWQ0|;>|b`hA+d)vvU0I[V i۰*6ثp&֡GZB<(*-9<2TĥXa'`zqxX^G)[9Y຅X) 42'uThbϏ.7::nKNYSE뒾r鼧q$| i`LqIAhfAmm0F`T6W 0oAXkvq 4WCN5zXTyi҂,L)m$ENy3FX3Չ)dq" /^WrCEMThfuσ?R4Dè0{D7OEe~G6nd3 ު3oak/%y%vlJoPGL+S` ye7ϱ/ ƙ!xrG?t?<+oh6.,/rZLFpXj0%'xB 5 \$6|˄8j6"TG3K r,/#R7%E%1P3FbCq;IXrhЁA3gN*D:zuoKYrɬia3:Fq@xYjZv$ |*pb~>_= R5@9Smd=N1答:)+΍n lKn ~ٗ2P%AEPH'bfs-)^ʅ<(ܦcpz<,r>]]Tu6*{BKL`gL_gX8c.P!scžOO9ٮ-j/g)T=%$ MKM7J=uj!ly: k2~t*葴B_sl<3f;忐vawѸჸp$MKƧ V5pٸ럨H+V!2/(3h2^,IM*ђS•ubngZQ4ј(3%7B]Iېݰ`^ 2#Av? z2Yp$?eԟsg:ޮ5snhI,\!"/`gX6LKH\c`x;R}q#^9!fz&rS_!PN]#/Έ$xh7ꢘandLf+6t=$wkS eDݮy+:|5(" u'M).a ș,X*w2xUO~:]ѹyS/*8'k'02 j;VD|JÂEtٞq?H^ucڄήz+}_=2pX[ >Y -26{ْ%ʗ"^ianTr %}y;l]E5gϛlU^k0ZQj6M,0-s $y6FYIXN2pm=CJk)`cB],cH|])yi3L_i-`U7IjÙt?}Ry5)?q8Jň.(P-/OZq3 ( 9 3p3\>oI26XٽU-鸰q!Yp+gä|ŔRC'cX?#Oo@doT9YӅf@f{H!y^W#m˚hEv|cl裂}r_P3BuJF_opuy'4gD3oa&Tlm7$QDD piWҵmk#*j2mjDgLצmfu8MBuVn>1ۙVw__MS &GLI.m#AZwֆUUulj)B\h[=+[ ?N=8ǍApnЀ 9kK*'8rRoʑtЊYĽ&珢s?Ìp• j? C={G}k}W35ʳcx9qv,ЍӐKyqL>u_d?<Ət࿗h.`?iQ 9afž\ks!.Xi %}"1p{3k-k8i7(M@n2e-ڻo\ΨK-j m2tűuJLK50Kfܓh&ni#E歃"vM|crڤҿÑIO {Zz=>| 0p80؋eܢUBg4fiVPAA3 3wl@zۿXcGLnz*bP>l5S.ՄUipmfÆh?I;];AP,3bBkd4cpKxh+{7hxLTկ==6WG@x['ѮE c^_7d_Ç⿎U>(cw[&Ƚ@PiM:n"vQ{0(>1=2+Ǔ B M%UK;5TT w%gb0ЗO3ܐφ_2'`f'%{K~U+$Y;}e__/+I)bK;'^6cA?̨ |POⱴ\< #"},JGL <0yp#ZN!Qg-~9f=j*^_]v_Q%FbX z?|w&2P8jݝb5bT*{UA{؈#i endstream endobj 107 0 obj << /Length1 1626 /Length2 15319 /Length3 0 /Length 16164 /Filter /FlateDecode >> stream xڭeT]]&qa-Kpwqn?cҧYcR( ;gzf&2V-K/4|((;-AvF@ 4(Aj5e ZZc0v_OO'Ks;+do s -3K ໂZB^ :]m,M&@;' `34'XN#= fGE:Z:9},FvΟ=p,Ll\L)7 #SLdhi ̪(*oFvT@f J3̧ ts'1`jdoc3`8Yڙ':#3?:[F6?0X:;mY>s86C`gV@fM]Q334 LAv6S<3%e>(o!7r+G%5{>sd,ꤜ>["lgI ӿNn@SEKg g%W3:X?yWKLLEjaibmVL+OQ^wUr8bȁLO @y>qs0yR+匜-:u31Iￄ336*Fv&.Vy h2 JIOub/UWM .5| byov?ۓ?ԅeCՙ'$ okMޡ]9Ԇ]쵥3ęַəMg-d؞KT)b{_ Ry4S-7OVFR U 2|p0X-ZVDf%Hƍ-v؃=qq~G$ J+cf%_8Jug7$%G6{Ńrcx02F7.fX3|˘{(4u#bh {re3u#Iּ~c1a `.Z];Ӌ?a Y~*;@ #AAfw+ |ے2o09%,9hD796ĜU՟. S3u p mBM^Bue~._:3T4'İhf<-%YcSl>$xcfMExJե ug`Vrac3NZ͐{:^6޵o2b+78%FJE ֤_EX| 2x7bO.M+SZ?gW{i{עӃ= 5.k7(Ɛ0鬈G>*LJ"-ՑUr#p}pD: 1/pW[qgfQ*9ajZ^uNS[ލm4mW6IDzUy*wj}_@\38'WGb$ Wԙd -SzPU+G:wfuLqĝ󍕎RD`~ zGo^@l&9bQ:MJhźKXnIdqȉ_vN {.D04R74o?FfxkQD#LSSPFwb>,zuNNeiy24c_n@U]..KR$10SU?SY_$X5f~vy;/4/d̔C55+?XwO}2rtTĊt,pEL1=eu}{qq$H{Tc@qT?iS>Lg 5Gʒ>Ӧ@`001/d:zf7wnBFO+q.zv jHG r? B0\m1gB*<"[DQ7'bW_\9Q{#i--?9]@m{٘Uve\1H2$Rkc  (>'K||-?ԯ3Б,PYq]VHb)O1)$4Ѐ]4s#3xK :pBJ_8>ߺu%?)$`/b#v;e梋hDt32ͨ2{@1oz8y[y Z̿znކ'[hF9,MJn,k8Zk|Sr fC0lx67*( $EB օ^/ \ϵľ aF5"L/iI -w9!;;vFzdOC+jZ > HY>#@ ˟h3Vzrh璥FGΔ+[! m!e]SD bkt I:UQNSS\7^|ԅۃ 8rȱTJ O>ݿ1c7aJʜ=&Z bMV~j:X.' --BNȇ4޵3-n/lVx?&v5+Z5t(]č|Ȓhm܄NEy 4%}/ΔshV `5(7?qL8ѮQœ5LdA}xRE:1,^TڸF4GvdW#nUd)dn"hs8أ>VLwř6\t|*5w&X?ѧp5Ӈ&_qToyUnpi<]E]CJX[9a')s0zb[5i7o`JfW,A 5EňcyNΔ6fDzlu6Wt3J/ɰ#o`Dm(f Mc1.-!~d(!6ZpXAق{:C)/; C3Ι)o3MT05xWwlۍ:Ļ věLA5C3U# I|nHKp-<BV~uu렎~D~0jaZ^3E|0U{g17 LM7+!mMm*vl]Mh~3p2t$:C||%y'v4WƆR4rOxLrɡŁ'<6m*95ŀfrR VEG~T--QmNt50 jg,v#t8~ sTeqT1) >=sx򾓄DdM>dlnH\G2Z졊;_[wÀiHObZ`ڋCuBV=%Z[t%=,q#+B΂;)js`bM|,J~teF,;at2.I˳w¢ɠVt@s͒7n tj٢*Y#ه'.WF9͜z4.3wN‹C*`Oޏ|; -D kC!zp%{ M1ƕ30Li;o%8*2xJ5Laa-ΦG=0cRvry  Aʦ%ۀgrZ(DvfmQ$H^ɡMlt 2<vP(#ƽZ[nݔhٯ/W:(oB<uulx{ѐOȊd֦p)?ƛFKJKazwV8\=pB0/_MDY@Y]cd7yj[HTUVf$ f?Md/c1M< Asӣސ/`BĘ&3W$ E߳Cb1M73 ЄA:컁B _䝩p{|)5wag-_c[ªd2njd[ײ@9.pf3ov5`ϛ ̏u>L*irva0Y ȟͶNTAH9SiB^&N{%by Gƃg?m_yEwD>d6?*ky]' ^&UY/H݊@e0~˸ztWxX&fa1 =0V[h*o+B8 C.Oh O0[-Kӂ궉9QruBT- )E8>1=c3uO8ތ4 qVIY$x`(3ҠEOzP*+p'²yx3E b8ølajy1Ң];-<ٗ\GԀ,*.;4>wf G@ ^2uOe",3^<(3yIq~[cESۦ(\*P$eJq>; a -&ůpphH9U-ŖϒqM?Q7.Bhe[l.ɦ*-YVg>0m6<Ins'2o.+\@`ZWu|eX4Uc 򸽏:t8kǐ"8n>43Urb"s ko ߡ1VAPFoǷ=-D#+?uAKIJE Ô[{t2lRe|D8|qVf.׃,ѰLgW9 '~+oA 6A.4ϰŰ]{9+"$ֺ#szlJnNL4ȃO^7^ɶ(F^T1ϊ\t6-΀tzI7F>%2ڭ|n! b}|Z<X ^]b᱐U䗍reZيr~"ފs;dM< 9^H-0୊[ VP?3#i ET?*])(膢V_P/?%y7gxs#_j o>gi/3XIa.ՅA+GR1*]%  Zіr2eJ sP{zyے6"NB3+R 3N\ǎR 7rAxOao3DBʺĵ`1S"ZʩRt֐]es&qd sZwtNkiP);k`[gӋ%@74AO0pS h}e.{ e*·kFBmX txp.4Y) .fzC5oCpeӦTD!!UkiBARDpck5v:aJ ֓J-E$2<⡻c[ = H]Ush~(΋"鴢=E'[UWTqhpjGܮ+e!j sy>85dd4c필k'*eaRj'D&5v%ݛe1HӦ ֹ֓m@|FqEVwH_-:l= x,\ ɡH٤o6=EL[O)=)j:,mf3SmW?<#!8{ )8GH`U"߾ZɵGċG^`v%Md7Q N}~;+&`_$r()mhRh8=焲)u8% w+Iy_9խb4L]YVDx!`3JRAl'z(R$/<`Q:b5@gAt,%^sR,ܻ0& ykgihý[ȉ貰`4`:-xܰSX` n 2yrO4"K:CCSI׬OW٘1s%KYБ8H*|.ꅰ ɟ(mH{nV)ԭa_&< C*@< dV mV{BFtUqضTWg$Z~U{D"֠(U{rG YFk՗\P#Q]N\1r;)nkQPy}QFr@^-{ Bet,5ٴU$C񱠚֯h)/7;ocƮtn.'ub n(ƎqmChnQe }|J ׀5>6ob(FC~Wzjn5@VZx>h7WLF֖:0 `mc#>{<{FMw5ۯPߕX'g,]XܜM[мIz +|PB~lMcR7Ը gd\t.ukQ쯅1W|Jr/-^㌎hϺK(udu+Վ:(ְ:񕢴+;zwI1JD)w7wx^5`%n@_R0D=q qX7ݵ<趁'3QNelr=aߵ=]nR vnpǎ{X~<=Srm]ɞΊ P)Q:|V|v~*Hj_NE3c ǧCLuK!`|_,')报rn]8 !_q+b~gqr'on 2Xҗ N\y8u7EB)Wmh}/k푊f*nIEdWH/w\]c#tJ ĵg^ŠK`tXҭ;+_+I܃Teqb׋RRr5x:Y.7,z;> n`ре4SuAyh팢 <[h}D $s68fyA tI!sl_)H,_[XmPR2TBYU+?t~mտ6b_X\p[/ؿj֚]2眽a)zv: Yb(|*qշB{\d Ma~<2R>Nj[=] ,@it`]Tm&%C~+hҠ QM=?TؠS5rW^M5:O_\f;8/CLac!=Mم;7nr&&E`v*8jݥç5N}Á}{`w`=(1MޒTl 43~[Y~3+$|`cC'RtJ 4crJ Z[^v_EÝl3a~ľu9 nc!V#iTS=՞O@D.tTZBa bYʦc$a2qZ}sK; Σ򬐶.e1R)f okl,HM~EF2?qa<"wXC˰-U1T8s|5.kܜyP6?D$t"d>3um`R@vϋ^JVb^8oSK)2m,ɕU5Df*^249Ee$ [8Go*_[/1 aa-E5 X; '^UmwPZ'򨎗;jC-+W9*'s_uF;VB9q  ,*1rtypGXw6Fh;V&?^~@ŞJz:~EȠYvl>럠(y)V P+g ͝CAF{ 7 aóy6doGT*E ś;iHC`P z(! k'8+C59@"AέNQc|jokQ#j2J.=P_GT;da6Bv=di\wWj? TnΊWrVɫ#QDc)B{ 7npeR,ImW!5Q4)/P!j*]=ٵ JuQvܔl DӞ/R '#[ƱgM[^qJ_JS蹡kh]4ͥ_xlMgDu׳$y(Z;PȪoQCWV!!X&0G:_>e/:3Edk*#3.ƿHYEpQVՌ|I7݆}?986Dm`HgEo;@hx 9J̗YFl &EOdrV1:'*B)vbOrG'-@M|&N2H4^WސǔƗo~k[vle0sWx6C\`Pg$#%J5ԧBeh fqL<ߞVٷ\AlekFigXmu}paa ~_n;c!?G a(٬QsF1<|1CФ71,KBpk>q,12Sɶ0DdNu3Z.J$lǾ +t@+g/T=SH4! \jdl{5Mk5 ˨+a:"!Kia:D[ ݓTZ w 1:t^m!囃OF 㳢4hD֟oz{f0Fw >~)Ii_ 3o NOjp9,!Pi^rQJ[S䞗:_&6bIhݪmV)H8gh+0tTaq(:Ѡl!iEүMGOMƖ{|RZڙ3}dF_Q++J2^N>?X|(N=HwhwZB^OzDY#X6e 3,@rIB .liռyڇ(^4 j~9wa4SR78yӧh\΁$NYkAs2TQb2v#LkpLʻ7#k CKO'ʗ QVzUXlJPaVƋʙ])|Vy3{dQsB5K]]Mct^X.\:6 =R{+%C?Gް%[IG?F&N8|eh%FR] \v*YBeTQ$Jү Ex_k$*r\"aҐe{IT]%jk$̐s[Ycw]‚Ĺ`!+r>ʌΰ{t&_ze=461W%)pxps|][LŞ{_EeRQ0tdYǿC/8S$VUi}WS*cm_뛬A沀NWQ7)ׂzKkW4 -omМ`x.3'ݳN\Gs/~L%F5]rЉ>1G]z]'<)&뻯ϜSQ+^ۭ+äE_U:Pn Yl|CdmfAp0ls|YF9B G0LjSam>JfCJ)wF p,Zwm6Qr7Lv3_['F)Gh< > ]**Ƨ3m5&Rh;W}% _yPC|BhW80ܕ4HmԜķ >EKh]|qK<f-xhr"P\G{FR\^咐Y*^vT F_G}Kwd\ F*W ^3IfsL %Mvlyj؀t J4)mG0`#*i .D&6<cJ8wlj1h9e~*m&ADb;Fkx\rFc]očWgNڳpTk__'# wMwza.d]X8*ͮOVsr!C,}t DLoVx]/cs~j|q!H# g%KȯP؏_I[8X{dHєPWDn㧠+Կ3|CQ;e5O;ZRqYmmsc'C ܝXNmۂDğ7?$չGErQ3TjO+lȸ>'YNYS*}; ram#G6 A⺏8!Sg5?Vh-YA@GPx+;Ϥ?OGoNttm0L|*>)N!,B.ꍉ1+J>~ݿ._TzݖAѰb _ʰ*1 ݁xN4P 2 pW05LU*()YvL0K ,8(2'Rk{g]XI^{KL5mTtj` t86=}TE"7~ؠ\|fWA ϓո_t$زheƽVz$ Es$m҅e~)#&`LϏ;Ѣk_BKdz"gϪ"5I "J{Wҿas-nAPQo:;l/gپ/%1awV |S'Cv+ғ"㖥qwtbv嵟l%`k ?zsB0&IH>^ ar|Cnt5)O[s! W|{c0EB,pHk4"DNG/Pt`I]ڤ'DA-P??sqAܶCH.k.ܿ3u xMuڙy,|qз˚4톴17u?eZv>?k;3E"d8Q9 Lޔ ^NĐ}C7l;W͕Ei JZQaշWۢ_?~rK(X h|1ٻ.W dGrzZu=YЫwx~6)Q57LIW~b i*gA~-E'YZ9}"T {#S, 9I_ڡzDR?Y|1@9C 01z ý Az37$h1Hx:7maF{w6?EXeGDߕ!.KϢō_B{/?)B9:hs/>& ` xph >rCB 7 Ԡp]^>G6;t>L@)0A8~9;y>WJ%8 Yw+NU((KA CN 7aW3zCq{' 14ҙG5k|9#Zsr^ 9I2qD}P'Um\-N: U[r' #o09"TGVǃOvBt1/ץD ̾HTpE> stream xڬctf]&b۸Sm6*۶mb6+sNu{&k&#VT232ucgm\ldM]ldd"@;[QCgSn @ `%{8-jT44%`N@s[WSk;{S[ǎ*g S %%/WHښ:Z]Y)`OiN'{Sc_7SwcST{SGw `hhv? +!{G6u휜΀QE?;&v./_ZgCXFJ hk_M MM;U'_vNfLc;megVlL_ gf&ahbgk015es@2;P'ߑ9.}.6;w,Ecm1Z{߀I9m_j-:MM3C=\hk@t@c+H`WϠ!!"!MX2T;Ϊsٙaa;w;'3"俀,gt_N??lhkwS/ZvuΘ'2-3ݹ+whBTP}ijQ/J)6?ԇ#=)>$T}(4 zg^W ꇻJz%S,WOT$褏Ʃqȍ O)G~@b&!Nr0po0xupZjBDƔ~Bh%(d'v \OK4&2*W׹$u¾v^ϝf ;jZH#)bDQ\i"ȉ7Z+@&Ə%X?Z+XC R6P}H7Fty((eJ}\+Nj و)\1iY57 %ۅR&sO"iH-Kv}ң՝&0/`0}(S 0%}R&+˚}`T󻱑V'Dw/]8%'}/ xŊG*2i8UzAT&L=C; [Ǭ9?R,heO}rJ L,m#>~5s1>/dp#إ+KkX׾!~c2k=%ޢjF 8($R4^{֣lҸ,F47MO Io?blj6d2:'uGW {tE!E@3׽&(ҝEsw4H 2~pΞ $I/xkc]^%-;u7Z6nݜϒ\kw/_̖tTGΩl^Q^yJ||Fo.'=fݩ 醦ՖTЦKLџɋlum*؀po؊`S K}85aoJ #U<{:.cLfVc`)h|{u8l"ub`ZS/ l4vw%e:1wՐ0M_g2TTwG\Gnʟ|⃯İVAz~sܝ1]3^^@|R ,l C9r+hh;Z"\f6ґÏɖ/!~värtORW6!,KY>;/#"4AL%hY᧥ozot%|;7|PxD.ܘE 5\+ګqro)V\rpQŚCK Lnm$I@ݛ:j[cU|N`HZBM@.3!tQ`WgGaK[,;#̯[)_)YfeDW ]«UzBDϖ7J?H_1/6"Mji2\q+^Q507Q}Gl:ż+#exǫsθ[SZy`GL֯B( V;Һ;!JD'PC5Do;EFTnV=-;#L*4cJfjЭw'B U5Sڼ&q1H/Ӑ@JN{D8iu /9&?m~6m$OF9GkI7ux` [j!¥^5xLS-Uemћdb\ukNYȽL|TEoԍ[kT]@_JϢB@C̪e>v7'au|1A(~K:û@\Cڄ%.K`9UT[W$]B2j%PF8eYaz@$5e5C]L=2L(k_exU U9`gNBBmlN#?#33 d-0^xa-Omlb;Xp.m,F?ኳ8N6>G5&y%ԶRձA8 ?NWjMj7ca mYeAkŞ̐ *0:ү\B1n VYʑ/ΡxUJ=`߫@Nͨ1'_;x[lE`-4i`oIn{V>[@0B^.j;<^ ;Gq7ax& .#4{^%镠 WO@ 7I}tIPtBE3p^M-Vwg)]D g@C3@ԃpNv5h7}+!)WEnB%G(5 R^c m> /,)#CI5mfk /"}NVN=U$K!lxɐkyzһ{zJAh^hH֍y 9ǂp؄>f4_ooM /녯!D?rC@]2ޤ R'i v 6UxC}au^TR1߶_ Ny&]Ԟ^ yEc+'.r1DlT1Xc(5PEua[I([-=؆p^?xb'LJΥg'h6}6 Ԧ&5I'+m1?jHL߻۲GN?X_+TfT4Pu$v ,zY9< KT"Ѕ01{nfs|D-t XaC6w"`o0ZVlӄIs(U1Z\hJے*k%҆#s%㔭sQ{ZĔ.cЎBe,&lːs~h;%FɁ&n.gMG?*C$j&ȎDeWE2 7>=NrEw5>saubykоFCV: P,a_Ki`t_ZqZ$LL5@AR#\)U5__͒t80*{XIhu=;Qg刎R]249sџuh3M2+m<Πѩsd C䱄šL7#9.j =t $$Y$?z[uEr<8OFMޓNE05AMb~,J!hz[ߗka{oxn9eg+||҅vu`&ƈ@ǥkz4Ӗ/EoQl㸭@ߝ8|Z,% woo!*"F5Դ/alZV,$׭LEo@)$7`{Dm.nnpb"šW ;`;y։NQ;ED)VXB]^/II~a M\iOHYֳ ٩ΥڧCeB2•Jig M* iq:4*>u&F!w8Х'kC]C]:O!DAΡ&D^7ǥF\CT(sI%3oʌwp}3˹Wef ݃f'R'ą(\ɱl@R^*_qcgZ,l"01Bx2.;!͑ɡ8$J5}3S0Ix"'=KJU1 iF!@ӐR" tȀ wz].7vفn'i ~v R-: 1 F:5mn7|M9`b0Kֲi_oWR#~pҟO{9-Z͛mEd(JTQK]&=Fff0 Z^R4IN*6V!Ϧƫ^",7 T4EFHXPe?V#÷~Zka@\լƀ9{^έZUg ׼^\%F!#(?a ":eOѴ?q/q,'Lkb)lihdyI$udQV%wGC"D=ZuD?@FXn3m0֗:YdLV bScm?g1#wThMJo0GTGwC> Ϝ8jv*om\8=jC!l3 _vЩ49r{19r ZR\c)O#W**+}?f:QA Z]: -ZY>Հt"tTź$9]8YG1VCWZf͠3U9( E >% mp[NvMxRjuV}~:GUh5G3ol8[s((fe/k\ N!,pп)$f)pC>03-`'X6\ʆc!,O)?RqgZV;-4H<9gj YV,S~yENϡ) p,irHx}R>>':mv, K]3i ?]êp ?C1nqku +$>2~~#/oryw`m#!Q%'gpT|3\ŠMCMq.\߂dCUqA65!*%A[j8)t"Jyk6$CDJ 9;Aπ^!dP=mɤː<;x G"RQi;=X}R$7'g#<]Jk iG=ߔ@0{'Lhe5S]N]y'O|oX8R0m]VTp g^r+cU - *N "s~ີFA#a,HW;ؔﶙ6C>1Xt#g@"lM+B^]3;bi#Ake@ƻ;. ̭v&%KwuxkfDt7r vLG{%YHw!@y1aGN0DWWа.ҭ3~ !6GoH] IxawǕ~_UPkV ɣt90%RF(Q}G"G'OeʧϛU~:&0P> .DlF7LiFh Pn#3Ac/Յ(yke/;n^E:ZS= pLA݋W3˱o]v%!M 1VYE-)r$"һ2pb;C4n.D|eAsʛ,4ĎqJϻ 5\< ŰXaf i)Kz5]i7%!BO@vpM>J|ն'WA(1gY>zXj*|o.PH>olMv-//UFVV2ӯrq=X5d8rݲ'؛n!f%X{E;672)>^XO&wDѮ_ԓۑӺʀ_<Joj^^Y7rQ{̮ppU];Mx5?uȯO" Ktn_tmA9 jJa:r6 $x@P|V66#2T޽XO2 O@ P:M u0+{{M9uM&R|$2$ik\"._%$@=2}hn=s2lR63xSzZ Z;_dZpvI4%BIKC=3U"'5<|W34_<;"29mjL3@o veI7[ 2LJ5(0lKKgA!W3Q9#Wp=8*8k7輻=Mp5LD_"k|0;+OW2u ~OBdRH53W#c#x/&rA Dl[;M $j~ppOaV-]Us~2 NW,ҥ!*^h=ckA(q_U7CyBFۢw٤ GUA V²!HbоcRB3v,_~zPኔLD UIBV׽3qVz#\u %WF€::^IHdPU KeKJ}/,bejv8j+|wm7Z{QY9ԏde*fNWsl\[#6:Q`vꑄ'Xum;La]!][`zr=- AZܭc<8AxVM%gkD j Ӂ*=V&休vja`>H+_M >߈7;ݠl|a5:a?h1zw|z/X>)||EYD q)A,pB`cYaҟ^yCIDVm=TK "+}JH=5%:T$Yʡx /ASE0Ka_i9vC{N` N@krܴ\u|,U6ƕ|.zE`O!K#w*}1kOcv|O&ʢzYש OLw5:sg^20I}V2=ΖlKB~Sň+D2X-GB(_8-+'YX<|nAv cȓOn>)jcIE4B*zg}RŌqGﳼ2< ~.Q64~ gVa^?,,Zd-NIVg!Ex¶hS+eAlxӽISMFc{b' RPt$6<^ _&ݟ`!`zҐŁxk>Lt~?q__,f!@R i5&/ .Y7Rve//c՝KlSj]cS,=K ;Ő0A&jy-$786nF`JM>w\SAJ%|Nm:f.J6Sf O{[eN)H郳d?Ҹ;ؼv ,T+I{Z. bp* DIj(?ڏ/UV!=17 Xx]GS;Ӹ"ޖVW+y69~>f3RtTr^o` A2wJ?*LXGK|vZDB>ϙ@L=Wm`[i@48:BofI'p CWmfHÔN5v/hJnQ<|)5BI/Ndk!(C1C'Z@B rb[`P]f%!OoIQ{$m2`MҗRJ 藳lM;^PVJcb~"hiɶ190dL|cKk-N5΋A2O֊&U(DqlΡiz5 Xz٣Iհw ךTWR S䍸-HOJ)'ymM~ɇTy+[2}jIx tǵAQy{PvRvKjcتz\ WA ` W 'v~{v:M>i7$jVqPV$Z @$z>{ٳp9/y)K)Ie6gmEM?9@8Px@?&`tiu`/`$"|6h#o@2~e8EFKvu+%uGFI=)'6ǑEkǡ3Z 썪-ي{45kQ~tQ22n, Tq3gf`$#gz?42p2T|R$"fY~~4IV;κU.J3U;sͻ㻠|[tAgأTa$ė+D1׏mK}:Uk(4'םV׵d#86T͔ Zƅ)]08 hs8g.,ik(~j&K\c'>W~cj]'jG>$˗͡)]I8L!j0"~vMͦ% 9fF"c7~ɬ"K_GTMZEP)j44<[&ӟi]\P| gO~s̖/ ;G1֎v< 9Ǎ6/5Lj,uep<ԥgvP4ܗCYñ>-7 %/F,^zaell_d.|*%Ӗ؈R.lks*2 4# ]KM~k׶+u74#x7Q'5mrv/ay B[n nijz##}+`AS37fK^&Sԣ/]dKK ܎y6G֛'ß,)F`m >P|FWK/߯~=z0>OIĢxm0nhXZOS2я_+T)? .[NMrvsD;Y<8jgj$'`)`D7Zxpd?  ♍!CR }H%E~~K[xP[~& bJ.l\jS{tjhJ%Ys@5sg&ӓ "mjSܸvNguyYs$<7RQ[@`ԯ%53#;9Ju|տ݃)7JTrD!ge.{؍~cԹ/2]ąۆQ4 [H%/PʭO#1#Zn()F|F9 3DlqN+1GL31ǣc8Wj22dG=aǑ*$. ;J/ Z}}DZPo5 %0}[~ٚ=H1B X1 ʄV? <y;:xJ#"zk3j8}eV=d˄ *qGUsmtˌ 8 l-kK ܊Ӑ2a:C*6Nk<` e-W)_6G*Tj1Q #|r cPX-ɭ;4eOl>vѐEl b8^U((*;uWgܕb[؋PI/qa o0\UݽU/=ಯA9WPW?ЁX.&.c@jWe PFfG]Zcd+szx_6ŝ(#IQ3y+ |MAڲXkGI6t c?"Yk\<.DOI?3rXsZ6FĈ}Drd&WUQ8fttI9Q mѹ `! s#VJ/Kq4\ ,zh&k\7˥s&)QTm*8axܖ1F-ߪ˔j 5vd7J i[5*'dAGmsYTw6IE,1ɽW}'P%VJtRaV\w:ϱ#Ut*lX mDe / }=7~757ڽ[oIH@%|kZ*u)|:"poWe|woCv0G## eѵ (F=09(_\+#zTZphL] -KvpwCyCYk̿60d(E,bo ɚr-ۜvneVj?D6^ f89G^2s T㸰#bItao{r( ^ ik\-~z1+&^D!Vf/X8jy 6e'X]v} %Bb$uė nⱯ^.OC]BUx<5Z +X)o*?0ymh()1ʀ.n0m9w7)*]N/y&xTSyE52};ƭ Yv0D7*a嵧j30m0j>l(c=`XE>bw]9qǸ9ݦ ] `&, ;&|rBxOVc"{p|VXW;%(|??wi( %w_ c ZmOpU,"1l0yUUI y& 0GOf:'6@Ƶhs%Ya.{12FQU=.-1,襼sҸT=\)T[&7tٖybKLTVTJJϫۭGJт,[뵫8"6 fLtgr<5TjQxOE3V$USI٭ 6B>ÿzɢudfiNsp ?mr>6?1LGPP=%>nFW]eMoʖ#{획?~t@R#ff/#1X,f}a,bPnufj[\]=Dkz-DOZkl E;$ Ir? ΀.;[-*KD|AvVL2pJh!dw 9"dxE^U,U֘1Woy%Fn`{P/JZWb\.ԙ&Q-`<_ {4 ª K-[HLPӥAοo Zy,Z{K,[V4x-2r+ Moҟ4'adNr뛄c } k/^<|rE*t.F82X#t,cA8 QOux֟ӕ6*aDujqh|%~%(g_Ғ ) 449Ap[gYz)58= prt]Dv |C KXz)e"U!OXڨCX51LL{9wUa%c` ˖ކK/0Zj TT!I_-Dntڗ!z㾴 yjoO p/!^HDT@J9>ۦ!LiY L{c iAV_c[[(DzY`ٳOs?aOyT4W_t B)dpBbq9 !8z)62/YJz@*YG 劙Τ|@!Q٨n$dqɧ4$ 0"6Tf%>09q~RzpC^k9fJYcof8MKD? x_*2- Hhcv3y>ߜ$M5[><L=&`y~@MDW?TtURRM4BSd-FןҗR$5$*RB/E2Ա]9|oLy^p:gze~u ȮZs't=Y/ͅ{J&v|mCZ n׮1P U[7rE!)YrAߨD7R h||&쵬+݌8I/H$˔ ` <"xfT8 O*DN<ٺσw_N,ʥu׋*7S!]b!N?$3fvV.-nw.`´NzggcK班W@V;/6U֟H endstream endobj 111 0 obj << /Length1 1647 /Length2 14201 /Length3 0 /Length 15045 /Filter /FlateDecode >> stream xڭvct%ܲmlٱm۶m۶c۶tl'uN;sy{Usլ5jl2"E:!Sc3q{W:&zFn,- c!#q63rr5r5hDL&...2+RMY_tp7up3w;\-VfE-)y @E7c[+`\迸\FG3/73O3ǿ Zo \V&n%e7w;!Ggv_++?t4r+ p0i`WIc_4_ XfS+G[#_dVbeo hfFΦf.._4_οmv`bfkN+= _"eo`b?0w3򯞡J `jf @?SOW_O <;Wc=kd-[#g_ r5?'!do=?V.VfV&s#ۯۮfojlkeo%o_j27t9%!Ya9f}Y+\U!`<>tL\:fƯaG.fVGؿu3ru0322޿шٛ8G*F_`7g/_!0343Xu0 rm` s,oV-) sȌ6|oZps,M}21aKџnv]GB5XCAs̠_us,Ψ~r0_? uBH^FoєރP|qIrL129>6>xKMcvAelǍ$Ȟ8A{s ewCȜpKe أ /=7H$$x /mFZ-]3y=W%Q&e;&~ʳRYZraX8&R{1E{ger㪳P,ȶd(Io?T/˪7bߛ,9$P QGj}^ڙDOEv{*6ٿղ\R NSz<9ӈ+;FZ&5|/{Ǽ7nl_ YT 3NR7肕\!^)@) iBg݃*AJ2WCg  6:":c볗A{A"+][(\[gJx pjy̜ݸ`ߣ8^Y)<2Tt=՝l)e|[ԪVͫD^o3DeۖP9`!4ie☊l3vJ,}x6JOˉ0(%A0moIUI L oB.m?5'y5iD{7zDÇھ'pD_kuoDs/]#7yiWa@{7/}Kݚ'?7:$ǒ[:M/h@2ILeuJ#&TU̖5)BˇcnBxC avA)n:4q뱂YZ&R@j, s(ZƮ4BJ['m8X`gCc-UD>%mS{?Q!ImPmOktK̒nC̓kRNHj.!2d_x6 J&ꞥj2hya:"G ܅3J.'Нr>}Lo^?sW AB:=ۣOe-DîdM[y٦~$8ćukn'Orķ(av]cۣy8 +nBf:jTl=JX@XQT+۟ԭ@zYRD'B0E^5$Cڌ(- wNώdrQjzW2~<;[CM/ vop}M{=L|izAOzW|3(TAEuIoV1d)e/M_$+]kf$\>Xq%RGCaK"<ſbl?3|@HQr5喇S.eێ.=FG˨-띰yeKgA]Mj8 9!飃,?tx"Emko,uwđI1hϾNEv(RKKE٭gCq{}}vQ2uq"R[˗;-&إUw|+:pWιdY&7$0D[g0$. /U*i׮VyN$a]?GqXb4%֘,gAօo#])|픶f9Nw=tￛet%2bo|BE̝D wna5rHoAM/ՈpZ>2A5_6P oq`Uuಐ@f\IB`/Jd}7 K(ڏk-5.gY|cY#Hp`M!y^' @ V3{tcN< /Z(Cյ+@A 'E{-b׽ex"7<>;eSv^(#fLx?uu:ٔe@0Tqf_3#~=i12JwG^ ؇iVCG(Gd.@ D}f5CkRp:lYmN7큤_%52:]ܜ 8Y"N+Sg 浝||] 3{}]gĵ.g+ٌDUA8|zKIn_ KJFu KA'㏣3sodٍ/-<>}Ͱ}bqJz`R׮-@s\qu!|yָ܀OYmÙ9E-W`Q=I$I.ⴾ ؝wQ" CJġ47PNݗQu>-"bkVFf C 2ԊV6>kd!Zip?Dz/*}k;zbfgڛ.U`q Nz> !m ɉ:`ЗbH!szWq@CA_A| y{%GPtvf@nvz#zE/DN;muΔs@w}"mn{Q1V $vFNdqfyd,'?`CǩUk":~;,Pi>$!}2UcP\;L)9nSOlMwMTBLh ~kl>瑥boM6%nzS=d)6T1 I7_@~&y L77_v%~<^RS#W2o3rH&XL v%^L()CPYN)>.mrq}=X+dr;GUO[Ժm{i[TtG"r1N;O.i+խ"r\8IH2?\iDy-q0;J9sJWctNroaQlEX]i&T-WO!;<ʭJMs6/frYTxgC:eN_?9+l_x]:uU 1V'rnIujs\1$2(`U?p`waS91Wl{-QgN11HlН|-zʋ9Wm?:onUV58\/Vo`SwErkޓ@1O?L'"lZ^P,ZuYoςʷ* '2xBaPC~*3GwK 3xuT GFӈJxۙ$M<.<{ֵG0fu7rƶ%LU>sTOV.Whmk~E1ZAyZd%&eɊGmuyOykBlxBnc>(; u|Yb&tʅ يo$xLd>b]f4{nF*NQԇ<`6UPhΖ5]&En-$*\U;])AH'}^r%n=Ǟrw. $J#y+/υ^C:k'I 4 ŌwU`#G%q&lOY}ŗLL @q6~&biYOI6tAwm!ܝ/h +K11FF~24 f)Rr15[aN M!\ <"hc"~V/OlϜQEhs[ZP#;8IBHVm<& ăD??0jrP8@SI#/gyJ"6*wmv6VO5eOEߌHޏTx>'`@C$ypW9ԢSO:y8y'# iY荎.qVxRV<åz絸nZ+/Yp*W42 GD,EOnLWQN+)ަ+!8%ӛ* ] Vz_3z,ǂ+ZKix,)a٘]% M>Y;/[Ÿ+ېx^=f0~/`KrRKݾ^J FhTXKLp }(_:!byW 0;Lf/Whd/< kP1`_!#@3c]28zs^AT:?l"uT-\iOY*f6A2Iqv:q;gtr2E`n03W%J|NQA\pƒ~ZlΞg*Ji7~K'"{p@3?W-\P_Ӧ% /2Y8ױJ쏛&Ϣe-/.=gےwb k^LظxUhIP?[Bcba#yl(3-)kK]Kah0>UJ7]oP9!bAޯ՚+G5^9{]*)ku¬ :եlbz|D~sL)159c}!&RW'SU ۶Z1JT_xdu*&~+MnL5_JHRMe? n9n\7tTj{=^Yqގxw~Sxi`ꤨmq":z>o@rH 6FNR2ݫmv^a?9*< S1 tm\ں 5%5sBR,l D |<~=&銿DpNN-sXXtl`^lCU" 69/T9!tVq)L5>݂iцTsDhSzbtumf;+ȑyҾ^ RC c9xz! lhzI̻{p 'L1EgI47=@.6\2^e﫣2; a~<ټ/$+w繘'3;h(B,.dM-l)4c<̊B&e)DŽ\vr|5UJBmz-b6hjek[{N<,N%qdv_z-%68Pf)4~3tB7Uf̈ ZLWIgIue8ُpMψ?'9Ȅ_z!@$Ꝿރ3q.%{9M3R9K O| Rl>{=~| uYD).Uk8io1){0^&(*'44лcS٥N[ +$̞{SJ7KO/Wru=4z⁰Nja-$M2>5@+@:P9%~ ʎ3\:W9It V!Ѕx[o}BضLr&t<ޅT^zԶ% *NJz nXL@#։"Ӱt.Řep=5SQӘI\#-;n"ɋd5 c 9TT4AoTl?xsD*DW\w[f6nv*ao?'K2I:93"BĄ \5 Yu̚"ݒoO+IyX8 X;d|܉9;uxjr7;,[#ۺ0L5J 4.nrOLNrR A >Xt:; 6D/]rL$xfJVo-L~/I]yx:3\rڳlb1;D`l'/Ԛ˧kUjrQYV4ߵj|]+gPrPmd@aj2Q"}$5:Pb0+tdE@mUwG:=LA`pH-ukP\s tpE00|S곓nsS#a'hwQY"%*e`3w2rt`PeD񌮤XqTmٚI[3te9OZ$-6>%:p*8WOIFD 2nE*Hp+ߢ= c,k= >n{(O]ZA:%鵏^塠BZ7H\'>u9g6I F?j gЏG8paŋ3o n/ ^bm[ 6q"IAY7> (gH*Iݰ 5 ø=:U}Q& Yl_QCÌ,K{fRroS!n֔1KIcAƨXFwK|t> KM{ғR$4|nu@Kk-}%xˑ-н82!՟,  >e!#dd4Z7;9Pu`J_FT J,@4xmUzb8GUo;` Ӂ]L1@-- S+}m,UV%AÌ{cz6 qhh$w|K#N3dmt%f#u4l8rVɺ}Oa5)~8-p`6*󎾞Ø{pۛHE #q%.=%ze.ADʆVXc`+𑶤ۖ3E4[I/UQp"7|$M˄DHE P~lG$O1*5b.Uӹ=d*-Xy.3Z+$TzccZgR[E5\)儷+GW:=bc]WvA_蘿Ez<)'Y[7r}g3:v-jB3A& {8Tѱa_z;Ov6`IrQu 8W(_ o<;=+jvgxe8]@ mt'2]{n сU.b ;kc\ Z E%w =*LY)fD)5~gbQ"rw'A_Xw 1#JD 8nVX㷦|P(ޭB(Յ)Gʢi.e%l|) nFǖL懾Wl$$~8}*[g qQE0sIؔ+^I 1|♒6Ņ8)ޡ|ΜQ\VRFsޙ$TE+`RH!BVx< f4udwpu:78QM$ 65q)jqJEA.~o9y9ql?-|s_~.OF0,Mm+ JШTCiAiNxLgD#`yP<ΜZVA͡]`tXXM{փx)!|΀অ=BX`JsD?qP\a8 !c Cy i9_mJ]tU{A޹vjj 鞻@g-Ůj.XB`K;fP X͊f綟il~R@"A]b)&Os5yPm^ {Bd CrL: 8KQ:AU(B #5~X;;3vBֽ4[\rA٦ups9);BBw\,8wVh\*1Evc2| ^D wFj 񓅀?"V{26߈J=W1*uΕ֥p%8N[kyE[w.&`2R&Zэ\.>ۼBdwLT%Iq x,' 1Me׎4hdlD*+jV0)!Si]JvJ}t}lՎyˮhO>(40bvqٟ_B8VG+9n eQQKP-+Mgn^}Gd3BUQ" 0(_v\+=_M[A"I1e v7B"q`v}!Ӡק?ǧ[?ߏّ121`)Zʴ\wCG ]U}.L((DN}'`(!( NB#غ{z,b5Ms>v{Q#p"Qw8dl}e9ZðL^:ѳo$t,)|gCCg2.rxH4C Nو 0֯yJ˦JTM_/YI$HP m.<Ƶ?I5,sƂz*b:+zϑӱA4zct &h+AVA/YG &n&&:yDzhJvɣ`dk)⒤1_i$$َGAHő:9A~"(xr..نmT| +d <ӣ|NtLP z;3i) efm3|-)gp觞frP4]@;SJ'pbH <>n1'!妶zoXɤ+h o?M4Ị/Lwȓ`y!)IZ x:(HcLt"Y ІϜ}7؇)]_F޷H7=G))=-{Bs1 b7Vŭ*" ?a䍌/~a%xBd endstream endobj 115 0 obj << /Producer (pdfTeX-1.40.14) /Creator (TeX) /CreationDate (D:20180918171914-07'00') /ModDate (D:20180918171914-07'00') /Trapped /False /PTEX.Fullbanner (This is pdfTeX, Version 3.1415926-2.5-1.40.14 (TeX Live 2013/Debian) kpathsea version 6.1.1) >> endobj 8 0 obj << /Type /ObjStm /N 80 /First 639 /Length 2650 /Filter /FlateDecode >> stream xZo8H(IXI>6uEqPl%֏IJ7C2-َcp0$Q| 3r$0ba0ך0IA$"-i&<#ZB#FfPAYA8 i() D@Pp09,aJ0" #q.m taIYF$̐iK$LtF)DI%SD!tWNpcQpd e\0P  8΁9P!AAU"` aj$YgpXT2/@+"Yǫ`,$AtA Ҁ^,8́:9aFgF2@41 2K Z hr((A% 04Nv& Ձ7Y&JC` ؐh"`zd؎!@_e1x~ 6a~^Lg_|q &lU(_%LYwD9(#X︧P8@?pv}e<<>)};Ҿxaҵ]E6"F#^SݰG7(15|;prG^d'"rzZDqR.VKDaV b$G;;LEY%˶M"Lk(Y**cG'FLua ;􂜰$Bea }W״SmUjmiv,[xUXO;aD̓YL;ewҿ'! ȇ٫__ uIdqHSп,i?z/ >iai>w@Żi1߫QR0rO03@8@4~HϟO>~}Zwil'Jv*lJ[ i(M tQM5?_9?zvpr,XBu]QXLR͕2(.\*ָ>.>R1}V%SZ#q]1nm{ƛy_ ^yzvtU܀}LXzx웢o: ;$[Ŏ&3"/0ޓ MwKqw6 BDϷ$S.GnN]޽..I b:3l& E׾>[je(.w˧I9ŀCc7)oKc~9lNZOi|v7[t)"爪o 1.iBMh|= [7m>e=4 g6@kJ^3ͨDpS2 ȿu+Dv# <36A16B9F03CA5B9EC6AF7EE02770ED5C>] /Length 317 /Filter /FlateDecode >> stream x%ѹ/q)j]uUQWu_uUFt"" D &6Abe1$1It7 y>W>~\ 91+b"nیC("Iˀ(!zv,D)K[Vr"~m(H<UD*dY#'˰%,Eqo(eJDD봭E4m8v%8MXv.lrIö~G\ZA1%bbH Ⱦ%3vp '7 ob}?|0i endstream endobj startxref 127872 %%EOF usr/doc/clamav-0.100.2/COPYING.lzma0100644000000000000000000000033113350521603015162 0ustar rootrootThe original lzma.txt license file, a small portion of which is reproduced below, is available under libclamav/7z/lzma.txt. LICENSE ------- LZMA SDK is written and placed in the public domain by Igor Pavlov. usr/doc/clamav-0.100.2/COPYING.bzip20100644000000000000000000000400113350521603015243 0ustar rootrootModified files from libbzip2 are present under libclamav/nsis. The original LICENSE file for bzip2 and libbzip2 is reproduced below. -------------------------------------------------------------------------- This program, "bzip2", the associated library "libbzip2", and all documentation, are copyright (C) 1996-2006 Julian R Seward. All rights reserved. Redistribution and use in source and binary forms, with or without modification, are permitted provided that the following conditions are met: 1. Redistributions of source code must retain the above copyright notice, this list of conditions and the following disclaimer. 2. The origin of this software must not be misrepresented; you must not claim that you wrote the original software. If you use this software in a product, an acknowledgment in the product documentation would be appreciated but is not required. 3. Altered source versions must be plainly marked as such, and must not be misrepresented as being the original software. 4. The name of the author may not be used to endorse or promote products derived from this software without specific prior written permission. THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. Julian Seward, Cambridge, UK. jseward@bzip.org bzip2/libbzip2 version 1.0.4 of 20 December 2006 -------------------------------------------------------------------------- usr/doc/clamav-0.100.2/COPYING.llvm0100644000000000000000000000626113350521603015201 0ustar rootrootThe files in libclamav/c++/llvm are from the LLVM project, original license is in libclamav/c++/llvm/LICENSE.TXT: ============================================================================== LLVM Release License ============================================================================== University of Illinois/NCSA Open Source License Copyright (c) 2003-2009 University of Illinois at Urbana-Champaign. All rights reserved. Developed by: LLVM Team University of Illinois at Urbana-Champaign http://llvm.org Permission is hereby granted, free of charge, to any person obtaining a copy of this software and associated documentation files (the "Software"), to deal with the Software without restriction, including without limitation the rights to use, copy, modify, merge, publish, distribute, sublicense, and/or sell copies of the Software, and to permit persons to whom the Software is furnished to do so, subject to the following conditions: * Redistributions of source code must retain the above copyright notice, this list of conditions and the following disclaimers. * Redistributions in binary form must reproduce the above copyright notice, this list of conditions and the following disclaimers in the documentation and/or other materials provided with the distribution. * Neither the names of the LLVM Team, University of Illinois at Urbana-Champaign, nor the names of its contributors may be used to endorse or promote products derived from this Software without specific prior written permission. THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE CONTRIBUTORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS WITH THE SOFTWARE. ============================================================================== Copyrights and Licenses for Third Party Software Distributed with LLVM: ============================================================================== The LLVM software contains code written by third parties. Such software will have its own individual LICENSE.TXT file in the directory in which it appears. This file will describe the copyrights, license, and restrictions which apply to that code. The disclaimer of warranty in the University of Illinois Open Source License applies to all code in the LLVM Distribution, and nothing in any of the other licenses gives permission to use the names of the LLVM Team or the University of Illinois to endorse or promote products derived from this Software. The following pieces of software have additional or alternate copyrights, licenses, and/or restrictions: Program Directory ------- --------- Autoconf llvm/autoconf llvm/projects/ModuleMaker/autoconf llvm/projects/sample/autoconf CellSPU backend llvm/lib/Target/CellSPU/README.txt Google Test llvm/utils/unittest/googletest usr/doc/clamav-0.100.2/COPYING.unrar0100644000000000000000000000454313350521603015357 0ustar rootrootThe libclamunrar code is based on the work of Alexander L. Roshal (C) The UnRAR sources may be used in any software to handle RAR archives without limitations free of charge, but cannot be used to re-create the RAR compression algorithm, which is proprietary. Distribution of modified unRAR sources in separate form or as a part of other software is permitted, provided that it is clearly stated in the documentation and source comments that the code may not be used to develop a RAR (WinRAR) compatible archiver. Original UnRAR licence: ****** ***** ****** UnRAR - free utility for RAR archives ** ** ** ** ** ** ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ****** ******* ****** License for use and distribution of ** ** ** ** ** ** ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ** ** ** ** ** ** FREE portable version ~~~~~~~~~~~~~~~~~~~~~ The source code of UnRAR utility is freeware. This means: 1. All copyrights to RAR and the utility UnRAR are exclusively owned by the author - Alexander Roshal. 2. The UnRAR sources may be used in any software to handle RAR archives without limitations free of charge, but cannot be used to re-create the RAR compression algorithm, which is proprietary. Distribution of modified UnRAR sources in separate form or as a part of other software is permitted, provided that it is clearly stated in the documentation and source comments that the code may not be used to develop a RAR (WinRAR) compatible archiver. 3. The UnRAR utility may be freely distributed. It is allowed to distribute UnRAR inside of other software packages. 4. THE RAR ARCHIVER AND THE UnRAR UTILITY ARE DISTRIBUTED "AS IS". NO WARRANTY OF ANY KIND IS EXPRESSED OR IMPLIED. YOU USE AT YOUR OWN RISK. THE AUTHOR WILL NOT BE LIABLE FOR DATA LOSS, DAMAGES, LOSS OF PROFITS OR ANY OTHER KIND OF LOSS WHILE USING OR MISUSING THIS SOFTWARE. 5. Installing and using the UnRAR utility signifies acceptance of these terms and conditions of the license. 6. If you don't agree with terms of the license you must remove UnRAR files from your storage devices and cease to use the utility. Thank you for your interest in RAR and UnRAR. Alexander L. Roshal usr/doc/clamav-0.100.2/phishsigs_howto.pdf0100644000000000000000000033164613350521603017121 0ustar rootroot%PDF-1.5 % 3 0 obj << /Length 1480 /Filter /FlateDecode >> stream xڭXn8}WQ*n-"]hX,>0 %CwxӭL}I3gG~9{NHW݊ $A,v9ޗݾ18Zl?o ՗Mm{֌Gn$>l1'2Ω9rD%YŌ#S{ WCYJ<& F$8aҮ'` ի;v[iڻ5QT?:W1M /<^2 *r"`Q@;o^{sjzi-UA/܋fgc4/ǾCCUe]fY 1`m5UhWx,܆uko>+htsu~QvJ=[|>w[Q}<KV"Dqf͈ M P""if҄G 6#PB e|S/ Ja$,@;ߛxei<?~+pD!F#]Rp4MViH^_ Dn}B"B:Pn55! 0,tTya9ywAׅش: Ci`4ER1 lt㬯݋9@bw%dkk.d')[0QLbb|6ϐO1W!%\4qCC .48rLRCOws mÂ!f}f2*v!yt9&MkՑ, 0aH.kA>`"'3B-:W~oNLKh 3LL&{ML|sXF\䘭fuhLU8Kd(ɇ[1dWx7`O;6> stream xڽXmo6_EoI.`pW\βK߯] b~YRC_>3o^|fg< ŲH%q„n_*Q?y En͏Jr< ._[mٙyVi Pێ:EߚDI>E>hA}7ۚ-ʣtbe<$T| p>S8XH 9@2{PaIXeSv O7Tz{Wm7R圁mCJmޯQ{+ÀaIrfqAć_ڭ8!ehɆ +qx6Cx%ewBut@}᥍i6's~pX-|83Ql)+6 [!q́OQs;}AC1Aj4+mM`x 97 TdPXdS' K09'[,EL&#n+}߂gNKIH5hپ;ߙ/l@Uc3sv@]JyJ#;~幦3<_X>RQWMea'tac;)0+ʦ@` !%ݣ\W t\,tӅv'9.pdpEsJDxVP~ͼ4Ϙva2&s )tX_!ICJZN'`  䐇uYxe$0liZj/YcO"u\ (FRH@YoP9ZsL,`L[SEoQ6l*7C;[ݙ%Ra34eGP  ԇQ% H(|hз0' 'ǟ!G*?0pGD'֟8Z ~1S~Kr e^`q7N Xf*eٱpy.{.{jd/'xoS͑{(ig)Z⠚zaRf/ʡE"ŧh: e*&8.wua _nmO &W`OKׄ+9h ~m)z/;?t>(b[RC/޼9 endstream endobj 18 0 obj << /Length 1516 /Filter /FlateDecode >> stream xڽ]o6{ՌH}ۂIP֡cӱY$jHYv%يHx_|xvrYEbXOYILd|8 3*/u;䂇eͱea8)yBIL%ȳR·lktJjrewV~ʁ}cOH po7wUFo0' X[rkb6?EAUh$/4G:Ljy%[󦩚VYƭZ}L$K.X#KnK?[ʻeeݍVn G'ط:aWxLē.d dp#Ӷl #fbt߾]!#2؎3qV3'hi n F^K [Zwy"7RӁa 6揗@cnYkz#M0*u㩟n,{ȋuK?]6S)t׵ZdO H>c5;N9G z ր98n{P> stream xWMo6W9I&AIEd)P^fDGÐMRwdQnCIp iq4{ǼID"b9anDOωFE2`]Qޅl-wBч|FsE6{jIUa[`gd`s\BS9wI>r'񯨍qfJYgOe]qaɌQܞrfbl8~oO!eRlt{(#qbcWo;1zs/~(֥͉=uz;Ψ 2v" ddsCS ?w#x i2 Y&284l]* -U$|G"Gk]裏 ㍮JJX5Rؾ7Oi6eD9SY\^h6L60s"u݋bKͰHXw0NF6GQ0a+F肠$hBNO_,01Zl+f} E.cd ? |΄6KDӁU8.S4G[iw$%t|͊TB/((8y,kVx tS Җ^\p .H:8D Qa4wnM HQS#(qh6 ~z FesC$AVu8ؔexDc m_PZs|VC$u-wBĩoT0+eF[]iվ+7Hy;h40ԃ}hT&n5ai6a1\d孙s퓧ZU6)Jc=?h_`oҵV8W桶otaf%R'i}9&ċvNG#%kK^18(@ =zFC)p0 QL+wESi{UXuޭUm3]*,ڼ:~O__tOdDZSUcEƴSV'# #j:p>;QzgUǂk3?"g  S1i6_gקb2Dw_&KJ'O2d!w?loU] b胬*{/DA?fɊL sUly> stream xڽWˎ6WDjJ|J2 2A[Lb, E[Ddѐ4U˗fy|@UĄط5hd};9yw#;iKnd}^.)@)Hv#ޔΟIL׻B\(lOxᩡ4cSǢ6eS0s|}/tә&a ̒,ytʹ0@i>Dnw(2up#}e:~[5jj> stream xYm~b iS:mqm"("mVcK$ߞ;|-9tw.)/Ee833^;VU IPrLayɔ`nt7RMǍ|KNwoajBEV¾r/o]Y1`8[z{'xܔٖm~n;nA'}\Z>JP0Prʉs;J_%'q2޻;;s1*߸}޵\ou|H ] -λҢ@*r !yY鮬uՖKӘeB#~˯5焰4GJřorQ0I6fSJ77Y΄Q]Q{tACO,[;]V=p^0[+. 488eIs>;x)_iQ'cM(Ze.vnf6{nv3}z foGˮ`<ώ7ƴ]S.:lٶӕvr{(WG'}¦r]j&Ddn *BAD@ŷF/N> 矀p|6CE&w6T!71ш @R]3%U3!yV]^ N ̃RMږi@Sr-a %(/2=edse8y埞@+zmp^C 0Y_K@JDzHS0-ыBXJ32X , 1>N%A_.tX餲|ZLBa{E_Elg־̾n=. 3),B-jmtUJ!J"GY%A]Jzg%iM2[4x!+8Y煴E׫Ӣ^C yQ8 5ŭгRu",fc7*eFɀŊ_rUS诃l@ޅ @lͩ-$l Ahȶ}"3`4dX]3Wc2W=Ͷ-_=R C0^f\_+_YpȂi?XwlE)9HIzFH+,H!FT$h#^OH"MG9E:J.CK1ΦI)b^scjTgBe #H%>)SM6Hr r$i Wճ2<_,ݯCnݻ(完Tn־<>>N^zkol)+VZ zmޯnAa}b[.,~K\%|%p|.֏v21m6#yźn x4f!QRV{f>wC !Ckz}1gnv\o3+o;ż|`sʝkw 5k, ~Y2ncb< _>7 endstream endobj 30 0 obj << /Length 1582 /Filter /FlateDecode >> stream xڽXK6WЃ\z4m lAZ$iAK\, @|3${Mv25΋ ͓d_%qxn[f/g^'Pޭ;S~`vKpӖM½ pr3i㜥iľ ϗZ&YHszLa(eYr < VNGUUڈcnzEOv$3+DMe'` |&XdD Ed},by9l2Gj< AUCW+9$X+NXnH&_?J)?ZT{Y~մRa ܊.>#ɣqt@ԃ>;z_IlԨYn]iY dd+GO7cn{oa:Z/XqwcM;˒^*,0vO+L& `uKS3؄'j4N]Uҝjz OS{عbO>gsӔ~M#ԻA ֔cgJRDcQ4't75DQyMbz9AͲMI[j ˂qK(Ѣ꽰"VJT6PL9.5 ƨ]@Ev>?co̒pLg< 81(9N _ }"p |)p +b})LB%~t{-wC%|e ZC$? W?d.$+LrBvN]mt,!-<4?ÁP حJiRw6 6G@h7Z:Kc'֔0Z88`4d0>1ó + NgcŖ)d#uMv5,2|7]~ob# t~@8?F0,ɳ șy1YW8&\:8.-YA[){*}Ї@@2-f39pﺧr!pPEe]3@c |NH\Yr@z%EWI)Qѐ!؞Z3ܺmtc̶ p#7(5ٍ?GsAXAi+ǸyQl9&|8isӿȖDB+=~ ʡz V/X_50 0ˆ[BC`gXUi'e8h/TaaFYAZX(z5HajLd,0qDٞ'`YmKjUm;2[ڱnaCkQoKx1-` FVݟ]u y-;K;l~n㦗.pnvOdp[K&eQ8,LB(&sz'[qJ=5VrVT^]c>}+Y _kyThMޡd^;s59 {ٚ\zzasVv*q\;ElYNmSU$kT&KVjj_$P_/K#c`sCbEYO^< endstream endobj 34 0 obj << /Length 1345 /Filter /FlateDecode >> stream xڭW]6}ϯ[4&vMl鮷iّAŒD6n+Ƒi^l!=:7h0_Hc 0r ̳{GÏ^\[= p䇞S-Wʥ=.ç/XP%/Hy )X)k}4z:Tk^|?`٧: gL͒3UIH"p 8Tv+/hZO?q#:~YKMOC: р8ZE&~QhU*뒭8>de)7rI$q;`%OUW 4qta{x|8 ΂=/qLK |b ގ~[s-j'x;-*nVsT[8NE dw~ƩTGpX r!P(neԲ9dxoÐxO؂?SݩN@e[qM V*/ nK VѶE^ya*ׁjE=܄/6,䫵jWZ (-8+0Ô#whcAf`TLZw%&*Oܐ<Ku*7_! %WMbmW_oIQ=wө{uIiG"EQ.=R1m#Nȏ&КA;h1f%Jt٫ ;)4*lbm؂{9d`MWUAVYbw}[O5\cڋ1شaaͫ&?{kFppӦ~"ӥ<'uifr%p{vR7t՗paF߸T.m@˂*~b72 ЪqL䂕&gf7rh)o6Xj,uOrz1\mb,@IOoC~]mحj6{s{p]ŧVpcx=x/71u؆jLzWg@FDId46W! Ǜ+ q)ƨ59{wwc#=N\B$&:!hS#i[6FQo_ntrUmcd )w]$ȋ҅uH{Ic6KTJ1Dŋۂ dٴ} AĀ|[4=1?inkZ_.(1H%{B>a,D x|U+I{04K}T.T+l;]1lQyw$?HR_ K%)] 7}x6?z]6? endstream endobj 37 0 obj << /Length 1747 /Filter /FlateDecode >> stream xڵ]o6&#R> ]׮ahh,4@<ʖbqDxw<OS:HxvQ4`DŽ처<8WoO7/=]\ O/_gߞ׀y$H f>(Or3xZU“Ҹne,XW5K+VJ5Z G3,@0%wS ;ަӭq*$BQ*U%*kG]R({Ws(ݫ>XS]P!exЮEk-G&hqZQfhT0"|/ߜrٴao l!q.dGhX  F.ʼ+E+wAU7H[/8t Zj&'IQ}6+NZXP .}\M1ͼlmFl = BS)c4pAw9(JZ^]Y niblB`6D2j3Aj6&Ø6b%5w7'~FfAHu[\ڵr|0qNڄǰ7hX(@E_8:<Ƣ.dvO$ ؞MhlBƼpp\n,8=Tk{LhP$Ja/l`Bo)aAz Ǫ^ب1L /\{wi;f9v#B~U,M1^ܯ,a!luwJ4"B8gĎû S²]?:͘WoeeG5sП:XD-@G>.71S!1[ڳIw6 4/6 "OK9qȐqE;#ΦaSPݕ 8`x]a\lhz:*'+eFcdli f7`1~=3!6Z-L NgdVش EU;U7Rl)H3y3/ܛ`jcF5%+4ܮ^>:䩧ժBx"qfMC8b!<<<2w;C0ѣ}Js[aCp:`|&́OP(h|(>,Tn 6DnݪD,>vIa`nK$IjklWW\e;;\Vkq!OH=%$ q2 ?uR'3ek(E}vvrnGL%]fo4PBC)ќ(~/ = V;MHw=ϻFVz=a@;Ef [FppLJ_v3gm]b,eB|T4Fѭn7ٻ*FscxH@I~kI$ƒO)3v`=/k}/Fʞ> }D,Be僿ەW endstream endobj 40 0 obj << /Length 1774 /Filter /FlateDecode >> stream xڭXݏ ߿"o`w4p--PCnG>K޹Ǘ)'N}9(?7?FJQ<7ReJԦ zxs$I?oݽʓmj/dsQ*IyϏу>WljQ`DQіY0>iGd0CG'm2&3QgבS"˕J c=ҭn~e~n>3q7'8pinDg>:;~|k;byh|*CS1T Z =Xċ]D!JGw.y~j9A+/ĽJ; 21c^RCS D³@!] ö[zD[7 {">%yr3UŔz;_Į#٬΄{ a/kj2cX*Ru+f-fAA֤U,_(4p0dl$۠u-y=mukķNLSnRww;YmYI dXhw\ P3su;mȣC(oXN{w먚 PsFtrt;`/iXƟp? Ey bP E18҇9|1ד',4:Q۞E4\ `8?SN_I4EU^%e[鹆a Fwܧe>E~bǫ*ci24V,GB^D&`I{2:wfhAk=7+QY$[v >&QH:@I]27T& o1Z`ߖ*)G˜aT:)i.v b2fE4؉J|FhϾ?h]QSָñLT?r|F\ןNkhGx)}y:챞_ĩ?!ժ"1Nį/DUcEa,4 0%ʺNhKB]^wX7 p#Ӝz6Ćl0ڜ"ߊ᰿V̋.g1f0|3=3M|BF]wJ܌~=.9%U$Kw>"X-u\,YW R'7-G0=Mgst& D4=Cg޻7',Cs \~m|G岐msPwۻP4vÇ#(O,nZS$ ?0vlA^~NY2<\Z 4؅,&qw7Bz/ ]?AAʅfd -37R/ xbYKStqJi^cX-.,,5AkY^o悖4{Ee]i{Qi.pE 6Lȥ:pS8>BF{> c4Q_kowP('6KG ǵ"pYQ^(p:8ZqsDalg1y>#ncwZ$s*9[ެONv4s;] y\~<8]A>2K[z訖WK)hAh\0@0xl?0<,( endstream endobj 43 0 obj << /Length 1842 /Filter /FlateDecode >> stream xڍX[6~_uЉ8h[E- }бX8Xd_R8 !DQG*?߽\V4.[4*VŮmڷG8[o$I_:Mz6:")[VcKZu]&Q|n_ +Vu\Y%MZEEJ xTQoh?cNncote8Zß["l|y#a499UV0"֎'tB|Id Zd 7|I;eVfkܰ ({zYhX`٣tq,A@i;8 $-E~]d4y]gwV 8|A‹`P7y~y@F@݊> exAKzDd1ìNYU.}oM =!E9VV% L}ew)BjQ{V]A8e~F_U+nA (>wˏOLx[YL%[Ŧ]L"\)rBBt{E-"%(սQ:.:..t⁜; ɧ&"d ZA,ʲ"'uK_1SHn)j"rp¨}<2s`/r}ͨYxrCG][73sU鶊KpK ޶l\iA.j`x~X5Ue$i>FM8 ucޞʅ!4AV\~%tځu} U_BHp0>_€y7'_F{.s;B\Ԝ+%H_Q״GB d)*^ yޤA&9= AK*w<*2?,Jq^sE~=twƛWO7pW("Hj/aY*b[j긫 D+ Q$|hmӋ 'fc$)^:-ob~^Rnτ鯞%|%\ʜ-i{B endstream endobj 52 0 obj << /Length1 1438 /Length2 6052 /Length3 0 /Length 7022 /Filter /FlateDecode >> stream xڍwT}?RPIf*p)c m#TRDBR@ABBExz?s?9{v|=q޼kįh!X~H A aHi Ǻ8Mah e4 T X.z  bR`q)(IDKU p{P aH7 %% *p(ԅ``nP+ ðH-Ţ=== n$Qu00xq&;1 FH' p( <@@|uPCvpp`HG @H7 G80 {A_8B\1H|<w~)!xah8 ]/0 ^*^C`1Thނ@z"|{ P& o# I Ka@I𢀱7 P1(|0~O?% C@;#wv[ ZA=YfDz׈U2_F%%Ї_X/$ A"@q?FK{dD8 %.Po$gox,7-A ( ނ_!?_d_=pue!npW?xB?C_~o.X~IxE@"p f:&p#`wŃˆ= rgk2 jCE_줐FCxJ%Q0_ X|D.-&tǀ7ցM\(Q Ʒ&V]0 @B[+=WdHͅ ɰݪ6 FYS&jmzJ9sv|kkE&/'ܚl$xb&U&EN.omIWuDO.5qʒ,zI/ Mv}+ ~r ZH˸-zHZb x#K*Ǣ"rt鵟4>v /yR7nr';&9DXQ3tJiH0v^ig:\\'VmΑS5-{&Ȟ.|JWe *}φC}q3! 4csjarku{/=imUrBDjf|3 oBӫqn^V:nB2\ׅԏR@gm1 ʦJ J^ҿA . 97=S)ָiz0h_>@^iq!夨ԝcPXޙ i>4.cr;pqӐ6WGm`i觯ye>:\~lɥourS˵y =3al-6yD+Kk~ya)Aͷݱ ~4#I<Fc7hd0B-ATWbMC|cJ+)!W@C~OP7?8ыED^T)3صE^Ph'C] KT*u7)NNzw*ӆr?4F68.%H7bTdbn`>>i܋!yEϑy+ӎ&wE+]{mݹ+ۅbYq_lT(}wfY7q4yU59wgJ&( ҇u.5 (ӟ!GqGEC 1hȯi-6!G.<8Ǹ&sU]y3ZrT#y`=X  :˩TT4n׉k?|oZ s=6`CygvLzzbBg"!CV Uf\S^9W2S{B]$t楍a5\GQkGAmB"b^ yހjOG5v.?Uy#;Kʯ6zFd]ǃ!ߜcH툔gAtH I;k(KKC/ǮWU .$au]/2V# r 47GXmxTa@EU^TzQyۦY[!P'kCת wʣAD^D4|&ȳhɖO9J"UgD _^ĢI(7F9 S F}jTN} Pg?Yal ɾ͉U"ߕO]Z^6.f+wU)PkCv;0rq 3nɽYzҷHGJZQ-Ջ$˭|5+ ԾM]q`vYJ؀3"Nc1fˏ;JS2+w9PDe=랝>x@xNq+{!~O*+>pXҕtR'̭ç|RaSeidxrSr>OPӈq#1W LR7\gr8\n*KH3k]/>nTd6%07C(7B3G}sXR3iywd+pT_-FV>$ \'Pۊ\zjN3F~e9]ћO'0Gb3JxyE{U&HQ;.Oة't?PSSYOr~-˲[bUdq=~ Eb_)~'t*Fc(B^ےhMpeWU*5Rܬr5{?< s3ZQ8br'O;1 t6AԜ%`J/R]E9Y]ڇId4ppmYVgԎm-(zqո|FM#{<3:ְ**Pje*yU-V[ Y>#[x{F??($o'8sr"3O>ʣ }CPB:5fAX15(`YfPr))*c%<|]{!f͵ިuT46pVhmtUb P#"BsgML㦴7RGJ{n2pd69)nJu T 1^HW+^$QM>;]̚};X]/g$*=ulӭqVͅ.M'UޠB+48j7G'_3fo_- #N? LO>8n21 tY ÿG0xb~wLWy>[1'f:1]dzHV fjE|' nwL=$rƢ>rEW@,|UeVW3t ١n qx_i'煐w9I;(|+:TԹp}ԄY:Le|r#6dx_H? 6Zz={uF'<1v+h;DM7ȵa-Fƴٓ> stream xڍt46D$:QFE7z% F 3D}BFMAQQN$j޾Iy9oZ}e뾯{s (9!`$#Tt@€)' I9͠(4 a OHIȀ$eaa(@ st-$&TAz`.1/G^$--+Pr` Bq':B1#+!#$#qG "Q. AP7 IЃC3$L\a߸1AA9Bh\ pƚ:Y?6Ht&!~C 8P@#OGC!08d@pC;` IQg\N*Hww(&y?U +C }60ON^BTS "7’Ң: Loeq <34 !P;Rp9b A8{k> X  Xi+f/2DąOIALMjdD8#pY^'!qZ<#?fߤ{<qI  ]$n8j=ʺP'[51x(!\*# B `G pjD~>6ae =܃ pD:<q BAHqānB  "\8#Q?;*^_N>B:c=P8#Rp{5B}HGpJ7}bW `ڕd޲s}Ӌj<{gkW OOԓ~_SzL$`xhzg5\CVu7mة/edA8Ӈ6/9s2Gى0ķ)})(]j%ljX͋<:ye"nd`g&أ P^MѢ (,8[+WuU2Q,ܻ{=h);j)ŮOSVoK)e^}<ӰoiRz0LnRpR9Q iagubSK6&m5W)t槄XLϥFs&uIdSBH\nj|aa+)nMJP лpt{;UT>#'']鯜xnC hpVh{VPȏU'qA|{;Gz˗~nGyf% ٖczVB;"ZVmi"͎K|;}6 QF~R#-$6Lܫ)M/48jrrLi ;Z:Dw`'>ߍ9.Br+Oￕd ^uߪ>Ϙtݞ+B\UuB'®d-]w6u])_91Lߡ$DjmMJ U$TF[) g=i3bSW,/fnwYzM)eXF9]#¯$蟌P=;E<4֦OޥVRVzG7s-F;ED_xi$yFahOga;#1v2nT~/}W"^Qo ok&/[8К֑Sgm.G}?ND&k>8lTj{'G E|YW\EkC˲ N\>kmJkN\^K&H вvS 7w - Hsn܂&Jd'{.`4LjBdzdg}Ah-G([Q?[cmVg3.H(أbf-Rq3xse3Ǘ;` 9[/(ikh Ճ 2W\=κ,]2r=#Rh$c*5&ɋ|Fc;Eg: QF9?i=A,Kqe|!3nCQU33񜆞k䔥Y0)Qwl+珵&9'ޛ>]J2'KfjV#)#l>A At f5/ D\ӣt5&+%y+2L:Y wƢb razcu%94u`\IJ.7?#~QZ$`9m/k=軼#g\+U_*'z'q5 j 4iB0ĠCc T{FsQ|R?lڅ HɫyCOZ,x\ #)ԃ2һ2vW̐_*e\P'W+^Mdzn7]^uykUx5&~ZKp׋osqxW^v?ؿrY_6K! h9۷9tp9wO5۫1~}/=w3#R Qq j,UJT@ǭ⭃B){zQñگd 'CK;\}a񜪫Ǽ6 {?Cr'670qz]}X~1:m2b>ukTAi^Ն'4|jAe^0Z! UVμFB^Vٮ̫ _- oMZs[Rvd-Z2bEҊOi%Uzહm{͈oi7uOAMskN)tsŒ~qSܕ.6wwVsSt ~dl**tĂVo׷Xd.hgN6e\:r.SPOZ=lMyWٮBٿ+ybKvƢZ,!ylR #)SQ.>lWH%I,Rj{|YÆ}ؚқ(w(ԪW>ۭB lƼuQKc #o] Փn a5␾+A}W bּo^jll X}c=f)S!VG%U7 O#&r؂flr3t`F -j94^Ptc4KH;F',+#hQ)~#C.bt)Ofim"\g~gyݿQ5-m}4ZPC*d#!87x1mQUPc{2KZnߨ}߄wLz^zT wvu,Ǟ7K^ (ɢa|J09XR1kd3gv^2!-Jѝ O| fv~rז7?LBb4RJjļL>($6>X&;b$R8Asձ@f$Dݛ!DP kֆ:XK/ ‮zH,8,hc#CgxI32[ª;U5ܢr/iP4|SH'Gr=-rݒ[L{}<OnV]tS4J lHܼ FIQf0,cEv!%Jl~~ 2߇| S8鞏Y9Ht.%}ӋEv%+κ+ìgAU5Uqd!cn=lb5.;{] NXЪιVzw),Bx\1sƧMJ3I *CSc"‘<;D(ꗷnSK̥uܚr/9{C]Orʞmڒ#ϬL_8lxutd?\xUJ|Uw\QލW~I!Zb,gHӺ: *&Jdg%>1%aj՛`]} |plxv`;DH@&JPi}@5,qav;PAV#V]VnÍ)V! flh3׵D [ϛ3đ[eqrSbl 4w4{~6*l(V.Ȯ[4˽w7% }'\ Vvcr֘p@%tOmWFӯ̒,ΈZ<-0hCvq~nY>|.ݷ).4+0"=*\]t& kjLɥNҷ5hliDM'?~Zg8tOGv=xpjZq[BsXfVAm4Mv4\V1T@]2~$а?2 `xת3RiLS qox٬$?mL&z!aSxҩVZZI#@OnJ+Ɓsn-f~m@|ʈdǏ3HWZOʙ6Y0]~09ȷ9_NW?l,.y?2ښek̒Cy1OmѫU^IzlKH.:SY%'MBѡAn'EYLPm/=JXuVc7j["Mte,K( y5G+VK:1u'/j; n/deI>WwӵxE].;dZz hR7vDm u&\<@܏b,SӨUl:t1ͱ_p߷|}O»d-g-.@S7dҝb:=\}~M\%Gi\z1N'uVZ{!D/LBR`11gjtA7y˱~w6xGbJFw:Dhi~-MdbRNVij׈4S&GcjĽ{ `Plu9BZ-"QX )o7qÇ4٩ Yr$Hu^e6ڛ\ ,77 Dbj#_@1%YoAD} Hv53}xUzg#<)z0mvϤ/Nɛpp0Fm(o^K]lBQdl}Mwz$LƴcڧY -KU_x( endstream endobj 56 0 obj << /Length1 1469 /Length2 6367 /Length3 0 /Length 7360 /Filter /FlateDecode >> stream xڍx4ڡJbY^E DޣVڴ[](jE[mi<=9'^纓v]~;-T@@%-30 @04ꎂ!Cj۠1ZHE%b @. o h  P!%$~\0 ev`*Bl$E+#* zyy ظ|/EA=v_6.п  a?= (0„x Lu&@ǁ+W"w tqA{ Q@{6_6poib~nPQ`qQ(F4cVF)!]\4WaP} B-v`y07|0*tP4@$!**@Po#WCWoo5C+` C1~(O( ߆K`0Al0?1j3w7ϓ%avH#h?FEE7_P/! `Q ysյʨG$@{~w$Cw"bjΟjܐt4r ЗP&;$ÄXF&q## \ b=B;/wv%. rtztB~>3uCF߱/;bilZg :-}AI{KH -URfȅREZ"+mK*#o3EIBJ!D:MH9S/@-ю|l5vXÙ5B^\j&^}OdY&RS,~`ݫGqI`A4gp&{k4%;:6Ӻ=>aU)ݖ7='H#FDfu<ʢ:yd5wB~L~A>n{$kY!żV-3 3䤔G/EGʄȤ'On;H $r*(H`QeLZ8ִxh6r"6Z(Țg$6s,G&-uѾۓ' +mu KPoBMuD( w,MjE EP%̎*h~ܴl%zZTK#xOoG\]|5ffVN=-=jM>Ƒ gVI0H[I%SH8ҕ%d ~k?q7Wk>.Yb=zn_mYEVQ34ϢNr川)~XgLG?ezsݫDQ=Y/FJ9'LxfP|CexuR0cd}Ʋg[A\O}*Tjn;YͲU_Ҳioz+-w$%%tMgkQPҵ®Z̦,SRu\ yKd 906UC=&>3(<xN(lԢɮS(r[zU3 ϤYVG2-}Wp1Oye]0*`S,EX;YD(-C}[G42U;$6=NV*qd}ggg"'(;;*PLٛ j`1%hϩt泺Qk=b慼%I<A'F}C#ZYGG oEdfm ݙPyfg𴄭fT+Gxk`Ɔw6ᇾ`3uNBݴk+,hB,QE"Or&󬄺S@1!t' 0+ 6㮈͆~$Xǎ/OXԡ[úm*-wfOmхLGrѤ:Q=exG% V8,z^'_^v*7O\`p&nTKq?4 Hq=NJ[V*ɱCWJXvDFJuwٶ[%vW[bY )> r>v k"MRWq EMmϚ3?/C|K rnRZk~/_mTLf'RgJKfYۤաʂb@}G^5C +vrvqp0̛ aZmT }(S`G/<ƹVfG,*5|>aU .= 9/ȷl*$Mߩj5Z^  հ7^`}(MՏRx$T P}7.iwZ<ܿ5 a~/ Cצ:s-g QoiZR[_w]uj - CQZEuyB ]X^Kwb 0ָP6^c9XѾg;%v?| Bz]3iFiΒ^eߐ0Ji5؇lKόYd9̐pURt1:Ըv*lŇ7vk {W=~_XG(I<8䔞4\ÃWb!<"2"?#,*e~u`ylÚ_[XsxBJk.؊4T`.&*ogX8:+;pqK;+_5\_]3 㣒E|Lp^pf(2,<*k9WU8U#@4/יݢm*L>}uGz&;s/"^1c{oC]]kTx?׭fz؍#D8a<5vd;%yV5z%9lxA'zk5xBL5z8}Fo!.&g ;R)z5H~+nQz"{"ΪQW{x_DbtC.e~fc~%>1l}H!dupU{-T%(B4*y881cS*Уحd|v"\F$CRPuƚLDDa^8O1kw+@zˉ2WS1LʼnGwު>3/=Խ"iuhλ/U~ЇM6ӼRJe'}ڞ3Hgp /Z_K~qI/ SWC%#噬)4aq85Oic%ݫ<4I7}r=HlRJ;J %}Qp- ꖑ4ZWdAME?tqxxY HXwau,},Qm8^)K_>ɲ6LTA`7:m$q~n4f\ Y]Ϣ`2^qC^:9;Y P@[ ֐+ᚤ˟}ʻpe^Llta?'Nn7hiXS \ -wȄykaFѕ=͚GK~e,zL@jͻ~GzɱڱzjAG!NW2wއ A-*Iffyz>K)=[ϼ9I[ @; ňN;TPzʍG5s6Ew,WלF"-6pOKBXMz/C]$jTGDn^FO2T>]鲶kGDVuLuA(@U\i0;zl)g|׷c^|>z4K0I&麙-8q]mЯ+lPl*)Jttr>SwtWUdC{#./ U5t,ZpՇN }WoܒIOH {}}Q-&ϼi!u3\9Vt)e\aq@E}sad",Yf4dW1ZhY[%@+Nt?{]!骿4˅!B14 CWJAxl*Iكcwi=#'ןUXEjA;x4fA3US2!PWü,+YFEuVGD(N7F*y)Jf7Bf0ܗoX$raG.2ʖ_CZ GRXaˉ] 4Qtc9nٯ=jrB] @'-h&3N ~puS. `&;yP+(2%MxIi%̤[ѿ[SCF)kX 崹`eܔhҀ3}wl<!AݼrC"QpsV]I-uItB"8dIPŢ}lW璢NΰGԹdT=Fe/絗5vN˨yR!HY{tҧМivTbu'[xYv~.yHZOT%vtO̰#/~0{!])?fd)扩!N9Il>gy퐢;޿{.hS"GH>юּ>@Z[BLWkB%}%r ko08nXƔڞt}zOPzj,}SYk1[EG|1VzGti'^XCVT節 0H8A YfU_ӹ:g[SeDi?kYQaՌfcvmz3ڏ{AjQ5(|i ͭȅceD梓wcN9N prX|띗zxd4ەȚVWd2(EcU(zr:{.)WVygU~f-/&(sMkY+WQJs_n- oLSJEgI-ޙ^w2>ViY͹A";$R!d8êaDVsK0Ў5-kx{NQMQӗJ5ti_Gp9{YڗgXǂU|d"S59]$xÓÖկ#ŕ;.rnXL$ϲBγ"v %1>ڒT#h+zդ!~'>bpo q;=baof]rz S. }5v<}z{6߯Y'Vg ~yO}(~s/EɤsX+9'Ru>oًvu/w"nǓrz* F\n3r]V_Ul T&\-֢O9Ե}|c~HKIE.@PNaL%>&XpBFI}?d}4ѢT8jM +YI0yt| @ZΜ Ufk&(dnjzsǧ V_SI]dXڠ?)r_7UtřU A8n1v{e[N|r]Aѓ«\jғ||p4>x,vlO;ݙW/e|& }f#@ŠY!@,t tkZz4bY01k"@i4G'vrXv^P8paSLQ=Ӣ ,;1g^^=;pÕZ!ISƕ2];ՙ%sU -u7UF~+_-H# p?Ħ'9* &8Vr |Cڽ͏ 4lk9LK$(` 'Q\F> stream xڬS%+UɕJ۶m۶m۶mvf}ۻ~s{g`Ĉ1X$ |6F6֎4ti3+}')kIjy#'_#3 @ hd``гÐllLLdJ*䔔Te'?=3L~8YZY;NT028,2jb"2i%%@I if`d`D0X0645X|=4#W#\T[#{+338̬ , !nl/B6#88:؛:V7OGS=j;ulF8ҿ|az̬F79Z_4̬MD/__}lm-mҘoMǿM̬ahY1kc=ݿNld3IX[ ahmߩL'-OB ;YZJY]?0/ @cg ׳2t?$gѿI9_Ahm4s6s525s40YԿJֆFfF0ttS453gvY'": Bt5pTtt%ec۸<^FjFVL6zzCYJ{::6濠tL__Z dm`c(8Y]emdoW fmƀ3<5#ͱ#gxRPt8ȶA0߷ڦ'5tB&qmPhݒ':Nj/yW+?v |څJ͢: ޤvt=3/s/*-AJ} Z'R#Jmů'ᡞ;ClhN= sDG7]/7gV=NJPHQG!&0PfsL99A2t<_e&F)#t#4 3nK=֎>8U&T 7Q4kkӁu@r8~vBQK(lu(}t_2?z'FlO"uM;=ٱ䋴U/8T2Fv#C,*-!T-$Ύf?'?E~rx(Julw$2QvgLwJkK(CТnĒEٵ+-2v$S?t*nJzm a8\5M"?Jz2 -#b$xN :(yjor0-BEw qo"/k[6 g L|Gk%qWw lGøA)ăzw9O"!,.2[T!MKJum?`Nr7QV3HÞ뷺?;R!p7'v1#jn; -g05>_FQ*4ͦ{g嘔-]!)́P!&]dѣ2{ ?v .;:R:O Hs#l_,I3;Δ^ (܂̭i.9L Z*e&87~0b6] 6;>'PnN-Uioo\t/"J2rt/]FWQ>`֓ňSBkxFn^h@>O"ILZ?ȺzM6 V Y^5ey.4}}@AIR{Nv4_Yrlaxxd(рPi'ϻ*c0*ܥ?h BԫY-[(2~iQ<+3HNS@q܂bQ" kPc'PϮ@%F"r/ų[|7.j5E}[7aӧ#2CZYơCtU`Ậ"4 UAAe9l]̷#\bSRfzXl! xky=C}"5B:86 'RAXУ+w^ı5~o JYJm-J(׃ ĩ*:әչcF0(RZwk0WQ& ht|z*ULo驌d~JIrW;8 `Wy 31ܠ3V(²³̚!?Ƈ^y""fR#ڡgfl6|%a3eB V~<֋yr Nh:y|'&.תq5!.o<errO󇳺wy+279~s5yxϙ;>OvjtPքKs)T0A$N>j̏y7ڇoMa'eҮs5j^d!UMTWd6S@" Γhc7 傡$] 0[+9b /Su)ϟ`3˭^ 0mEVK%9{*! AK]UT\ȓSDᕞaZ̉NDV۳2;ÌW/V]ENC,$bw{{0ʩE06_UF,A52ϕ ܹMI8;|FCXI5n0m27ws7JxM˫Uj*Ѝr(f"䗤ly0< ޔ ~Hg#?E;+I8ŞKIK pCRW?Dislq=$y<α9]K+gE,X ܴh,Yڋ[LiҚ)E2qJw;T%9ݨ2WU+rM%Ʒն }o&\"z ?W\|I82肾 8f)nK轆3)OJ(|;w!zebm>`h|e jێ"-i46:Qu8zU :&8}"ǎ@QZ͛_d 'T)jL WB[İ?-夈J -٥F.aLM-X'X:$0ܴQs摖4OeHv#5+!i0:a2t{yl>SDۆ}Zrdh!A[X P!$)Wje*3di;84Tdꭁ>#0/ !+rR2*=&DV7f{?֯)NT[ΈpG¹$Rx]J'-6<*Ulv]>E?O$ ;ׅ4n/2IA[`d0ş-/fX"b;VCGvr&8)ǻR*b!T7?tlM9ɃmQ%'[muNMSM&_78(k";Ϩ%xDTx91ҟ%j|U gƏ_Р^x>7GI#KKbU'5Ll:VndxIw" ̖4 իJB&PŎ#qꈫ&rTlzaŹJЂgY v&y@;|*PRiL~sIEx r:;+ stEןTU׹8lݩ(}VKucd4c나%!oijeYzc*O@ sCR/H+PK~"A0e. ZB6ECٳjJ *e"HDP|uU%>a:J'Mhʇv3΢ D?$IU.HB)%Sހ,gA'6O3wilHq/ >r^Cse;V˝tƤ?W zv%;)SL4.ޡv f0Gk^ٓHL }^81W<njT.jAj%+S2Qmܔuбs DJeI?]c ]ǯBmfn:fH|=%Eu4$Ì`Q2ᐞ:aцzjzAGJJGP wGhk M=CϱZÂy0+)[SH'-,?_>J QE E!VqA+YBo d/} W'JǷd?܈UC\Bqw2 (dv\o}.蓜 $o 6-9|[-ܽ"VTFJ{2(l vgT*sN_R2hUM $ %*HThVOՊZMfXS]'Bh4MNFށ m­/LeZ CXD 2Sx?p|t0R]qL*嘀14~5X:-5US]m*腡zP"'ݹ!95i5Ul F\6xSj,1 UκGcu~7@[ijH7y/G?yK ݘ mC}{k /](#`40Df_z.2ta>!6B-&M5j~sXG {ϝ-5yIr 6ix%At0qAW Դ0S='AT;eFq I&3_?jByPl-@Sk NNi l炇MgI%}׳ޯo_O1j54 t)vٕW$]T8b SGM@w`QU";#ցG}C 0~SMZ8wed0R7Q"1dzƕSut?ys2!껃#A**m7pе`q2n0}< ͹fbMN@hd!b(@ pGTh[E6хkgsa0N~!( [[@}~ i[}GV">11pA ocLq?FǬx֡:QE>{ H᧝D UӘWI|]^r1facy:MDP8+6|[raq𕊣$ZO'UD-bm]j͡I=9k%EK_$ uR?Ȗ+flF|D?z2 ^qKɨc +\8E'լv`8 PG ,"N 2ڬ'fqc\yr;RaO|HhkU2y dq\=S; ev OPTQ IœVoz$E6Tgq8ԕzbK0QkY3C0jя`.9A\vdz!Du|Hu!@,`s&Mrgv.A[Tn-4@`(UWN畊>\'oVWb "!}hP Cm4"<4LklJ4%EU[[?+lɾoB`t 3墾|F: .T.@ * Z곏M e=|b3A=J"$ 8Տ-փRec&.a}^Leo-Ty Q_Yet\]d9wp3ȮTt`0vHp0XOk$cUC,aN 4.RC ^3 XQ#׿`W Nl vB ,W DDnkmI>o"}Fǫ\HKD_yEߝ 6 (;9IO,K"5وf~Hnt~|n\IVs%Yq`wߴkN gxmE ë<&W/QhGD==z%gYc#nKTeDcd>Pr.]3Ϫ(A8,u2;FWgn+9!0a+U]ۥwo@Vn2E VUn!܌(430-tί` )sLVʧ1Y 8A)q%kE* DGuM:N_VTR8zL`vDtF[Eͱ*`3+=\5tqw+q^u(%۠M.]~L8҄-(-Ͽ[wt}#S.nTU"[A@Dnm&v&|j_.O^-[ =.a*AA M:5x ŧܵi5Vj731%M8;ObC?%T V@\,.?DFGϯ=SE[ʿ eZcv)D S2GQA绝,kzQ`f5'Cg੎3Ѝ/ jA\`ߐם 1_oO~'F)˱ˑSv@4ǮX#"&O 7ꯧVj'Q2qs'_23ް(#˺O 3w_mM,$!9(%UТ=;0-$I^5'DO?}gePIֶJtM MέR v؇SvH.-}œA+E,Z=/U/fO5U̅^u2$Tꊦ&(yxTԔ".ed jnrW@|ѨN֧l[w^TEla% sʕ8_m@7HKtTuJsٹ̱tD ƻb 9v¶ԝB $Yڬ9)&L^;t隔_x_fְ{E ! JqX8]0&[)cT+.P f^@pv}uۜ=3m$Q6LŸ"!|z? GP( JJiMa?wt؈ܧX%pYt5L/D+7i>Owv7Q .1>v_% P&]9#QmCkKbW96ɔhߔ )W"S[,{!}d_\\)<9ty!i'%ʔ'}6PtdU0PJdhA"*ElMHC\*gRM AUֹ5s-R]tIcnځYl#_g|s.`^>(؍r*XD\ L4ukhDЦ…Ī㡄jY|_%N5Mn5]N-[:R_U@`B4=ykտA)F:\taz|wIND0?I@Oa/BMC($`ytG~JܷљTO9dfQ˯@/$E3Fm0jJFZBLd.9`Og빹gQ o$ QTS̪'܆b{{远vRmn~̒\=hNe-EuS79K)bvкR .}̈kjUwS_uO=!5&0th-J68h:U)t>. s CDLKEHMM,B `YT-P夎sKz2!Ak߻% tѩA?acxl%IYMT=BL|G2Vic}NǺY>ՠXT~f/>.?!adg2fsIXqk:tv]2B mU5rzͫg/DOa7EU'dѹ2ݔd&ʫӂ=/| A B-oT0HBZIr0 šj&<_#z V BTP>H}jkG c rܴ؅fSдZg]Xr8zS$ la1GW, Evh}ӁaE{ Fa{fk⛰#|;tX(4٥LP.Eaj?-4<ڗ4ciRdpwX_5ZT"?v7DN}R:L `2Bi}1'zTl)Uj+b;]JƟǴ ^aȝ\=h]*،DhL{=sɨP:x&NUn杳Ƞ`Rލ^`D%ݷf2ߪ \}a 5ñ\+!)l;$c'/g_=qnmnj=p @yf{a /&3&,Mux <\䖠[~):Faba~Jg3Z-Y llS QvƲl(۹L7`xj EffK0cـ>䥃EYE+#O&Vx [4n3EøfPB"ل FW(A{3ͪ{KA -]ʺLrn8EΩ Lh.̨} Ѹ̒⟞J-_^H^UctS?@-IaqJl * bՂ>B`LК~XQR&Jq13Qߩ0jGɱbyk"tզ)s+ŢB5}GV%F>ad/ ѳ X7,Q e L;XxmZy]0v>+Q~E( ?n2^/H vCd[M~.%ȸ|tczPl1 6a[EA M x q-*l)9>,.Đ #/b^yXgSE; sm7T W{hGS^zLrw̎|;\"a P=$> E V[M}PfBrn/=?!-Rz8%fK}7x`IIޫ7x[̓ky2pi`v;>y XC_2ǩ3 Ov}Bzu)j7 e兲=!'?,H4@PfxG"G }Ъ)(C.k0XqkX{:1d|v}&"$nID-Q>{Finy6N/~ X7v0x"I6d]_4SNn9=L@HJ3O|_hiUFV\;K@"dOc˟b >1cSL^QX{kCO^`zYDnq}0ԛ"4r z v  Nۦ\k%c߭G3x|L+A5hMyN*͏K{Zlqcf9#d9i!JF'3fW cTZjjl*L.Z8iQW * ayl -)9l.1 o<\\#x3[I HJ5U*?89%'fQ%"bn_0k`p5]-&r<l@u%p` pt{1(!HG>FpA8n*-^=2cZ.(x&y~-!801E W2 {eS{=H {Ѡ\Zpdg:hnjVt"=_o$l҈10J`#dtsDIbaSSoD*Tttr+{v"IxA [kdk[CJ_iqw=4 As& $ʉ5L"#rAB~k4mf@Sl!AOFqTb}Dc~@ճ Os$Dv[c}ׂ4xvl+EJC35ϖ'{4 =L!rCό^fDvVPeZEN`b[Eȓ$S -YF xE{?Rj47/`# 1כ&VuOK)a/ow5'-eD9A*l7g/,_/Y}Ԕ (u0- 2.nMa U78&څre oQ0Tr%Rmt~9^}Z2tުSȩ(H4#hˏ+(V $u LR{E:ajUTA/'i%F.k[dixv>i??/'1R2I/}R] t=p'?.WJ9E#|$gz,QTc9f189aYk~1PP:hR&G- i(E|Lhx{=B p9^(ǥ" F{U{Aa/w3ITfgLh"'~WrâQ&]T,ws7#<=CHuɢ";PHɩr-|Ab~u~'}k(in%~suo:^GJ*@0˻_,yt]am۾3޺{zԅ/Bl.@LSO *GνX۩[ݺ0|pD0.ly0Ձ\QMVJP/ <$6Х{@,o̠>m+u :y^9>6$Ch[pDv T\?:}BD)BZ̜_oA D2RT8((:M_;3^eGQ I)8;OFQB0FE8ݼ>'39#I ULM+ˢHb]o\8'ҡ+BwwvyD{'DxZ9%3ҝJ('ijT~?%@"A?niwdO ĉղ؍m@̺MljB, e˽4:e[! Aխx }і`RWy}h endstream endobj 60 0 obj << /Length1 1626 /Length2 16569 /Length3 0 /Length 17415 /Filter /FlateDecode >> stream xڬctem&vvl۶mۮNŶQq*mo>=ߟcyM_cMFB'dbod*noBD 5ruV璥35|`DL ],D ]L&QSc33 bdinTS֠O?*#@--n6v.. ULM.3KSRB^ ajgdhPt54Z9R6>L,)͙ۗ3`jlmfalD p0utv~X:̝ \{b3q5'orpְƾ);8;Y:*;O Cb;[~{oM{cJu1sz`b`cۙpu3 hNN&6n}ӝUo`/ki,]Mmac|6agVL:fQ33TIxLL`]C(X#[#r]_]~w { @ϢqZxWm g+loc_1)ٙHo_ٙ:Xڙ~ jailmlLLkT+yU)-M rz:|?K7_ {9t,Lw;!.vFC9bϳ@nFU?y/nMC;I_`cW'ouffuޘ'*=+å3whBT t(ԡQ ƾ?W{m(}gǁ4H/ EOU>/ U_&ya^)|ƹF66;^;TU[AqZCz'RJ]9y#`-x.MN4!_Q}'ڨ}IL9Mj,?4՚5wr)A¶%J's`@DjO1.`G03l u,Uum潨@t`e2^|l)EF~lFQ]}a\`Z^+7#FkŚP1bMˮX9ܲy\k^7[#Fy(< T;Fܘ#ŏą[t53'kVО0SkKh[Ut_|_/x ų4"Aob|J\lN($=GV>?9iyi } .or K()yA|Y]x .3s[M NPّGdMU]P=xSb 4sʂޖ,zz63_u(5n^1ө<&c5!Z30jDrqǜA큘'0?= Oi TGXe9ǡԿASH*`: n3;HK"TCt)kGc7nWW=+Ezr%;!hO񠾹Cb =ZܼϢ= pܿ+piNn Cq@'8{ 1lsO*W.cUZm#n~m~a|g:~7Qmu:mӉv~ .xӳF M+rx|A$o.nX.YT)4=+)R p7XjϪa:^&N^NztOp>29b뛝w5]pG%E"F?mEؑ.v/*#?GBe ;E3x k)pYq繿p8":힣@ku9;@9,x= \/-9H=F2@AߊNƏ*mVc\fMJ5b<9#iP[$C`mxairsË6:vfUh,#}BR̫h4(^ꏠ"Vh ؞]98þ>]4l>} .%^6GzF(:P~ʔ; w)Lj"l[Es0;^VajZmAt_dH:LaF@3 ܷ.Ɓ3GI$ އ ,_*A&zIT+L[KhV_J!$z}^^_<\4Wi຦225ˣ9NN#bT1 YT"HSkJgTOdmRL&rAӑᆵ/#Iw} <*;MfT=w˝xAn&,n<׷/?.Cr_8C)N tÐGiW1י  T9:aƿM/Fa? etE8O@A *Ućagqa‰~Sup\Z97Wzz)b䟄r8M|iɥ@r݃>?nZwYo'Fqűh.{aط|6`b k oWoD?%\0aYNP-;[Jz.R[,e~4.(!ړD|)enhU~`ZCHNϛ8яG+H"!$+VR(>'5҅W8=h g/3_6p)yg>t v Ӗ68?F6gR^,[TY6:ٱo+ !%h&cۺno fQPJx%t䪙 Ci3I蚺p9曻(Ϛ >jm M0RdE:Ý>]R#aw^@H;Em;"/>%Uq!`G {"%I6Þ\d34mxz2)&-39\zF?i,o_ U_~߳8 zZy:tPݭo4DiϹ^EŐ"XQ OolnSjYd6+98d]*4O_=m}X$=͡[ " @6ff <)HZ3cκ򠹾H, :"i>Q' io\2k.Aʍ4]]+*sLpW (^a?=D QlOHǃ/GLngeE|s-*7 cҢx93wر~BBM!U5՜$ztȡ)$P<2Aj!vl~4M$:oӨ,i?׋ 6A ȸ)WP^0ERM7P[ oBpSvG(C͇Dz{դmi+j{Ÿ~؏ǒXTL 8J~KaS6((uV3y y-.:O`͏EHآ"&Xcr& }](̩b3NX\BNyTW'ӣy4mtYn۔µT\iCsZ ~v+_6pXJu)B9`:v9 BeO>%,` A&J#LS _uey ߛjNz^ӣ O]i]);-孷\we{~$r ĐdNa_Ρ<S&r!F.uߜqSb,AcYzBareWRcXw$J3xg;t+B%J;Q9OgUJ~G Y]y~D9ҩ u&MHYxn ܙ˒!ן9 U&=Jʮ]n5~&!S3ә26jdf #~3WIsbiЩJGocnI!M:筽ì[{ N$ ^3:dLYgs/ڴpe,櫟5r@䫏x"kx;su{WdTaO)ůnec J63w)ϬXgSUpTvsLE l>HO.!x q.^pQt>Yô;d(T+2VwMBm.c7$NrB޶Hwveļ2ZM@˔HaDAd] 8f9\B$JJ*Մ?]* +cT"͐5pƂA0YvS1zά |LP?ZSTY+M5iγK^6x ٻtaYv!TQGle-&BTc"o NwTTdjG[epG=r! !P>M9вNoak)N"vD3|}@KSYgJx9l8SezXa|/ 4Yې4ϯDy-D`'E 秼. Vhdr74tBGcEX.|<'ukp f& Y'B`flV C\`i$z4x*i?[_@(Gm3is)\\zO[.qחϑk[帚BP5/22@ۃtV4HكNu' s+m[68̎78ێO.r dMmQE!qPa$ .R>N:xz̡x664sl}q`TG8CL\d誦0n&УD;6[^*f5ћcihbʛ"s'H f17?\6 ʆ92x=!G?ʬ Mkǔ:+ZΡGqGGCdg鞆0^ĂCe$tT~N*nge>{>k4ց"@Z~sHΟaRJhJexđ ^M!J$]K@'Îdw+ZIPr70ZfeD%+ ^vhiHRbi!Ԩv\ /O;6 cOjs5e%DPَE*Ƹ IƖ\ujGT~F!/.E5AE)9@x2n0ɡ;w;4N$G~74XxヒՐ- \$ց#!g ~O.U9-{_buD]=g~Ah-TwVgcA?q~M]hx=h!鮕/EkM{bHץ+b4wJܽVRjE׽%y zmIJzH;W~^ U$SESM]D$\V(Ӝ%d("Nu,[}k7) LQp?QDPXx-N'BG*4'_)^mj?4f@M6'Dx Ũt4ޡXO:8=iٽ62_W,f{.(]c1љ r-$"L#)bj"R54=]0nm, jM`Hn Ď ӾjͱȪ)G;W?C c{By~u\U/BϓwR1 :NʒZ!*f)͎ \ QPU42 â~%w =p iY* г#N=B{kPa5ԟ-ENQ|jPIȒ/>A?M}Vx8V[hrFi5?W[=K iej/(l/0T*'xQxⵆ]ߤ=Y6ce-7G͘ʻ,` 'f)$1>aᠦe3EES%Z& "ɆiϤzG~% v{G/ߌ,#~%+;vY>0wOP" 5{ ?@>Ed+S޲Xq[g,jx^V< kEȯy\AG(H $Xk5m%UO.2҅ŝJs]X $HxxsD/?i@8$~‘^ދЉXqzx4zZdrzM@V u;cX֟c՗6OM1(U9כC`f3;wؒ L|-6O[uX<\\};Ns=JE*(g.=߱jC40d6O+x{I~XT-x:"sPB7rά醫-LV^ j&"E/ n)e2i2tZ 5/}0}v+vh ʄ# a^Q#'cul ÐGPJyoOd .hܿ\m3NVgSS4bly)\G,'Oq_Bꅼgٗ;m YY ob;Ō2a j* ^gf{Wsz۱yƛX; NAOo5>=2ve#>qKOԷO6 C6S+]hi0h?H]N7# iɖ:jWF=KWU"-8C:%]`N 85܇AҘR |q\"nw*Av$fB! qžF` I7G=;|"YT*I%YEmlx0aP2hlaa@M킊wSau= &9=eH#KNFʼnD PB (.[V(]1th?3g?yG5-c݃&dL KO?qCcdm7%11u 9_ å8vsc1/4E-k*|JJu0sZJBBW),1CIp'^l*mbRڞp^n`VwF`:8ԖUH(FU%hQmӐslxĤ*l;?J ^VlDB/u )xBmi2<̼=;Jr ?~Nhѻhp9Q"'rJ+ԗ/^HEW?eP l4}Oۺ[wg ,X?e)y{F=HFP *h|Zh0x-=qrXbT'fn 3-J UHԬ…[21D׋[l$k6bl`I@l W@k#wЋ%7/7"V{tt! zKn-IţV@ Ȳ } B׎H^!/oZ2cz%T7ŠVDZ8Su2k55|!~ԍ0FMWwf,}(p^xj"x6'96[I\L>T)IDzkF W\S+QT g3rqp-+e唅SфIK/*B=hɲշP;Q#q/m9(p> >Q-so[7I;aK6CI0\8uzcM8֒QD@8iYQ"mB[703Yd+"g- 3=G;*"*A334@7eM"ŽAUlIY5RH{+AA=̣rkE,ۻHk;f^.O6P C7*UdD/ZxWC9C@\K1C %a3 NҪ~OGMB6#<9k y-ST-SfKm,=/ 3An ;axI{B w+eΧvta`02ԑ;~psKPH ɝm+A9VkQѩqptϵRȁtEmfHIEM#MvXN}+:[o>5C4XDᒂXsHQpT? W@J&k4L ?]hଳꎵQ0}*XHj.ZTi ?KkgUʗJEcJA3{]ʝEv8BFxzIWk=6nлɂho䗎gѰ2YԶ:2%Kf_VLj.B2TFUp6E2oGU Y܈ -Y4~ -@?x5_W(ڝGG.~F=xze&͝ł†T^ʡAp LZhj {cfnd'elI/( ܵyWIcdP 2LrW\~gV2nKI5$X;dȠ*bӡ@mةf*Xvts6YWqk96FXyQl֭ͮcb}ii/WF;RG419Ʀ\82 lt8ބUҬ;6"G*gg{=ڝyw wCH8pA6gN5Zl`1~~ku=] 6eWn`j.]-%]4dq6(Y-9rGŽw"tNk1.tUy4,>g Vg+S?~umEŭ,? 8u a,9dlÂac{C: 8 ($ !~Segg"nQv@y 1 9$1ī=)1DݴHQ!mr'v -5?,[-q}sOǮ:xT,jM!$N`lL+5479o1]6&3:0dߣ&o]s nw]AWl8J!grEiC*t7<7-$g{--.w*E작\}T/PmƝKd (Z-z!^C\ᄓ;2z)M_V׼'MzAƇ$=<hRVoQY{@w&>7$E`!w(Hr o%qB )#T~чz)x+k  }LBv<y. BOR4q2?vd AJ D8Y3fۉVܣC.YBm'+)@LWɻ~"$0؈dQ#> ~p߬g}5&LДa56Hd+=5/b|ZѹF_o1J X#-I'̡l.!Րi9<5:¤~KYi!< YgR a1TZ͡6\ צɱ'h{P̙ !bnpZvp=?@b/qOد[Yd3ʹ+ʡ* Č2XfXly"#exG`R@,XXQWq|}XY#,و-Uu~zqcBqfJTALFwa9zx8 Ƚ %;D 9"Bth@o`1M] -Ƽ1lzf̪pM8>d;>~>,583Ta±+zdRQ\[?Z^!Oh$(dLx޽ʥ4L>.?VXZge `_U`qs~ޓ!V{=T:^v>#גR̓q 0ku ix [)Q3$YBp Y(z.R0XRsBwe{/3OagYZ N_ɊGH$ E\˧cAPZ/E1[/6u>A!o%<톳C-uFlBY gG"ڔ YuIK3.EW:C97oDk0"% kiD",й}9~ q-xB}Ȃv@"#kgeƺ_$33_h"ռo"GnqMml{2Au2O [i?\ P~v^ S%p9莶H^`=sJ*1$-IEܪ&QAg=_@u:]A7Ś9͜!1L-l`ߨT}>(8w(\/YT2^-N<+ac "E3p"9w831d)KH0IY{|5(s}pstOJ\eZu+PUz3Zmur2/ss40r܉C&ntW:2cR폑wV$ҐQA4Uˠv\d!7S`)J,Ԭt X@Z lp~xuR#_ewȒGBt+Pi.]aƛp>',~7sR-}!,3ځ;|qZ7Fc=09mI@.IAn<~#S_uo߰W\c7ŕkSozT bIq%jHEVVacz^z2B_:F]H7=-&0,y]}_Pr eQ= Im$zXؙ_{j"qW r4Xd2$2̥, ע|cӮӐ,/-=Ҥ[XQ# 4_*/vVMQ1x6[צ@>Dp9(. MNYۤ𥬟{Zem@ꐾ\Dqh/=!TM_)A~lłCET8Ƶ"#q 9Z%FAFEٺf$ r7DC4QzCH!DŽZ9?-[4Ζ>ڒH76Ee+nাˊ$ endstream endobj 62 0 obj << /Length1 1630 /Length2 19222 /Length3 0 /Length 20069 /Filter /FlateDecode >> stream xڬspfo&vmc۶ѱm$;۶}̙:?3]kZ])HLLl陾3r6F.NJv6rv\J.r68 GSCg)7@ jj `f0qqqQD=΀oJԴt)`N@s[WSk;{S[׎ʦg S ")%'&! 05u4(Y@cS['Sj# ҜrMLݍMQMmNN@'8.&$WnfZSsrv2v;FUwvUZSҿtaj NgSwbLNֆcw+ 'f@p457t46ur gzC{{kytv267@[8fEo\Mՠo $ Ml=&fp rvC߱[or_w3;1Kwd,kC _MLo[lRB8Dll03۳UmMLW[LEb4LmMkW R *R/Ca7Q;yFXE gd{& / <0tv'#fklg(;ښ)Gm-U_sojnj dgl\;b_ڨRT_cUi^icc_w5Uoe>ue'A ^)bzՂ;΄^;T'#?k?=qjCfJZ]e#կё}|ڜ8X ClS$gFOWWŬVDU7O%bmt "/!=F%8˰PX梟tc"*z]KRg iV\@æ%4"OTo2BL$9Q5բ9X(G+vc:}`z@U1Ln4gяЯJ嬱x`)MXUs+iͱݨn2{,a6MRwwz=iblGM2%;0Ú= e2ryZgH FCMMtQ:ەY)I<+V]JW1PH+ء:4Q}sF OVYs~ X:XRz^}%kb|^n5&^7GK_W2(l}c+TZJEoBPtInfir\WwG,q;SY hoj J!?Ɇblj62z'5GW { !@ ׽(Es5):d$ D G?8gWQ $On<}^%-;u'Z6n͜ߒ\kg?_̖tTN7D6D@0v/MOZ;V ݉ &զ@ІKLE@S_ Z{l@O8I98z&ԧN7aw,R mJ䊇rOG)*˭,;jfU&v׸W7fIPj>'LS pK\(:6Z64C4^pQ!;=A. 9QnlKPFCpLm{e\|plHI˯dTZ?g ߥЕ%' 7H9w}TNƖ'jiAѦBYg &ZU:W26 ^]:ǧ}aY=7ZYG(۫[:}`}f2i`ŧ&mgp ^YY֛#U-J$BtW"C4}4B7E OLcxC!<0h(_gag8٤-%% ~KFm޼ [Ye(v-$R_vo6jWhh4^*]3:hj6kh^!^+)nEnG'BoKum(ڳF`!)% 3JkXo|Fypxg 1QDyϧ9egdda*7RՃ*X#okW`ƹ^"]ݜU(e6H᮰!#*uIN08]qN~~4[٥(MQBN'\9`ׅn=IlI]3鷰c-7ӌ$;;y^>\VWk ZՀ {ԆKBFQ]x9-Y/I& n4aY^_Ijv 8\'Љi=/ÿN쯧i{684P. )qJH_^»_}u[/.4 @Yf YޙC`06/(]iPߒ͑AH 5PIsK=s#U+" )ބMBBLxTx{ :n[y-DV(D-΋qdEQP el^zמ]N;v&snN2dY+le{Z1'f?V@FW Vs'k sۈm_ms K*?ݒWdfdkкX| W nJVs@G*brk´)VD.j(PG !٘:"qz5͠Υ%M aAAe^*2k< sz2,Ep̩ǜ*|V|FbIgĈ4!2UAYBk0Xio3Ss(=+<uSm4SiRbJJɪDVJX36f `n0MA|d|s0K8?S MݕC7}Fᒔ2麦!5Q|\"kfX7_\o.#4Vo37na1n Y1ᡃа"W?!iև):b;+g a-#/af#a$蹚ROulz(ЄLMd缊Z>ɱg*G'^T$K]1JwZ;W`Z/AtQ8W bku`I(AcxP%R0cY󭊱U#rR'QL u%30P3d8ƐΌn6$wuRF}k~)tOV3qF Nm[{ rGBC_ M7\ 2}"c<|6߷qI'ZI(|^4p2Wl 27͍+:uP,;vlO!t26>Ўe33-dѼ=՗ ш/s˨H52?{&kqV\ |Qܴm\5Eqʂ0N~!ZL00k^gU2F' ^ —I 3UZ-R:9 卂-j%#o7\i8lji: Lvqkjk+\Km8AjXI*޿XEzDˢBd?olHeUωh8/~'+cד2 &Y.j 'u-܈:sPAq$@:qEN̙-ӔPR1r7}b316Zt{L2ukL~/R-EۻHA*‘<ԓDu5ݔh/MIe5b^Yṅن |d|7t \H]Tg:{oF@r+ BM`aXRUAAsp Ͳ)IŦ#gx 4l-4=R<-QǤK38ctmB`ߠ|b?* ̘P9̠iO15M>SK_kVzD%X}ˤ/n~>S4҄E$'6B~Z ƯwMsYܽ@޻IAӿdq:K~y"R#cl) A9f{oO Tqf}hp'k2_'o(ToS>?F`- 㷣G}vȏp{%` 춬.xsND(eأC@V"i *܌;g%<"/w2:SԗإlQC1?vn=sc$p٦!D$Jiz? b& ěPI{E >cS2o (\fߕ)FhJ=8D: NF-G9>!Ϳ+ѸǴ'=k]飨E;PJ*Rnkl"wYu`\q1Ix yߑlZ=/n}ER%9Gm7 efAD. H3~/HU ZM Yv31/LLE#>{p\.,%3dM {O_0KW;=-MSd~y*nA DpvFf&rWK,!$oG1^Jb$P,}{>"~Iͬ}ضFBWz1ĿQ^̀@C%a|yO1PVU-&p`<[ZYqrfBZ7!ɤ~P)L^=̊L垦phCH}}˽bQ7uV*ݘrސ9=ـʀ}\+U M[Tf}6؏GEr(`vyw~X5@%5% A3y"$lg)&7!̏Yy'H=ۈsJUl>at~LDj+U ZN"{ì)p ex&5="`jp2Ur)#A"\V2S}򶬗p]h'#jEsV1f{*W>% 3 3=!Nݹij|Gbsd> aY )kaANZlΡ~ݐ!чGc F>,^=7 ThyK%T̙0˶sBqN0ݹ!^2|Dd}볙8~鍴&yRc4$4_&k} ,wگr yZWPT[m93:ŬWbͧ O2бveWive7w.5{|#uxp~;!wX Mq"Zu&F8Sa?AUΩf8N<[åˬ]:c?"c؂k{/(ӑ|ǗWvp,/>\riO_Ln溚tPQ^GvaABVS&0=9qͼs^!SlaKfmWbr'a5&9~7S~j>g%eocig6Q@M+$;Z)5ެY) L6t ;KQU[!(1 Y hp%@xXpu|vv+MâZ 8Z̈㇍#WXu[G@6-P$PL$e$JFV8~J@Q#jbH?aA}CS蠢/ӓ?-c LAːv @,u:M_˥dKf>/bGQDV׺! ϓ TH.3 f1_<"^sn$'=PhɏI`lQM8/$UHHƪ+ TX?n RΎ`3i,ƢH!--hîZO:*$U2A͸ `7+ ЊD; k{vmвR BJ*1CExMqq'kZ7EţmL8f^* OnYx$5,(3BniR×c{rQ(R^3,jGt^sheX0 4{,iɩEnߢr0*' [s*\KEmAT&9M_֌=l`;9Ꮵ拥$?BT 5!;lCa;T7GI@|-Rss{[|F|fǸ9Ou`5~oM8>Mɠ+3e c[oq#r@K(G X̼#Coa9՘d7{MQ9NYIZs2U0gN$@ݱ&Y N"c-FwX{O3Ǔ̥Q^xeQӐ3fc.+ $L 29-v?.ib8֭8*tt&ҪUyPgmس$nd6?,h>;}m 4B:G{jObyq\UyrYڳnOTCnM,'JKqyK&8mck#Y实lf2Υ]o2 "=2LUSm<k-W{!xk)JBuBErfJ)P.o:A4O(98F+ \9s䢉;rM+͟2"&F2ǖmQ5 ãH &+JGK!qd_߅·qH21ܹ={x5AEdOIgE}Og1yثNV|i*Z6r9!u6l^AMY:VuL4Bp/,7}鍧MJDk|N;{S2ƁqVu!WN[z+*a.m_w; =G9t͈ZzR<)t)Bṅuz|; vc}Ʌq8k\xv5h9Ea*q #OPzRk)v/JI۸RBкP/yFzJIAJ\ҠuOn?^р{]ZoI̋O[χg=~7fwK 7RiGK|޹:M55c&;qJBt SHAa{?mF9AtV1&rT_#&>k +􍂋f.۴%mȔ>b ꄿ@E{VHʏBNnf #m@Jh;vhRUdɭ?~ '^6>Җ/q.oeS֌Jd7#MBAuEQ娓% B !+k1]^G[h/TmMMb T_V;w2|V%fvsZ ʩm .=C54vVUpt ' MJJ d_:¬wͽ=*T!AOrDS0:u|{''~qx4Ӫ̃`3_^~J strn@Znj_.Mz%*xe6z%R~\l}1i_pp8rh:Td*~5l=v}/1.*k3L:cAnoMAjKSi6Lb(Sد fJ\ޚ˿RTήX)I2 fDHAk!='|'@L]fsri^TH˜O:?sUhѯPz!`QqwM{X%.Ȃ,#VV-urs\G&t*1pKVeTJX"2u^z{2n eXp3 ޴P!` 7z\mu2nuFՉm6`:c<{đ8FJ  PU[א;y,X9ȉ'G U"5.61i*< Ng=Mj;d3富 v]8ae\Įij7:f7@adS<!LK7ͷNz!.]PD}I/- P^KK*:g(D 81H2ʅHC^mc3B4p\2H=Y-> @P`>c0<*\!(u;!Zg:Ui ށcOUk%ɗi唂qʾaOO>-xY4-nEц36jt9$0&{Ӿ Q6nY}*V+ٱBww+yy1e̟Fo6 777.C#K: ZsD6$3gw5hfS%n=9^~sAuGzg-T5ViAR̮6a[p%o @K&4y_3,|l,JY_OOH|y"Dva+vE[pRd$ J=*7+q"'*3mSrd= R&$#iq쮀ihW /\$a/,(wb|-REnYQy1${!YV*~u-*;Ϗ|iXA嫴p]yq C~zV[,/cvaX6>zq8(>6Iԋ3?C:T\Sus4mL+h3fϙ`{D--;ɝ+Yy%x`v#T->m"YɇuOD舄Z<}, ?%j"s̛`.ThHglƇgba}L J(2:lY,**]BZO p5-zD'MuR gMou:ػxE{E¤y=e]` Zjz+hNen6ȺJ 'ZS1M$xt}u:S /%r2LF2 ~75pG}MmVI9㸈,dN~8ȠKJ:T{BS奫u6vDPk/rX53ҍWm$cL?W =$>^:VGLĕj@^lf)ޕ@T@d$Y녤 ALH% Bz/sH)4Ɯ̺nIJwkxF?&nvPϿ \NȽ{ܴ U A071#)毘/:sB01voBopEe}ܬ%J+|:K߉_`e@BX :%hxЍ?Ƹ; ]-k8daol Z…ڄ/̖ųV,p|tTdB :'1[aF/F0r4'ѳ!j%82B?in(rŹxyx;˟)bnjqV$-BY{v;؟Ft_1;wȐ/S;,]SG-qg݂;$hR Ç#؎"weNi?Ɠ-9_nO+9H%ƹ(@ŀcrx?M{l gr)pS)sw&#^ݦEFnM@Iݷ*tvJ#Yo5s*(hb 4BHZi.MņGxfľt$tR UN"(T*yV:rDK+`Nqvwh~W,)I<8 ;tř7Mw#Jݝܲeс^:KkGPaq;h˥_CBo<[SwY2!!K;1mL-m%ʔv{"L ]%;V@7*:}gďEztP?It"fO5 J+hG@_L@l{17SmJ8nf'Q!A.UlܗxҮ~DK_ !\NzWΰe=Q,rMmW'_Vvb~Se\l ~Y^TU`XY }g~dSE|=nrx"@jdXZAgU@Ss*639nYfYLA H,6vƽ4f$ zX۠D~pAy41bS2.8ƞ.:nӔ|T%A׫, #bUjp[0Ȑ?Z,`*G_s󻐂470SptFoq@ %C=(Ȓbi]smBNG&kWnZ+E e\,YO[*;r"5|S1*z1^g>NBPKe-'U XG.|>_r_.벀B:J RE)QF7(ǯňò4wZOSnɩmP88 OvGnlV7|O"Lz("t pAk, |s(nS,\H%_ jښSa7# V/w](ZO+tTUNʚ4 xJA=} RZJi(o6gb#9T\;:dΘ8χjwt3Q$Сs6p.$C.lR!dՆZC=\^G)q7LZo8VPx#?Xpj 1ī_{SS +?1BPFlp67?3KvV nNsh!(Ƽtf^%.$ZJj>=[@7'`PHϙct6N̯*^b.=HK֬͐fj$P' _-zR.T"Ψ~1t n >qM .;J U];ot:k\8 k]!~ǻ:F`TSh`LsR$<,_V\qO(5bZ}۝!f7d`h{+*}p0M(?آM ܄g_,^zJG)v a.R9JeTL5! 4+?BM)o2t0lKH`Ѹ])J]ȁ2(p:݃zj. +)Rrl8|SF|OxRļ)댧fʘ(3ʠ~>Do;wF0-#1Y"]9to%d)%lJTw\ &vdןPQC@rQLݽ ?Tbd+KD湴hp.82"=j/X-+EIl+%Lmל뚏{4a`0D7cOC;7<`p &s_´(JSFtpIXS$R'wyvM LO`4!v%Hђ!RgHYCF[mHqYr ?XҎԳ7{ϓ{?}4<[<mnb.fTU'vPj2#iɋ#>Q.UY*n)fAVq:l.晑">yū]]0b4$}Bh&ꔣO9teƜK+S"}饈U/UlǞ^QR#'mcb6) 啅"~2 P&`OMmk!)ͷ@b)V]ŖsyS`3kP]dWzqzyɁ7] 'WeМx% s2YoaJ|O1t\/qwOGy錒jyak&[iK4=??}|1}UVpPWb qӲM@tȘН kLE'ʙVm=G}}cozc*QN`GkTskD^vuq$H2d8| 98wtR[ MH6At:|6r`ZJ )6bJ@Kwe*JXC_$ǫN3]?u~Îsi.ϳut`J#E[ U p ܊g'&vona[w-0KZQyWmL*J"X7._ 3[ mac7XQB$XLaDf {$l&$\'G> stream xڭveX\.N@XN܃܂wwww}̙;ΏUUMC"n` vp Av.v,@KW9-]ǃDC# 4%M@A6 4pr8h K+0^K]_LԼ{,n@[G;=V@PQ,,QEڂ 3 ` ``o4w,q hzwzR1v o`lb~dofjWr rtvx{׽:]̜A`{TUI 28X[;Uߺww-d=2A.&AWg-WR[g ւ==%~ppCnO gޓ01w-ؔ!3YH_zwCK*ؽ7? }јw @ײ5qp@fswkm?W#;C,<<\A@sU `ab~y˵́ζ {;;4@f6kx dՙm{W5=`>~txp X8߇}8aY 豳s|u27){3Hlboz)Km h0`&dXXW.Pj\vTse[qgϖ=xCMЙBǴfXru6igcXMݰt-,:m-]`_ol61Sf4" ϏCu++;vʋ+=eD՗N?«QI.5 V_$D!$ߞSKWRE_clw ݠXeJmu񻩙OD*Fϕz,qimm $HDqU~ߗ'.'c<ܗ3I^QYo/E;/[U_s 6KlGr 6ê\R녈/V|>8m9ؓކ=r _5pԗJ^Ig.+:f{vsy^^1ЏV,I-xf?-jZZ_368XBbΨDc] x Yqr(o'<O{ C䋨 b.q%A)Q޲)F4rXfyQ(i|[+:`ו]"A 0a8D聮$.Lݾtu'dfa]dOgy4~>;4PJϨVg8`inguh>Fy [lrJv:\"%iֈl b6R 2\k֢)xW(Ay/&v7/t@Jډ |0}"Wsi=G)^gb`]o_i4x+'bER녷5>h+nJ/.4$䰑S0h-4(do3ss7d$rt ߘ][mILeS~A72xhgpOJ)^hT((B*n]Ӽ<6us_e/4baKX. =I:턥WHTi1SCf+gWO>Kz/#pM+/i}1sUل1u?:u1XlJV~o0xVXDke:FJO5FD{ pZ h J,t!t[a&#@ >M r<^ bY*ڧС cf kM ^4\wɊYƼh[B*C 9h{bdΆ5Ţ͇Vza.,ȵ(v)V .O1@b$6Pμ (WzZnİNZqtM[dhEj 59!˒Esh땝a̢T *GJ1ȿmmq͸B¾֟r;JIYdЈ3lHIL5hA-͸Kӕ jEtzwȖYqZQXD)f @nlz-n{@WGӄ Cq2fE6HW~"} /!E5x W4Vc`_#9N\A "_ ]dOXgq [!l uQF"qo^o?Îu$XЌFl, ;U*HJ&mx<xLq\. tЭzyr [YvI,~=LCxp}~' $@$sF?sUF]\g; =33EPqfnT7y ->>Ei0:dmFR9w:;@D`>A ʙaZ{aLx'Sk(*)> l'<]%eUJvBc.E}+ ,uR]_&2Diq^ Z]\XI MᑝU6E!#Aa3lFPQ _3c A}T5 iF*QB;_ʆ1)i{قboڰRvKP;<߼w+j¶;[vKy4|ywZ# '6IcqUd҉ُS'Be?x) vIͦ=&`@~&YbU/^y"O T㲥|a BWq4 -sвIk屹) ʇ^xGZ*f6 CnUUdAMHP^8Iax .*Y*ʓg1!G?85=3vlj QDƇC&D8s6 Y lI7tFhÈ?'<[6\u%7 b.L3T9nb\݉U\7O}Uso.M]#bT)ί&h[Ne6ԣ j;ؾxe4#jcInB]:aWR7SGnVA%$Q;%k1LP_+b.R8"c>U4=8|͙D;+~q`?Z\7|rC+1r1 c)cCa[T21|Gt)چ=!%C~7V7"wMEx2Q 3`k_m#H7# Œυ{ʊR3mҨ,dC_rXq'%b6\~XrF%0X0X6VzBpe;/hFކz"?S.ɳ~t֞ Y_.{Hv?EE?v:MhzyqRʼn1KvxZv)C~PU^܇gr˝Ѳ'T;^,UãsQ+ٜ6&wZP<@ 0=> Kt=2ûZF4ꋕ>( wBȖl3 l ҐAOJ qIneC*էZ^<(%rF`dؙQ~\ܰ5|DOիo]ojɯQn4v@XD tEl_ o̰A?pi}4:)H\U^ `iF]#rqomNnA֠UU %z}FLQd.HIcх{,ړ -Y)MSj&KK*sSLkFt_QorO9,pQ~Ռ4L POv?FvFG]u %+rx)x:n KiePw{A+!??201f`wZI%bc+9ޚI:?w}#F.76^-3Z)I/+od \V<&>oB~?T4>KC3+SpI!J@HӦ񹊮)za N/>>ş?>Bkj '|a{X1'8*žȳNx>Er8[M cb4*AORW,*?xblڗsE(  SA[@ 0j ZUd^5Dۚкge-wJ\fO1iH'DÆ>߻<}_[+oowbyVL1ٮ&3ȚPj1oUzV$hW~TU%pPpqvFtJ:|/ { Ι痦ؔ'/cxw_ EFt Q<*cY7);Ku#:iES̶BX/<2]:覴ޡkը~oj< V(\1μ4Χ:/kcB-y5S (π팟>/M(y#2ӣ:[f[NjQ0,vĕH3)էW3e_J0:#$' 1"cנиTƲ8WzɃ%wo4i/. ,YT 짵/ qO'̬'l'+kyۺh>ɴBQ9obM֦x}aURW( 1o`Q+x{?$Rhk9u=' L{3\(E#o(3Zޤ+MI7wؼmw[l\֟buF\=8(i/>18e{,::7Wwv׵@}!e!07`п:7.B䡹][7Ɲ*!$SQ>ۭ3^:EnE׆8;#zgnJV@JPgtpSaex3d-HT?.L3pV\ Jv˛٬Bu#ĹB naӄpM ԑV"OF"HρטKHA^f*2tZy?:B t"Mv7+_g7$yϢ0bTODKu_bP!>[(3kYڣs+pBP14A~ Ѧ XuLVꚷ-5EWU M%ڲ,z; ep]>pl2짮Jy)Vz฼Dv:%np]r5'.<q`+e _ev͇d,?y/u?0=o9H9壶 }`lp[y$6l'rmι}GltwAuW YO5կ8"Z:LS19B)6EQЬ?ؑ̀yl[vgy+l&_[ ߖ~By no'XgRحDB~ilսm 98XeXf8Of.8RhUtAKꅰ}&Dq֠=Ƈif>tct4Z>f!%ɍ!j?R-Ao=]r[¶j-!譫%)e!muZzPMb>Am,0i:w D7j BkdU#~r"hLLN~l4u~d3wAp,f<"qpb2^ RXj)|Zsq<JsOS}+C]_=L>KWPEKNP|o!pN Ӭ]aSH\$ !jhyLyK "TiâP~η2?tlG;Jbm%J' ޻@TJSgy*wa |i@]:=d'Muޚg9Az픣:;y_d\ډOvg6)[KvNefFĀ=d/KtfC4"e߁lx ܘs$ ~ޮ7VJ!M%x9V(N{~Ka%VܼO$4'ӄ[ĵo${K]EPZiJJ^[U]j1g{'!lgjFXT!~{zR0V)]`ͩ>үsx7QPL+YN\ l4A٨PA}٭ (XGuNj7'=/-Z 茏=5KM.G^xJ LpG1YޒmcTu25;}Ņq=#.o͆~dپOMGz¾3c6WF&fB!Ķm|f|_P \vMm.M@1n ])s5Ng̴X,x:C=d!{(w$'m_]1V~P|⴪]]$hfR1yIU`;QBH=~LSyn ,fBph+a:vh0Oe^sbW]{{đ1-8c&>\5#T?)7J=o7G[E%ypa~"HQڈ^jO [}wM`N,2!D M&ҕ+·FȻ]0t99 w;{|tV,L(Qƌo_eO׃v%3?}o] 3&9DK4 >jj@[~5HшVLZ2[Y#L(^|B^Ӹ$7~X%/Fʪ7w!er˲-<O(c+MOq^ʦ =+s ~kPѧICYZ1:r5Lšoq&Q. 7V0{|1BKXX8lTEE%P3th>^E{Gut %abxVu\Zb;e*=|>>4,[:'?Xf]$X.w Hsp9[{B[ʅC8{{ph{zĻ~oUAChO=_r@bG7YdBaƆNQg1lWc튧gø>se\7_''v/Yxl+ f>n`Nϱl2?ʽܧ]5Doٛ@iVl/Rћ12HݼԈZVé~")& l4JJ̍/X+ґ;/RgwLU *utmKYh9 R-5 LKN;}dcil|c7lEDfoYG>R28N;V@Z%R,9G r!9}ƝD.[אx-K3)`%\El32TBak:JVzqVO{2WeP˿fUP J0IZ/uy ~VSJ9O>$s%bw<4j2x;5J`GCчJ˹N6%3(w]la,]mÒ͢ B%z6efT$7}b}^W SL軨[06Wfӄs52ev΄wWp7hX0%ڕ=;_;f$8] GN0nZQE@(R}\ĿQVBH'玚AJ~wkvΡvD$]Q9af b;p]cRPt ̤.Y7IOqB!ҧՇ>V*Ө-Z"xչ_q>#S=g3i-,ݝn<ڨC"[rch/DE zF;+EN :9܂#\!inj2S 3ZUu[znUò)9oR'$?SUU뀌Tﬣ` &9{e+ t#;},d~\'Gw_ g߃vg8X!2%YeyE?ćzI!O>w#DVf POG &ڝ[||uő@}6ꁬm4%NaSJ3=l/5ڻ15Ve1Oz9Q|ۛԐ[ E 𹩯:leWۤ=flJj5gm!'Ս\f˛9{ ފTI]"QX endstream endobj 68 0 obj << /Producer (pdfTeX-1.40.14) /Creator (TeX) /CreationDate (D:20180918171914-07'00') /ModDate (D:20180918171914-07'00') /Trapped /False /PTEX.Fullbanner (This is pdfTeX, Version 3.1415926-2.5-1.40.14 (TeX Live 2013/Debian) kpathsea version 6.1.1) >> endobj 11 0 obj << /Type /ObjStm /N 48 /First 362 /Length 2467 /Filter /FlateDecode >> stream xZ[o۸~9XP,Ф6fn$:Tt!E/8"EQomNH $/n47)?|_CFֹ7]ƼXV{I5S"AkIJn.YSmJd&!]?H]񤟬^`qįzwu?7ezrJ3~:f lL0QR0r5*zYfEViVU8s:ܦ==N6iZ$E$Ӎ:e_)ƃ4XZ=;hxӇc&yJR~nZA߇9N&e}r>uzK5UWP+r:ͺ(yΗbj$\=Co6!sfe,r1WJXŒ'O}FC}AKoS}O?U<x9:ߵo0OPƂ.,]|ո(3~7E>x{pC I1{S DЖ Y &h>6TI  uٰ:FNsxqp4?.fQ˂I/СDD$80o|zG=_co5\F6kb_3VEVvWwش'5_ֶ<L߯C`FOx:̘?_L̪!sX%YEkşab`6DlhEV5#MRs`r/߾zyRw@q4ͱܚ88;9~E)=y |@DSHƵ5MT+B⹰@Y\USeܽHoj՟ZvfS MnB '˶(2e 8#4[1U LJضMO uy Bmkd P٤miݬ%.͗|['[濗a.?"[m$ΊQۤ2_>߲ ? endstream endobj 69 0 obj << /Type /XRef /Index [0 70] /Size 70 /W [1 3 1] /Root 67 0 R /Info 68 0 R /ID [<82A2215286A0DA86B21A552A92CCB674> <82A2215286A0DA86B21A552A92CCB674>] /Length 202 /Filter /FlateDecode >> stream x=NP@]Q: K6!92<P@ZC1/EOH};'Då g"GDo@͵ D\sDQ\ʷ(ӞRT*Be鬉+q/E$F4YMxjs6zu˫K.޽XL_?Y endstream endobj startxref 111073 %%EOF usr/doc/clamav-0.100.2/COPYING.file0100644000000000000000000000352013350521603015141 0ustar rootrootlibclamav/textdet.c includes modified code from file-4.23/src/ascmagic.c. The original LEGAL.NOTICE file for file-4.23 is reproduced below. -------------------------------------------------------------------------- $File: LEGAL.NOTICE,v 1.15 2006/05/03 18:48:33 christos Exp $ Copyright (c) Ian F. Darwin 1986, 1987, 1989, 1990, 1991, 1992, 1994, 1995. Software written by Ian F. Darwin and others; maintained 1994- Christos Zoulas. This software is not subject to any export provision of the United States Department of Commerce, and may be exported to any country or planet. Redistribution and use in source and binary forms, with or without modification, are permitted provided that the following conditions are met: 1. Redistributions of source code must retain the above copyright notice immediately at the beginning of the file, without modification, this list of conditions, and the following disclaimer. 2. Redistributions in binary form must reproduce the above copyright notice, this list of conditions and the following disclaimer in the documentation and/or other materials provided with the distribution. THIS SOFTWARE IS PROVIDED BY THE AUTHOR AND CONTRIBUTORS ``AS IS'' AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE AUTHOR OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. install/0040755000000000000000000000000013365330320011224 5ustar rootrootinstall/slack-desc0100644000000000000000000000200513365330320013152 0ustar rootroot# HOW TO EDIT THIS FILE: # The "handy ruler" below makes it easier to edit a package description. Line # up the first '|' above the ':' following the base package name, and the '|' # on the right side marks the last column you can put a character in. You must # make exactly 11 lines for the formatting to be correct. It's also # customary to leave one space after the ':'. |-----handy-ruler------------------------------------------------------| clamav: clamav (a GPL-ed virus scanner) clamav: clamav: Clam AntiVirus is a GPL anti-virus toolkit for UNIX. The main purpose clamav: of this software is the integration with mail servers (attachment clamav: scanning). The package provides a flexible and scalable multi-threaded clamav: daemon, a command line scanner, and a tool for automatic updating via clamav: Internet. clamav: Most importantly, the virus database is kept up to date . clamav: For setup, see README.slackware in the /usr/doc/clamav-* directory. clamav: clamav: clamav info at http://www.clamav.net/ install/doinst.sh0100644000000000000000000000503013365330320013053 0ustar rootroot# Handle the incoming configuration files: config() { for infile in $1; do NEW="$infile" OLD="`dirname $NEW`/`basename $NEW .new`" # If there's no config file by that name, mv it over: if [ ! -r $OLD ]; then mv $NEW $OLD elif [ "`cat $OLD | md5sum`" = "`cat $NEW | md5sum`" ]; then # toss the redundant copy rm $NEW fi # Otherwise, we leave the .new copy for the admin to consider... done } preserve_perms() { NEW="$1" OLD="$(dirname $NEW)/$(basename $NEW .new)" if [ -e $OLD ]; then cp -a $OLD ${NEW}.incoming cat $NEW > ${NEW}.incoming mv ${NEW}.incoming $NEW fi config $NEW } preserve_perms etc/rc.d/rc.clamav.new config etc/freshclam.conf.new config etc/clamd.conf.new config etc/clamav-milter.conf.new config etc/logrotate.d/clamav.new # Create log files touch var/log/clamav/clamd.log touch var/log/clamav/freshclam.log # Only way to create and use the correct uid and gid on the target system, # is to use chroot: chroot . </dev/null # Add the 'clamav' group if it doesn't already exist: # Actually, the use of "amavis" group is for compatibility with amavisd-new. /usr/sbin/groupadd clamav 2> /dev/null # Add the 'clamav' user if it doesn't already exist: /usr/sbin/useradd -c "ClamAV user" \ -g clamav -s "/bin/false" clamav 2> /dev/null # Restore the correct permissions chown clamav usr/sbin/clamav-milter chmod 4700 usr/sbin/clamav-milter chown -R clamav:clamav var/run/clamav chmod 771 var/run/clamav chown -R clamav:clamav var/log/clamav chmod 770 var/log/clamav chmod 660 var/log/clamav/*.log chown -R clamav:clamav usr/share/clamav chmod 770 usr/share/clamav chmod 660 usr/share/clamav/* EOR ( cd usr/lib64 ; rm -rf libclammspack.so ) ( cd usr/lib64 ; ln -sf libclammspack.so.0.1.0 libclammspack.so ) ( cd usr/lib64 ; rm -rf libclamunrar.so ) ( cd usr/lib64 ; ln -sf libclamunrar.so.7.1.1 libclamunrar.so ) ( cd usr/lib64 ; rm -rf libclamunrar.so.7 ) ( cd usr/lib64 ; ln -sf libclamunrar.so.7.1.1 libclamunrar.so.7 ) ( cd usr/lib64 ; rm -rf libclammspack.so.0 ) ( cd usr/lib64 ; ln -sf libclammspack.so.0.1.0 libclammspack.so.0 ) ( cd usr/lib64 ; rm -rf libclamunrar_iface.so.7 ) ( cd usr/lib64 ; ln -sf libclamunrar_iface.so.7.1.1 libclamunrar_iface.so.7 ) ( cd usr/lib64 ; rm -rf libclamav.so ) ( cd usr/lib64 ; ln -sf libclamav.so.7.1.1 libclamav.so ) ( cd usr/lib64 ; rm -rf libclamav.so.7 ) ( cd usr/lib64 ; ln -sf libclamav.so.7.1.1 libclamav.so.7 ) ( cd usr/lib64 ; rm -rf libclamunrar_iface.so ) ( cd usr/lib64 ; ln -sf libclamunrar_iface.so.7.1.1 libclamunrar_iface.so ) etc/0040755000000000000000000000000013365330317010337 5ustar rootrootetc/logrotate.d/0040755000000000000000000000000013365330317012561 5ustar rootrootetc/logrotate.d/clamav.new0100644000000000000000000000055013365330317014534 0ustar rootroot/var/log/clamav/*.log { su clamav clamav weekly rotate 5 compress delaycompress notifempty missingok create 0660 clamav clamav postrotate /bin/kill -HUP `cat /var/run/clamav/clamd.pid 2>/dev/null` 2>/dev/null || true /bin/kill -HUP `cat /var/run/clamav/freshclam.pid 2>/dev/null` 2>/dev/null || true endscript } etc/clamd.conf.new0100644000000000000000000005512213365330317013060 0ustar rootroot## ## Example config file for the Clam AV daemon ## Please read the clamd.conf(5) manual before editing this file. ## # Comment or remove the line below. #Example # Uncomment this option to enable logging. # LogFile must be writable for the user running daemon. # A full path is required. # Default: disabled LogFile /var/log/clamav/clamd.log # By default the log file is locked for writing - the lock protects against # running clamd multiple times (if want to run another clamd, please # copy the configuration file, change the LogFile variable, and run # the daemon with --config-file option). # This option disables log file locking. # Default: no #LogFileUnlock yes # Maximum size of the log file. # Value of 0 disables the limit. # You may use 'M' or 'm' for megabytes (1M = 1m = 1048576 bytes) # and 'K' or 'k' for kilobytes (1K = 1k = 1024 bytes). To specify the size # in bytes just don't use modifiers. If LogFileMaxSize is enabled, log # rotation (the LogRotate option) will always be enabled. # Default: 1M #LogFileMaxSize 2M # Log time with each message. # Default: no #LogTime yes # Also log clean files. Useful in debugging but drastically increases the # log size. # Default: no #LogClean yes # Use system logger (can work together with LogFile). # Default: no LogSyslog yes # Specify the type of syslog messages - please refer to 'man syslog' # for facility names. # Default: LOG_LOCAL6 LogFacility LOG_MAIL # Enable verbose logging. # Default: no #LogVerbose yes # Enable log rotation. Always enabled when LogFileMaxSize is enabled. # Default: no #LogRotate yes # Enable Prelude output. # Default: no #PreludeEnable yes # # Set the name of the analyzer used by prelude-admin. # Default: ClamAV #PreludeAnalyzerName ClamAV # Log additional information about the infected file, such as its # size and hash, together with the virus name. #ExtendedDetectionInfo yes # This option allows you to save a process identifier of the listening # daemon (main thread). # Default: disabled PidFile /var/run/clamd.pid # Optional path to the global temporary directory. # Default: system specific (usually /tmp or /var/tmp). #TemporaryDirectory /var/tmp # Path to the database directory. # Default: hardcoded (depends on installation options) #DatabaseDirectory /var/lib/clamav # Only load the official signatures published by the ClamAV project. # Default: no #OfficialDatabaseOnly no # The daemon can work in local mode, network mode or both. # Due to security reasons we recommend the local mode. # Path to a local socket file the daemon will listen on. # Default: disabled (must be specified by a user) LocalSocket /var/run/clamav/clamd.socket # Sets the group ownership on the unix socket. # Default: disabled (the primary group of the user running clamd) LocalSocketGroup clamav # Sets the permissions on the unix socket to the specified mode. # Default: disabled (socket is world accessible) LocalSocketMode 660 # Remove stale socket after unclean shutdown. # Default: yes FixStaleSocket yes # TCP port address. # Default: no #TCPSocket 3310 # TCP address. # By default we bind to INADDR_ANY, probably not wise. # Enable the following to provide some degree of protection # from the outside world. This option can be specified multiple # times if you want to listen on multiple IPs. IPv6 is now supported. # Default: no #TCPAddr 127.0.0.1 # Maximum length the queue of pending connections may grow to. # Default: 200 #MaxConnectionQueueLength 30 # Clamd uses FTP-like protocol to receive data from remote clients. # If you are using clamav-milter to balance load between remote clamd daemons # on firewall servers you may need to tune the options below. # Close the connection when the data size limit is exceeded. # The value should match your MTA's limit for a maximum attachment size. # Default: 25M #StreamMaxLength 10M # Limit port range. # Default: 1024 #StreamMinPort 30000 # Default: 2048 #StreamMaxPort 32000 # Maximum number of threads running at the same time. # Default: 10 #MaxThreads 20 # Waiting for data from a client socket will timeout after this time (seconds). # Default: 120 #ReadTimeout 300 # This option specifies the time (in seconds) after which clamd should # timeout if a client doesn't provide any initial command after connecting. # Default: 5 #CommandReadTimeout 5 # This option specifies how long to wait (in milliseconds) if the send buffer # is full. # Keep this value low to prevent clamd hanging # # Default: 500 #SendBufTimeout 200 # Maximum number of queued items (including those being processed by # MaxThreads threads) # It is recommended to have this value at least twice MaxThreads if possible. # WARNING: you shouldn't increase this too much to avoid running out of file # descriptors, # the following condition should hold: # MaxThreads*MaxRecursion + (MaxQueue - MaxThreads) + 6< RLIMIT_NOFILE (usual # max is 1024) # # Default: 100 #MaxQueue 200 # Waiting for a new job will timeout after this time (seconds). # Default: 30 #IdleTimeout 60 # Don't scan files and directories matching regex # This directive can be used multiple times # Default: scan all #ExcludePath ^/proc/ #ExcludePath ^/sys/ # Maximum depth directories are scanned at. # Default: 15 #MaxDirectoryRecursion 20 # Follow directory symlinks. # Default: no #FollowDirectorySymlinks yes # Follow regular file symlinks. # Default: no #FollowFileSymlinks yes # Scan files and directories on other filesystems. # Default: yes #CrossFilesystems yes # Perform a database check. # Default: 600 (10 min) #SelfCheck 600 # Execute a command when virus is found. In the command string %v will # be replaced with the virus name. # Default: no #VirusEvent /usr/local/bin/send_sms 123456789 "VIRUS ALERT: %v" # Run as another user (clamd must be started by root for this option to work) # Default: don't drop privileges User clamav # Stop daemon when libclamav reports out of memory condition. ExitOnOOM yes # Don't fork into background. # Default: no #Foreground yes # Enable debug messages in libclamav. # Default: no #Debug yes # Do not remove temporary files (for debug purposes). # Default: no #LeaveTemporaryFiles yes # Permit use of the ALLMATCHSCAN command. If set to no, clamd will reject # any ALLMATCHSCAN command as invalid. # Default: yes #AllowAllMatchScan no # Detect Possibly Unwanted Applications. # Default: no #DetectPUA yes # Exclude a specific PUA category. This directive can be used multiple times. # See https://github.com/vrtadmin/clamav-faq/blob/master/faq/faq-pua.md for # the complete list of PUA categories. # Default: Load all categories (if DetectPUA is activated) #ExcludePUA NetTool #ExcludePUA PWTool # Only include a specific PUA category. This directive can be used multiple # times. # Default: Load all categories (if DetectPUA is activated) #IncludePUA Spy #IncludePUA Scanner #IncludePUA RAT # In some cases (eg. complex malware, exploits in graphic files, and others), # ClamAV uses special algorithms to provide accurate detection. This option # controls the algorithmic detection. # Default: yes #AlgorithmicDetection yes # This option causes memory or nested map scans to dump the content to disk. # If you turn on this option, more data is written to disk and is available # when the LeaveTemporaryFiles option is enabled. #ForceToDisk yes # This option allows you to disable the caching feature of the engine. By # default, the engine will store an MD5 in a cache of any files that are # not flagged as virus or that hit limits checks. Disabling the cache will # have a negative performance impact on large scans. # Default: no #DisableCache yes ## ## Executable files ## # PE stands for Portable Executable - it's an executable file format used # in all 32 and 64-bit versions of Windows operating systems. This option # allows ClamAV to perform a deeper analysis of executable files and it's also # required for decompression of popular executable packers such as UPX, FSG, # and Petite. If you turn off this option, the original files will still be # scanned, but without additional processing. # Default: yes #ScanPE yes # Certain PE files contain an authenticode signature. By default, we check # the signature chain in the PE file against a database of trusted and # revoked certificates if the file being scanned is marked as a virus. # If any certificate in the chain validates against any trusted root, but # does not match any revoked certificate, the file is marked as whitelisted. # If the file does match a revoked certificate, the file is marked as virus. # The following setting completely turns off authenticode verification. # Default: no #DisableCertCheck yes # Executable and Linking Format is a standard format for UN*X executables. # This option allows you to control the scanning of ELF files. # If you turn off this option, the original files will still be scanned, but # without additional processing. # Default: yes #ScanELF yes # With this option clamav will try to detect broken executables (both PE and # ELF) and mark them as Broken.Executable. # Default: no #DetectBrokenExecutables yes ## ## Documents ## # This option enables scanning of OLE2 files, such as Microsoft Office # documents and .msi files. # If you turn off this option, the original files will still be scanned, but # without additional processing. # Default: yes #ScanOLE2 yes # With this option enabled OLE2 files with VBA macros, which were not # detected by signatures will be marked as "Heuristics.OLE2.ContainsMacros". # Default: no #OLE2BlockMacros no # This option enables scanning within PDF files. # If you turn off this option, the original files will still be scanned, but # without decoding and additional processing. # Default: yes #ScanPDF yes # This option enables scanning within SWF files. # If you turn off this option, the original files will still be scanned, but # without decoding and additional processing. # Default: yes #ScanSWF yes # This option enables scanning xml-based document files supported by libclamav. # If you turn off this option, the original files will still be scanned, but # without additional processing. # Default: yes #ScanXMLDOCS yes # This option enables scanning of HWP3 files. # If you turn off this option, the original files will still be scanned, but # without additional processing. # Default: yes #ScanHWP3 yes ## ## Mail files ## # Enable internal e-mail scanner. # If you turn off this option, the original files will still be scanned, but # without parsing individual messages/attachments. # Default: yes #ScanMail yes # Scan RFC1341 messages split over many emails. # You will need to periodically clean up $TemporaryDirectory/clamav-partial # directory. # WARNING: This option may open your system to a DoS attack. # Never use it on loaded servers. # Default: no #ScanPartialMessages yes # With this option enabled ClamAV will try to detect phishing attempts by using # signatures. # Default: yes #PhishingSignatures yes # Scan URLs found in mails for phishing attempts using heuristics. # Default: yes #PhishingScanURLs yes # Always block SSL mismatches in URLs, even if the URL isn't in the database. # This can lead to false positives. # # Default: no #PhishingAlwaysBlockSSLMismatch no # Always block cloaked URLs, even if URL isn't in database. # This can lead to false positives. # # Default: no #PhishingAlwaysBlockCloak no # Detect partition intersections in raw disk images using heuristics. # Default: no #PartitionIntersection no # Allow heuristic match to take precedence. # When enabled, if a heuristic scan (such as phishingScan) detects # a possible virus/phish it will stop scan immediately. Recommended, saves CPU # scan-time. # When disabled, virus/phish detected by heuristic scans will be reported # only at the end of a scan. If an archive contains both a heuristically # detected virus/phish, and a real malware, the real malware will be reported. # # Keep this disabled if you intend to handle "*.Heuristics.*" viruses # differently from "real" malware. # If a non-heuristically-detected virus (signature-based) is found first, # the scan is interrupted immediately, regardless of this config option. # # Default: no #HeuristicScanPrecedence yes ## ## Data Loss Prevention (DLP) ## # Enable the DLP module # Default: No #StructuredDataDetection yes # This option sets the lowest number of Credit Card numbers found in a file # to generate a detect. # Default: 3 #StructuredMinCreditCardCount 5 # This option sets the lowest number of Social Security Numbers found # in a file to generate a detect. # Default: 3 #StructuredMinSSNCount 5 # With this option enabled the DLP module will search for valid # SSNs formatted as xxx-yy-zzzz # Default: yes #StructuredSSNFormatNormal yes # With this option enabled the DLP module will search for valid # SSNs formatted as xxxyyzzzz # Default: no #StructuredSSNFormatStripped yes ## ## HTML ## # Perform HTML normalisation and decryption of MS Script Encoder code. # Default: yes # If you turn off this option, the original files will still be scanned, but # without additional processing. #ScanHTML yes ## ## Archives ## # ClamAV can scan within archives and compressed files. # If you turn off this option, the original files will still be scanned, but # without unpacking and additional processing. # Default: yes #ScanArchive yes # Mark encrypted archives as viruses (Encrypted.Zip, Encrypted.RAR). # Default: no #ArchiveBlockEncrypted no ## ## Limits ## # The options below protect your system against Denial of Service attacks # using archive bombs. # This option sets the maximum amount of data to be scanned for each input # file. # Archives and other containers are recursively extracted and scanned up to # this value. # Value of 0 disables the limit # Note: disabling this limit or setting it too high may result in severe damage # to the system. # Default: 100M #MaxScanSize 150M # Files larger than this limit won't be scanned. Affects the input file itself # as well as files contained inside it (when the input file is an archive, a # document or some other kind of container). # Value of 0 disables the limit. # Note: disabling this limit or setting it too high may result in severe damage # to the system. # Default: 25M #MaxFileSize 30M # Nested archives are scanned recursively, e.g. if a Zip archive contains a RAR # file, all files within it will also be scanned. This options specifies how # deeply the process should be continued. # Note: setting this limit too high may result in severe damage to the system. # Default: 16 #MaxRecursion 10 # Number of files to be scanned within an archive, a document, or any other # container file. # Value of 0 disables the limit. # Note: disabling this limit or setting it too high may result in severe damage # to the system. # Default: 10000 #MaxFiles 15000 # Maximum size of a file to check for embedded PE. Files larger than this value # will skip the additional analysis step. # Note: disabling this limit or setting it too high may result in severe damage # to the system. # Default: 10M #MaxEmbeddedPE 10M # Maximum size of a HTML file to normalize. HTML files larger than this value # will not be normalized or scanned. # Note: disabling this limit or setting it too high may result in severe damage # to the system. # Default: 10M #MaxHTMLNormalize 10M # Maximum size of a normalized HTML file to scan. HTML files larger than this # value after normalization will not be scanned. # Note: disabling this limit or setting it too high may result in severe damage # to the system. # Default: 2M #MaxHTMLNoTags 2M # Maximum size of a script file to normalize. Script content larger than this # value will not be normalized or scanned. # Note: disabling this limit or setting it too high may result in severe damage # to the system. # Default: 5M #MaxScriptNormalize 5M # Maximum size of a ZIP file to reanalyze type recognition. ZIP files larger # than this value will skip the step to potentially reanalyze as PE. # Note: disabling this limit or setting it too high may result in severe damage # to the system. # Default: 1M #MaxZipTypeRcg 1M # This option sets the maximum number of partitions of a raw disk image to be # scanned. # Raw disk images with more partitions than this value will have up to # the value number partitions scanned. Negative values are not allowed. # Note: setting this limit too high may result in severe damage or impact # performance. # Default: 50 #MaxPartitions 128 # This option sets the maximum number of icons within a PE to be scanned. # PE files with more icons than this value will have up to the value number # icons scanned. # Negative values are not allowed. # WARNING: setting this limit too high may result in severe damage or impact # performance. # Default: 100 #MaxIconsPE 200 # This option sets the maximum recursive calls for HWP3 parsing during # scanning. HWP3 files using more than this limit will be terminated and # alert the user. # Scans will be unable to scan any HWP3 attachments if the recursive limit # is reached. # Negative values are not allowed. # WARNING: setting this limit too high may result in severe damage or impact # performance. # Default: 16 #MaxRecHWP3 16 # This option sets the maximum calls to the PCRE match function during # an instance of regex matching. # Instances using more than this limit will be terminated and alert the user # but the scan will continue. # For more information on match_limit, see the PCRE documentation. # Negative values are not allowed. # WARNING: setting this limit too high may severely impact performance. # Default: 100000 #PCREMatchLimit 20000 # This option sets the maximum recursive calls to the PCRE match function # during an instance of regex matching. # Instances using more than this limit will be terminated and alert the user # but the scan will continue. # For more information on match_limit_recursion, see the PCRE documentation. # Negative values are not allowed and values > PCREMatchLimit are superfluous. # WARNING: setting this limit too high may severely impact performance. # Default: 5000 #PCRERecMatchLimit 10000 # This option sets the maximum filesize for which PCRE subsigs will be # executed. Files exceeding this limit will not have PCRE subsigs executed # unless a subsig is encompassed to a smaller buffer. # Negative values are not allowed. # Setting this value to zero disables the limit. # WARNING: setting this limit too high or disabling it may severely impact # performance. # Default: 25M #PCREMaxFileSize 100M # When BlockMax is set, files exceeding the MaxFileSize, MaxScanSize, or # MaxRecursion limit will be flagged with the virus # "Heuristic.Limits.Exceeded". # Default: no #BlockMax yes ## ## On-access Scan Settings ## # Enable on-access scanning. Currently, this is supported via fanotify. # Clamuko/Dazuko support has been deprecated. # Default: no #ScanOnAccess yes # Set the mount point to be scanned. The mount point specified, or the mount # point containing the specified directory will be watched. If any directories # are specified, this option will preempt the DDD system. This will notify # only. It can be used multiple times. # (On-access scan only) # Default: disabled #OnAccessMountPath / #OnAccessMountPath /home/user # Don't scan files larger than OnAccessMaxFileSize # Value of 0 disables the limit. # Default: 5M #OnAccessMaxFileSize 10M # Set the include paths (all files inside them will be scanned). You can have # multiple OnAccessIncludePath directives but each directory must be added # in a separate line. (On-access scan only) # Default: disabled #OnAccessIncludePath /home #OnAccessIncludePath /students # Set the exclude paths. All subdirectories are also excluded. # (On-access scan only) # Default: disabled #OnAccessExcludePath /home/bofh # With this option you can whitelist the root UID (0). Processes run under # root with be able to access all files without triggering scans or # permission denied events. # Note that if clamd cannot check the uid of the process that generated an # on-access scan event (e.g., because OnAccessPrevention was not enabled, and # the process already exited), clamd will perform a scan. Thus, setting # OnAccessExcludeRootUID is not *guaranteed* to prevent every access by the # root user from triggering a scan (unless OnAccessPrevention is enabled). # Default: no #OnAccessExcludeRootUID no # With this option you can whitelist specific UIDs. Processes with these UIDs # will be able to access all files without triggering scans or permission # denied events. # This option can be used multiple times (one per line). # Using a value of 0 on any line will disable this option entirely. # To whitelist the root UID (0) please enable the OnAccessExcludeRootUID # option. # Also note that if clamd cannot check the uid of the process that generated an # on-access scan event (e.g., because OnAccessPrevention was not enabled, and # the process already exited), clamd will perform a scan. Thus, setting # OnAccessExcludeUID is not *guaranteed* to prevent every access by the # specified uid from triggering a scan (unless OnAccessPrevention is enabled). # Default: disabled #OnAccessExcludeUID -1 # Toggles dynamic directory determination. Allows for recursively watching # include paths. # (On-access scan only) # Default: no #OnAccessDisableDDD yes # Modifies fanotify blocking behaviour when handling permission events. # If off, fanotify will only notify if the file scanned is a virus, # and not perform any blocking. # (On-access scan only) # Default: no #OnAccessPrevention yes # Toggles extra scanning and notifications when a file or directory is # created or moved. # Requires the DDD system to kick-off extra scans. # NOTE: This feature is disabled until a thread resource leak bug # in the OnAccessExtraScanning code can be resolved. # (On-access scan only) # Default: no #OnAccessExtraScanning yes ## ## Bytecode ## # With this option enabled ClamAV will load bytecode from the database. # It is highly recommended you keep this option on, otherwise you'll miss # detections for many new viruses. # Default: yes #Bytecode yes # Set bytecode security level. # Possible values: # None - No security at all, meant for debugging. # DO NOT USE THIS ON PRODUCTION SYSTEMS. # This value is only available if clamav was built # with --enable-debug! # TrustSigned - Trust bytecode loaded from signed .c[lv]d files, insert # runtime safety checks for bytecode loaded from other sources. # Paranoid - Don't trust any bytecode, insert runtime checks for all. # Recommended: TrustSigned, because bytecode in .cvd files already has these # checks. # Note that by default only signed bytecode is loaded, currently you can only # load unsigned bytecode in --enable-debug mode. # # Default: TrustSigned #BytecodeSecurity TrustSigned # Set bytecode timeout in milliseconds. # # Default: 5000 # BytecodeTimeout 1000 ## ## Statistics gathering and submitting ## etc/clamav-milter.conf.new0100644000000000000000000002245713365330317014542 0ustar rootroot## ## Example config file for clamav-milter ## # Comment or remove the line below. Example ## ## Main options ## # Define the interface through which we communicate with sendmail # This option is mandatory! Possible formats are: # [[unix|local]:]/path/to/file - to specify a unix domain socket # inet:port@[hostname|ip-address] - to specify an ipv4 socket # inet6:port@[hostname|ip-address] - to specify an ipv6 socket # # Default: no default #MilterSocket /tmp/clamav-milter.socket #MilterSocket inet:7357 # Define the group ownership for the (unix) milter socket. # Default: disabled (the primary group of the user running clamd) #MilterSocketGroup virusgroup # Sets the permissions on the (unix) milter socket to the specified mode. # Default: disabled (obey umask) #MilterSocketMode 660 # Remove stale socket after unclean shutdown. # # Default: yes #FixStaleSocket yes # Run as another user (clamav-milter must be started by root for this option # to work) # # Default: unset (don't drop privileges) #User clamav # Waiting for data from clamd will timeout after this time (seconds). # Value of 0 disables the timeout. # # Default: 120 #ReadTimeout 300 # Don't fork into background. # # Default: no #Foreground yes # Chroot to the specified directory. # Chrooting is performed just after reading the config file and before # dropping privileges. # # Default: unset (don't chroot) #Chroot /newroot # This option allows you to save a process identifier of the listening # daemon (main thread). # # Default: disabled #PidFile /var/run/clamav-milter.pid # Optional path to the global temporary directory. # Default: system specific (usually /tmp or /var/tmp). # #TemporaryDirectory /var/tmp ## ## Clamd options ## # Define the clamd socket to connect to for scanning. # This option is mandatory! Syntax: # ClamdSocket unix:path # ClamdSocket tcp:host:port # The first syntax specifies a local unix socket (needs an absolute path) e.g.: # ClamdSocket unix:/var/run/clamd/clamd.socket # The second syntax specifies a tcp local or remote tcp socket: the # host can be a hostname or an ip address; the ":port" field is only required # for IPv6 addresses, otherwise it defaults to 3310, e.g.: # ClamdSocket tcp:192.168.0.1 # # This option can be repeated several times with different sockets or even # with the same socket: clamd servers will be selected in a round-robin # fashion. # # Default: no default #ClamdSocket tcp:scanner.mydomain:7357 ## ## Exclusions ## # Messages originating from these hosts/networks will not be scanned # This option takes a host(name)/mask pair in CIRD notation and can be # repeated several times. If "/mask" is omitted, a host is assumed. # To specify a locally originated, non-smtp, email use the keyword "local" # # Default: unset (scan everything regardless of the origin) #LocalNet local #LocalNet 192.168.0.0/24 #LocalNet 1111:2222:3333::/48 # This option specifies a file which contains a list of basic POSIX regular # expressions. Addresses (sent to or from - see below) matching these regexes # will not be scanned. Optionally each line can start with the string "From:" # or "To:" (note: no whitespace after the colon) indicating if it is, # respectively, the sender or recipient that is to be whitelisted. # If the field is missing, "To:" is assumed. # Lines starting with #, : or ! are ignored. # # Default unset (no exclusion applied) #Whitelist /etc/whitelisted_addresses # Messages from authenticated SMTP users matching this extended POSIX # regular expression (egrep-like) will not be scanned. # As an alternative, a file containing a plain (not regex) list of names (one # per line) can be specified using the prefix "file:". # e.g. SkipAuthenticated file:/etc/good_guys # # Note: this is the AUTH login name! # # Default: unset (no whitelisting based on SMTP auth) #SkipAuthenticated ^(tom|dick|henry)$ # Messages larger than this value won't be scanned. # Make sure this value is lower or equal than StreamMaxLength in clamd.conf # # Default: 25M #MaxFileSize 10M ## ## Actions ## # The following group of options controls the delivery process under # different circumstances. # The following actions are available: # - Accept # The message is accepted for delivery # - Reject # Immediately refuse delivery (a 5xx error is returned to the peer) # - Defer # Return a temporary failure message (4xx) to the peer # - Blackhole (not available for OnFail) # Like Accept but the message is sent to oblivion # - Quarantine (not available for OnFail) # Like Accept but message is quarantined instead of being delivered # # NOTE: In Sendmail the quarantine queue can be examined via mailq -qQ # For Postfix this causes the message to be placed on hold # # Action to be performed on clean messages (mostly useful for testing) # Default: Accept #OnClean Accept # Action to be performed on infected messages # Default: Quarantine #OnInfected Quarantine # Action to be performed on error conditions (this includes failure to # allocate data structures, no scanners available, network timeouts, # unknown scanner replies and the like) # Default: Defer #OnFail Defer # This option allows to set a specific rejection reason for infected messages # and it's therefore only useful together with "OnInfected Reject" # The string "%v", if present, will be replaced with the virus name. # Default: MTA specific #RejectMsg # If this option is set to "Replace" (or "Yes"), an "X-Virus-Scanned" and an # "X-Virus-Status" headers will be attached to each processed message, possibly # replacing existing headers. # If it is set to Add, the X-Virus headers are added possibly on top of the # existing ones. # Note that while "Replace" can potentially break DKIM signatures, "Add" may # confuse procmail and similar filters. # Default: no #AddHeader Replace # When AddHeader is in use, this option allows to arbitrary set the reported # hostname. This may be desirable in order to avoid leaking internal names. # If unset the real machine name is used. # Default: disabled #ReportHostname my.mail.server.name # Execute a command (possibly searching PATH) when an infected message is # found. # The following parameters are passed to the invoked program in this order: # virus name, queue id, sender, destination, subject, message id, message date. # Note #1: this requires MTA macroes to be available (see LogInfected below) # Note #2: the process is invoked in the context of clamav-milter # Note #3: clamav-milter will wait for the process to exit. Be quick or fork to # avoid unnecessary delays in email delivery # Default: disabled #VirusAction /usr/local/bin/my_infected_message_handler ## ## Logging options ## # Uncomment this option to enable logging. # LogFile must be writable for the user running daemon. # A full path is required. # # Default: disabled #LogFile /tmp/clamav-milter.log # By default the log file is locked for writing - the lock protects against # running clamav-milter multiple times. # This option disables log file locking. # # Default: no #LogFileUnlock yes # Maximum size of the log file. # Value of 0 disables the limit. # You may use 'M' or 'm' for megabytes (1M = 1m = 1048576 bytes) # and 'K' or 'k' for kilobytes (1K = 1k = 1024 bytes). To specify the size # in bytes just don't use modifiers. If LogFileMaxSize is enabled, log # rotation (the LogRotate option) will always be enabled. # # Default: 1M #LogFileMaxSize 2M # Log time with each message. # # Default: no #LogTime yes # Use system logger (can work together with LogFile). # # Default: no #LogSyslog yes # Specify the type of syslog messages - please refer to 'man syslog' # for facility names. # # Default: LOG_LOCAL6 #LogFacility LOG_MAIL # Enable verbose logging. # # Default: no #LogVerbose yes # Enable log rotation. Always enabled when LogFileMaxSize is enabled. # Default: no #LogRotate yes # This option allows to tune what is logged when a message is infected. # Possible values are Off (the default - nothing is logged), # Basic (minimal info logged), Full (verbose info logged) # Note: # For this to work properly in sendmail, make sure the msg_id, mail_addr, # rcpt_addr and i macroes are available in eom. In other words add a line like: # Milter.macros.eom={msg_id}, {mail_addr}, {rcpt_addr}, i # to your .cf file. Alternatively use the macro: # define(`confMILTER_MACROS_EOM', `{msg_id}, {mail_addr}, {rcpt_addr}, i') # Postfix should be working fine with the default settings. # # Default: disabled #LogInfected Basic # This option allows to tune what is logged when no threat is found in # a scanned message. # See LogInfected for possible values and caveats. # Useful in debugging but drastically increases the log size. # Default: disabled #LogClean Basic # This option affects the behaviour of LogInfected, LogClean and VirusAction # when a message with multiple recipients is scanned: # If SupportMultipleRecipients is off (the default) # then one single log entry is generated for the message and, in case the # message is determined to be malicious, the command indicated by VirusAction # is executed just once. In both cases only the last recipient is reported. # If SupportMultipleRecipients is on: # then one line is logged for each recipient and the command indicated # by VirusAction is also executed once for each recipient. # # Note: although it's probably a good idea to enable this option, the default # value # is currently set to off for legacy reasons. # Default: no #SupportMultipleRecipients yes etc/freshclam.conf.new0100644000000000000000000001446113365330317013745 0ustar rootroot## ## Example config file for freshclam ## Please read the freshclam.conf(5) manual before editing this file. ## # Comment or remove the line below. #Example # Path to the database directory. # WARNING: It must match clamd.conf's directive! # Default: hardcoded (depends on installation options) #DatabaseDirectory /var/lib/clamav # Path to the log file (make sure it has proper permissions) # Default: disabled UpdateLogFile /var/log/clamav/freshclam.log # Maximum size of the log file. # Value of 0 disables the limit. # You may use 'M' or 'm' for megabytes (1M = 1m = 1048576 bytes) # and 'K' or 'k' for kilobytes (1K = 1k = 1024 bytes). # in bytes just don't use modifiers. If LogFileMaxSize is enabled, # log rotation (the LogRotate option) will always be enabled. # Default: 1M #LogFileMaxSize 2M # Log time with each message. # Default: no #LogTime yes # Enable verbose logging. # Default: no #LogVerbose yes # Use system logger (can work together with UpdateLogFile). # Default: no LogSyslog yes # Specify the type of syslog messages - please refer to 'man syslog' # for facility names. # Default: LOG_LOCAL6 LogFacility LOG_MAIL # Enable log rotation. Always enabled when LogFileMaxSize is enabled. # Default: no #LogRotate yes # This option allows you to save the process identifier of the daemon # Default: disabled PidFile /var/run/clamav/freshclam.pid # By default when started freshclam drops privileges and switches to the # "clamav" user. This directive allows you to change the database owner. # Default: clamav (may depend on installation options) DatabaseOwner clamav # Use DNS to verify virus database version. Freshclam uses DNS TXT records # to verify database and software versions. With this directive you can change # the database verification domain. # WARNING: Do not touch it unless you're configuring freshclam to use your # own database verification domain. # Default: current.cvd.clamav.net #DNSDatabaseInfo current.cvd.clamav.net # database.clamav.net is now the primary domain name to be used world-wide. # Now that CloudFlare is being used as our Content Delivery Network (CDN), # this one domain name works world-wide to direct freshclam to the closest # geographic endpoint. DatabaseMirror database.clamav.net # How many attempts to make before giving up. # Default: 3 (per mirror) #MaxAttempts 5 # With this option you can control scripted updates. It's highly recommended # to keep it enabled. # Default: yes #ScriptedUpdates yes # By default freshclam will keep the local databases (.cld) uncompressed to # make their handling faster. With this option you can enable the compression; # the change will take effect with the next database update. # Default: no #CompressLocalDatabase no # With this option you can provide custom sources (http:// or file://) for # database files. This option can be used multiple times. # Default: no custom URLs #DatabaseCustomURL http://myserver.com/mysigs.ndb #DatabaseCustomURL file:///mnt/nfs/local.hdb # This option allows you to easily point freshclam to private mirrors. # If PrivateMirror is set, freshclam does not attempt to use DNS # to determine whether its databases are out-of-date, instead it will # use the If-Modified-Since request or directly check the headers of the # remote database files. For each database, freshclam first attempts # to download the CLD file. If that fails, it tries to download the # CVD file. This option overrides DatabaseMirror, DNSDatabaseInfo # and ScriptedUpdates. It can be used multiple times to provide # fall-back mirrors. # Default: disabled #PrivateMirror mirror1.mynetwork.com #PrivateMirror mirror2.mynetwork.com # Number of database checks per day. # Default: 12 (every two hours) #Checks 24 # Proxy settings # Default: disabled #HTTPProxyServer myproxy.com #HTTPProxyPort 1234 #HTTPProxyUsername myusername #HTTPProxyPassword mypass # If your servers are behind a firewall/proxy which applies User-Agent # filtering you can use this option to force the use of a different # User-Agent header. # Default: clamav/version_number #HTTPUserAgent SomeUserAgentIdString # Use aaa.bbb.ccc.ddd as client address for downloading databases. Useful for # multi-homed systems. # Default: Use OS'es default outgoing IP address. #LocalIPAddress aaa.bbb.ccc.ddd # Send the RELOAD command to clamd. # Default: no NotifyClamd /etc/clamd.conf # Run command after successful database update. # Default: disabled #OnUpdateExecute command # Run command when database update process fails. # Default: disabled #OnErrorExecute command # Run command when freshclam reports outdated version. # In the command string %v will be replaced by the new version number. # Default: disabled #OnOutdatedExecute command # Don't fork into background. # Default: no #Foreground yes # Enable debug messages in libclamav. # Default: no #Debug yes # Timeout in seconds when connecting to database server. # Default: 30 #ConnectTimeout 60 # Timeout in seconds when reading from database server. # Default: 30 #ReceiveTimeout 60 # With this option enabled, freshclam will attempt to load new # databases into memory to make sure they are properly handled # by libclamav before replacing the old ones. # Default: yes #TestDatabases yes # This option enables support for Google Safe Browsing. When activated for # the first time, freshclam will download a new database file # (safebrowsing.cvd) which will be automatically loaded by clamd and # clamscan during the next reload, provided that the heuristic phishing # detection is turned on. This database includes information about websites # that may be phishing sites or possible sources of malware. When using this # option, it's mandatory to run freshclam at least every 30 minutes. # Freshclam uses the ClamAV's mirror infrastructure to distribute the # database and its updates but all the contents are provided under Google's # terms of use. See https://www.google.com/transparencyreport/safebrowsing # and https://www.clamav.net/documents/safebrowsing # for more information. # Default: disabled #SafeBrowsing yes # This option enables downloading of bytecode.cvd, which includes additional # detection mechanisms and improvements to the ClamAV engine. # Default: enabled #Bytecode yes # Download an additional 3rd party signature database distributed through # the ClamAV mirrors. # This option can be used multiple times. #ExtraDatabase dbname1 #ExtraDatabase dbname2 etc/rc.d/0040755000000000000000000000000013365330317011165 5ustar rootrootetc/rc.d/rc.clamav.new0100755000000000000000000000313613365330317013551 0ustar rootroot#!/bin/sh # Start/stop/restart clamav. # $Id: rc.clamav,v 1.4 2017/08/07 19:00:49 root Exp root $ # Author: Eric Hameleers # --------------------------------------------------------------------------- # Set to '1' if you want milter support: MILTER=0 # Start clamav: clamav_start() { # Remove zero-size db files - they are initial package placeholders: for DBFILE in /usr/share/clamav/main.cvd /usr/share/clamav/daily.cvd /usr/share/clamav/bytecode.cvd /usr/share/clamav/mirrors.dat ]; do if [ ! -s $DBFILE ]; then rm -f $DBFILE fi done if [ -x /usr/sbin/clamd ]; then echo -n "Starting clamd daemon: /usr/sbin/clamd " /usr/sbin/clamd echo "." # Give clamd a chance to create the socket sleep 1 echo -n "Starting freshclam daemon: /usr/bin/freshclam -d -l /var/log/clamav/freshclam.log " /usr/bin/freshclam -d -l /var/log/clamav/freshclam.log echo "." if [ "$MILTER" == "1" ]; then echo -n "Starting clamav-milter daemon: /usr/sbin/clamav-milter -dblo --max-children=2 local:/var/run/clamav/clmilter.sock " /usr/sbin/clamav-milter -dblo --max-children=2 local:/var/run/clamav/clmilter.sock echo "." fi fi } # Stop clamav: clamav_stop() { kill $(cat /var/run/clamav/clamd.pid) #killall freshclam kill $(cat /var/run/clamav/freshclam.pid) [ "$MILTER" == "1" ] && killall clamav-milter } # Restart clamav: clamav_restart() { clamav_stop sleep 1 clamav_start } case "$1" in 'start') clamav_start ;; 'stop') clamav_stop ;; 'restart') clamav_restart ;; *) echo "usage $0 start|stop|restart" esac var/0040755000000000000000000000000013365330317010354 5ustar rootrootvar/log/0040755000000000000000000000000013365330317011135 5ustar rootrootvar/log/clamav/0040755000000000000000000000000013365330317012400 5ustar rootrootvar/run/0040755000000000000000000000000013365330317011160 5ustar rootrootvar/run/clamav/0040755000000000000000000000000013365330317012423 5ustar rootroot
next up previous contents
Next: Documents Up: Supported formats and features Previous: Mail files   Contents